Basic Information | |
---|---|
Family ID | F082396 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 42 residues |
Representative Sequence | MTHRIVVNVETGVTTQVEYTPEEQAIHDAAVAAQQAEA |
Number of Associated Samples | 83 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 95.83 % |
% of genes near scaffold ends (potentially truncated) | 22.12 % |
% of genes from short scaffolds (< 2000 bps) | 42.48 % |
Associated GOLD sequencing projects | 79 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (43.363 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (26.549 % of family members) |
Environment Ontology (ENVO) | Unclassified (54.867 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.257 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.76% β-sheet: 18.18% Coil/Unstructured: 56.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF08291 | Peptidase_M15_3 | 3.54 |
PF13392 | HNH_3 | 1.77 |
PF07883 | Cupin_2 | 0.88 |
PF13662 | Toprim_4 | 0.88 |
PF09636 | XkdW | 0.88 |
PF13539 | Peptidase_M15_4 | 0.88 |
PF10124 | Mu-like_gpT | 0.88 |
PF00149 | Metallophos | 0.88 |
PF01391 | Collagen | 0.88 |
PF00959 | Phage_lysozyme | 0.88 |
PF13884 | Peptidase_S74 | 0.88 |
PF03245 | Phage_lysis | 0.88 |
PF00166 | Cpn10 | 0.88 |
PF11134 | Phage_stabilise | 0.88 |
PF13508 | Acetyltransf_7 | 0.88 |
PF11351 | GTA_holin_3TM | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 56.64 % |
Unclassified | root | N/A | 43.36 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002091|JGI24028J26656_1009281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1251 | Open in IMG/M |
3300002091|JGI24028J26656_1013199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 940 | Open in IMG/M |
3300002091|JGI24028J26656_1014225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 885 | Open in IMG/M |
3300002091|JGI24028J26656_1016573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 779 | Open in IMG/M |
3300002092|JGI24218J26658_1005403 | All Organisms → Viruses → Predicted Viral | 2580 | Open in IMG/M |
3300002930|Water_100030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33260 | Open in IMG/M |
3300003852|Ga0031655_10075108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1408 | Open in IMG/M |
3300004240|Ga0007787_10330348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
3300004448|Ga0065861_1010504 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300005955|Ga0073922_1020288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
3300006802|Ga0070749_10003916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9900 | Open in IMG/M |
3300006802|Ga0070749_10024824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3772 | Open in IMG/M |
3300006863|Ga0075459_1082173 | Not Available | 550 | Open in IMG/M |
3300008113|Ga0114346_1058021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. NFPP12 | 1899 | Open in IMG/M |
3300008120|Ga0114355_1000931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 26110 | Open in IMG/M |
3300008450|Ga0114880_1027982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2543 | Open in IMG/M |
3300009068|Ga0114973_10059494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2233 | Open in IMG/M |
3300009151|Ga0114962_10732738 | Not Available | 503 | Open in IMG/M |
3300009152|Ga0114980_10010561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5946 | Open in IMG/M |
3300009152|Ga0114980_10011469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5672 | Open in IMG/M |
3300009160|Ga0114981_10204900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1081 | Open in IMG/M |
3300009160|Ga0114981_10479840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300009180|Ga0114979_10513795 | Not Available | 691 | Open in IMG/M |
3300009183|Ga0114974_10321317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 905 | Open in IMG/M |
3300009184|Ga0114976_10058808 | All Organisms → Viruses → Predicted Viral | 2249 | Open in IMG/M |
3300009502|Ga0114951_10093553 | Not Available | 1721 | Open in IMG/M |
3300010885|Ga0133913_11358389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1811 | Open in IMG/M |
3300013285|Ga0136642_1003980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5355 | Open in IMG/M |
3300013295|Ga0170791_16227656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
3300017707|Ga0181363_1019029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1358 | Open in IMG/M |
3300017707|Ga0181363_1019333 | All Organisms → Viruses → Predicted Viral | 1346 | Open in IMG/M |
3300017716|Ga0181350_1028289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1549 | Open in IMG/M |
3300017716|Ga0181350_1126002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300017747|Ga0181352_1147287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300017754|Ga0181344_1034831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1532 | Open in IMG/M |
3300017761|Ga0181356_1159987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Paludibacterium → Paludibacterium purpuratum | 692 | Open in IMG/M |
3300017766|Ga0181343_1206651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300017778|Ga0181349_1110175 | All Organisms → Viruses → Predicted Viral | 1023 | Open in IMG/M |
3300017778|Ga0181349_1174526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
3300017784|Ga0181348_1020701 | All Organisms → Viruses → Predicted Viral | 2803 | Open in IMG/M |
3300019784|Ga0181359_1265688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300021354|Ga0194047_10133428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1025 | Open in IMG/M |
3300021519|Ga0194048_10020298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2892 | Open in IMG/M |
3300021952|Ga0213921_1000090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34832 | Open in IMG/M |
3300021956|Ga0213922_1010028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2650 | Open in IMG/M |
3300021956|Ga0213922_1109229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
3300021961|Ga0222714_10432216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
3300021963|Ga0222712_10021421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5361 | Open in IMG/M |
3300022179|Ga0181353_1031426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1407 | Open in IMG/M |
3300022752|Ga0214917_10008898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9749 | Open in IMG/M |
3300022925|Ga0255773_10407279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300024289|Ga0255147_1027428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1168 | Open in IMG/M |
3300025635|Ga0208147_1006305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3408 | Open in IMG/M |
3300025889|Ga0208644_1001001 | Not Available | 24441 | Open in IMG/M |
3300027608|Ga0208974_1022687 | All Organisms → Viruses → Predicted Viral | 1936 | Open in IMG/M |
3300027733|Ga0209297_1000085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 64849 | Open in IMG/M |
3300027733|Ga0209297_1072333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1519 | Open in IMG/M |
3300027734|Ga0209087_1060410 | Not Available | 1700 | Open in IMG/M |
3300027734|Ga0209087_1232500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
3300027798|Ga0209353_10307012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300027896|Ga0209777_10010873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9610 | Open in IMG/M |
3300027973|Ga0209298_10000131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 44380 | Open in IMG/M |
3300029753|Ga0135224_1019775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300031707|Ga0315291_10977644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
3300031772|Ga0315288_10462013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1265 | Open in IMG/M |
3300031772|Ga0315288_11584679 | Not Available | 535 | Open in IMG/M |
3300031857|Ga0315909_10823374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
3300031999|Ga0315274_10133481 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3176 | Open in IMG/M |
3300032092|Ga0315905_10804980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. NFPP12 | 817 | Open in IMG/M |
3300032116|Ga0315903_11070503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300034062|Ga0334995_0394296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 869 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 26.55% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.93% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 5.31% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.31% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 4.42% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.42% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.42% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.54% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.54% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.65% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.65% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.65% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.65% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.77% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.77% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.77% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.77% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.77% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.89% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.89% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.89% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.89% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.89% |
Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.89% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.89% |
Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
3300006014 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012771 | Freshwater microbial communities from Lake Croche, Canada - C_130625_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024512 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_0h | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300029753 | Marine harbor viral communities from the Indian Ocean - SRH3 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24028J26656_10092812 | 3300002091 | Lentic | MTHRIVVNVETGVTTQVEYTPEEQAAYDAAVAAQQAETPPSETPA* |
JGI24028J26656_10131993 | 3300002091 | Lentic | MTHRIVVDVQTGEVAQVEYTPEEQAEYDAAVAAQATVVQEEPQP* |
JGI24028J26656_10142254 | 3300002091 | Lentic | MTHRIEVNVETGETKVIEYTPEEQAAYDAAVAAQQAETPPSETPA* |
JGI24028J26656_10165731 | 3300002091 | Lentic | MTHRIEVNVETGEVKQIEYTPEEQAAYDAAIAAQQAETPPSETPA* |
JGI24218J26658_10054033 | 3300002092 | Lentic | MTHRIVVNVETGEVAQVEYTPEEQAAYDAAVAEQAAQSTEHQS* |
Water_10003026 | 3300002930 | Estuary Water | MTHRIEVNVETGVTTQVEYTPEEQAAYDAAVAAQQAETPPSETPA* |
Ga0031655_100223912 | 3300003852 | Freshwater Lake Sediment | MHRIVVDVQTGEVTQVEYTAEEQAAYDAAIATQNEGASQ* |
Ga0031655_100751084 | 3300003852 | Freshwater Lake Sediment | MHRIVVDVQTGEVTQVEYTAEEQAAYDAAIAAQALEQPPTA* |
Ga0007787_103303481 | 3300004240 | Freshwater Lake | MTHRTVVNCETGEVTQVEYTPEEQAAYDAAVAAQQAEAEQPTEEQLP* |
Ga0065861_10105043 | 3300004448 | Marine | MTHRIVVNVQTGEVTQVEYTAEEQAAYDAAVAQQQQEQQNNEHS* |
Ga0068876_105945562 | 3300005527 | Freshwater Lake | MTHRIVVNVETGVTSIVEYTAEEQAIHDAAVAAQQA |
Ga0073922_10202882 | 3300005955 | Sand | MTHRIVVDLQTGVITQVEYTPEEQAVHDVAVAAQQNENIEPEQNI* |
Ga0073919_10271992 | 3300006014 | Sand | MTHRIVVNVETGVVTQVEYTAEEQAVHDAAVAAQALAEAAA |
Ga0070749_1000391610 | 3300006802 | Aqueous | MTHRIVVNVQTGETTIVEYTPEEQAAHDAAVAAQPAQEEQPNGQS* |
Ga0070749_100248243 | 3300006802 | Aqueous | MTHRIVVNVQTGETTQVEYTPEEQAIHDAAVAAQQAEQPAPEQGTTS* |
Ga0075459_10821732 | 3300006863 | Aqueous | MTHRIVVNVQTGETTIVEYTPEEQAEHDATVAQEAKQQQEQQNNPA* |
Ga0099846_12389771 | 3300007542 | Aqueous | MTHRIVVNVQTGETKIIEYTPEEQAAHDAAVAAQL |
Ga0102859_11473202 | 3300007708 | Estuarine | MTHRIVVNVETGVTTQVEYTAEEQAVHDAAVAAQEAAEAA |
Ga0114346_10580211 | 3300008113 | Freshwater, Plankton | MTHRIVVNVQTGETTQVEYTAEEQAIHDAAVAAQQAEA |
Ga0114346_13083192 | 3300008113 | Freshwater, Plankton | MKDKKMTHRIVVNVETGVTTQVEYTPEEQAIHDAAVAAQQ |
Ga0114355_10009317 | 3300008120 | Freshwater, Plankton | MTHRIVVNVQTGETTQVEYTAEAQALAEAQALAVAAQPTPEQGTTNGS* |
Ga0114363_11351952 | 3300008266 | Freshwater, Plankton | MTHRIVVNVETGVTTQVEYTPEEQAIHDAAVAAQQAEA |
Ga0114880_10279821 | 3300008450 | Freshwater Lake | MTHRIVVNVQTGETTQVEYTPEEQAIHDAAVAAQVAAEAQALAEAQA |
Ga0114880_10760651 | 3300008450 | Freshwater Lake | MKDKKMTHRIVVNVETGVTTQVEYTPEEQAIHDAAVAAQLAEAE |
Ga0114880_12620111 | 3300008450 | Freshwater Lake | MKDKKMTHRIVVNVETGVTTQVEYTPEEQAIHDAAVAA |
Ga0102864_10113095 | 3300009051 | Estuarine | MTHRIVVNVETGEVTQVEYTAEEQTTHDAAVAAQEAAAEA |
Ga0114973_100594942 | 3300009068 | Freshwater Lake | MTHRIVVNVETGEVTQVEYTAEEQAAYDAAVAQQQQEQQNNEHS* |
Ga0105099_101154504 | 3300009082 | Freshwater Sediment | MHRIVVDLQTGTITQVEYTAEEQAAYDAAIAEQQAVEPTEGEQV* |
Ga0114962_107327382 | 3300009151 | Freshwater Lake | MTHRIEVNVETGETKVIEYTPEEQAAYDAAVAAQQQEQQPS* |
Ga0114980_100105612 | 3300009152 | Freshwater Lake | MTHRIEVNVQTGETTFIEYTPEEQATYDAAVAAQQAEQQAQPPAEQGVQT* |
Ga0114980_100114691 | 3300009152 | Freshwater Lake | MTHRIVVNVETGEVTQVEYTAEEQAAYDAAVAQQAAELEAQQAAEAQAQ |
Ga0114981_102049003 | 3300009160 | Freshwater Lake | MTHRIVVNVETGEVTQVEYTPEEQAIHDAAVAQQQQEQQNNEHS* |
Ga0114981_104798402 | 3300009160 | Freshwater Lake | MTHKIEIDVQTDEVKVIEYTAEERAAYDAAVAQQAAELKAQQTAEAQAQQ |
Ga0105096_102027903 | 3300009170 | Freshwater Sediment | MTHRIVVNVETGVTSIVEYTAEEQAIHDAAVAAQQAEA |
Ga0114979_105137951 | 3300009180 | Freshwater Lake | MTHRIVVNVQTGEVTQVEYTAEEQAAYDAAVAQQAAELEAQQAAE |
Ga0114974_103213172 | 3300009183 | Freshwater Lake | MTHRIVVNVETGEVTQVEYTAEEQAAYDAAVAAQQAQEQQAPTQGA* |
Ga0114976_100588083 | 3300009184 | Freshwater Lake | MTHRIVVNVETGEVTQIEYTAEEQAAYDAAVAQQQQEQQNNEHS* |
Ga0114951_100935531 | 3300009502 | Freshwater | VETGEVTQVEYTPEEQAAYDAAVAAQQIEQPTEPQS* |
Ga0133913_113583892 | 3300010885 | Freshwater Lake | MTHRIVVNVETGEVTQVEYTAEEQAAYDAAVAAQQAQTPPPTEPTA* |
Ga0133913_122323491 | 3300010885 | Freshwater Lake | MTHRIVVNVETGEVTQVEYTAEEQAAYDAAVAQQQ |
Ga0139557_10345732 | 3300011010 | Freshwater | MTHRIVVNCETGIVTQVEYTAEEQAVHDAAVAAQQ |
Ga0153799_10428181 | 3300012012 | Freshwater | MTHRIEVNVETGVTTQVEYTAEEQAGHDAAVAQQAAEAARLAARPPAQGA* |
Ga0153805_10685491 | 3300012013 | Surface Ice | HRIEVNVETGVTTQVEYTAEEQAGHDAAVAQQAAEAARLAARPPAQGA* |
Ga0138270_12739971 | 3300012771 | Freshwater Lake | MTHRIVVNVETGEVTQVEYTAEEQAAYDAAVAQQQQ |
Ga0136642_10039804 | 3300013285 | Freshwater | MTHRIEINVQTGETKVIEYTPEEQAAYDAAIAAQQAETPPPTEPTA* |
Ga0170791_162276563 | 3300013295 | Freshwater | MTHRIVVNVETGEVTQVEYTAEEQAAYDAAVAQQAAELKAQQTAEAQAQ |
Ga0119960_10927032 | 3300014811 | Aquatic | MTHRIVVDVQTGEVTQVEYTPEEQAAYEAALAAQQAQ* |
Ga0181363_10190293 | 3300017707 | Freshwater Lake | MTHRTVVNCETGEVTQVEYTPEEQAAYDAAVAAQQAEAEQPTEEQLT |
Ga0181363_10193331 | 3300017707 | Freshwater Lake | MAHRIVVNCETGEVTQVEYTAEEQAAYDAAVAAQQSQEQASQTESA |
Ga0181350_10282894 | 3300017716 | Freshwater Lake | MTHRIVVNVETGVTTQVEYTAEEQAAHDAAVAAQAEAQVNAPTQQ |
Ga0181350_11260021 | 3300017716 | Freshwater Lake | MTHRIVVNVETGVTSIVEYTPEEQAIHDAAVAAQQAEAEAKALAEAQA |
Ga0181352_11472872 | 3300017747 | Freshwater Lake | MTHRIVVNCETGEVTQVEYTAEEQAAHDAAVAAQQAEAEQPTEEQLP |
Ga0181344_10348313 | 3300017754 | Freshwater Lake | MTHRIVVNCETGEVTQVEYTPEEQAAYDAAVAAQQAEAEQPTEEQLT |
Ga0181356_11566501 | 3300017761 | Freshwater Lake | MTHRIVVNCETGAVTQVEYTPEEQAAHDAAVVAQQAEA |
Ga0181356_11599872 | 3300017761 | Freshwater Lake | MTHRIVVDLQTGITTQVEYTPEEQAIHDAAVAAQQAAELAAQQ |
Ga0181343_12066511 | 3300017766 | Freshwater Lake | MTHRTVVNCETGEVTQVEYTPEEQAAHDAAVAAQQAEAEQSTEEQLA |
Ga0181358_11047794 | 3300017774 | Freshwater Lake | MTHRSVVNCKTGVVTQVEYTPEEQAAHDAAVVAQQ |
Ga0181357_11230741 | 3300017777 | Freshwater Lake | MTHRIVVNVETGVVTQVEYTAEEQAVHDAALAAQALAEAQ |
Ga0181357_11465152 | 3300017777 | Freshwater Lake | MTHRIVVNVETGVVTQVEYTAEEQAVHDAAVAAQA |
Ga0181357_12324582 | 3300017777 | Freshwater Lake | MTHRIEVNATTGETKMVEYTADEQAAHDAAVAAQQAAAAA |
Ga0181349_11101753 | 3300017778 | Freshwater Lake | MTHRIVVDLQTGVTIQVEYTPEEQAAHDAAVAAQQAAETPIEPVAE |
Ga0181349_11591612 | 3300017778 | Freshwater Lake | MTHRIVVDLQTGVTTQIEYTPEEQAVHDAAVAAELA |
Ga0181349_11745263 | 3300017778 | Freshwater Lake | MTHRIVVNVETGVTTQVEYTAEEQAAHDAAVAAQAEAQAL |
Ga0181348_10207016 | 3300017784 | Freshwater Lake | MTHRIVVNVETGVTTQVEYTAEEQAVHDAAVAAQVAEAQALADAQALADA |
Ga0181348_10771703 | 3300017784 | Freshwater Lake | MTHRIVVDLQTGVTTQVEYTPEEQAAHDAAVAAELAA |
Ga0181355_11314921 | 3300017785 | Freshwater Lake | MTHRIVVNVETGVTAQVEYTAEEQAVHDAAVAAQALAEA |
Ga0181359_10805191 | 3300019784 | Freshwater Lake | MTHRIVVNCETGAVTQVEYTPEEQVVHDAAVAAEAQALA |
Ga0181359_12656881 | 3300019784 | Freshwater Lake | MTHRIEVNATTGETKMVEYTADEQAAHDAAVAAQQAAEAA |
Ga0194047_101334282 | 3300021354 | Anoxic Zone Freshwater | MTHRIEVNVETGEVKQIEYTPEEQAAYDAAVAQQAAEQSAPTEPAA |
Ga0194048_100202988 | 3300021519 | Anoxic Zone Freshwater | MTHRIEVNCETGVTTQVEYTPEEQAAHDAAVAAQEAETPTQ |
Ga0213921_100009052 | 3300021952 | Freshwater | MTHRIEVNVQTGETKIIEYTPEEQAAHDAAVAAQQAEQPPAEPQ |
Ga0213922_10100283 | 3300021956 | Freshwater | MTHRIVVNVQTGETTIVEYTPEEQAIHDAAVAAQQAEQPATPTEAQ |
Ga0213922_11092292 | 3300021956 | Freshwater | MTHRIVVNVQTGETTQVEYTPEEQAAHDAAVAAQAQEQQATPTEAQ |
Ga0222714_104322162 | 3300021961 | Estuarine Water | MTHRIVVNVQTGEVTQVEYTPEEQAAHDAAVAAQLAEAEAQA |
Ga0222712_100214217 | 3300021963 | Estuarine Water | MTHRIVVNVQTGEVTQVEYTPEEQAAHDAAVAAQLAEAEAQAPTEAAS |
Ga0222712_107880922 | 3300021963 | Estuarine Water | MTHRIVVNVETGVTSIVEYTAEEQAVHDAAVAAQVA |
Ga0181353_10314262 | 3300022179 | Freshwater Lake | MTHRTVVNCETGEVTQVEYTPEEQAAYDAAVAAQQAEAEQPTEEQLP |
Ga0181354_12303971 | 3300022190 | Freshwater Lake | MTHRIVVNVETGVVTQVEYTAEEQAVHDAAVAAQAEAL |
Ga0181351_11120311 | 3300022407 | Freshwater Lake | MTHRIVVDLQTGVTIQVEYTPEEQAAHDAAVAAQQAAET |
Ga0214917_100088983 | 3300022752 | Freshwater | MTHRIVVNVETGEVTQVEYTAEEQAAYDAAVAQQQQEQQNNEHS |
Ga0255773_104072791 | 3300022925 | Salt Marsh | MTHRIEVNCETGITTQVEYTAEEQAVYDAAVAQQEAEAAAEAAR |
Ga0255147_10274284 | 3300024289 | Freshwater | MTHRIVVNVQTGETTIVEYTPEEQAAHDAAVAAQAQAQEQPAPTEGQ |
Ga0255186_10065511 | 3300024512 | Freshwater | MTHRIVVNMGTGVTTQVEYTAEEQAVHDAAVAAQAL |
Ga0208147_10063052 | 3300025635 | Aqueous | MTHRIVVNVQTGETTQVEYTPEEQAIHDAAVAAQQAEQPAPEQGTTS |
Ga0208644_100100110 | 3300025889 | Aqueous | MTHRIVVNVQTGETTIVEYTPEEQAAHDAAVAAQPAQEEQPNGQS |
Ga0208974_10226871 | 3300027608 | Freshwater Lentic | MTHRIVVNVETGVTSIVEYTAEEQAIHDAAVAAQQAEAQALAEAQA |
Ga0209297_100008565 | 3300027733 | Freshwater Lake | MTHRIEVNVQTGETTFIEYTPEEQATYDAAVAAQQAEQQAQPPAEQGVQT |
Ga0209297_10723331 | 3300027733 | Freshwater Lake | MTHRIVVDLQTSTITQVEYTAEEQAVYDAAVAAQVVET |
Ga0209087_10604103 | 3300027734 | Freshwater Lake | MTHRIVVNVETGEVTQIEYTAEEQAAYDAAVAQQQQEQQNNEHS |
Ga0209087_12325001 | 3300027734 | Freshwater Lake | MTHRIVVNVETGEVTQVEYTPEEQAAHDAAVAAQQEQQ |
Ga0209597_10349641 | 3300027746 | Freshwater Lake | MTHRIVVNVETGVTTQVEYTAEEQAAHDAAVAAQEVAA |
Ga0209246_100530981 | 3300027785 | Freshwater Lake | MTHRIVVNVETGVTTQVEYTPEEQAAHDAAVAAQALAEAQAE |
Ga0209353_100418591 | 3300027798 | Freshwater Lake | MTHRIVVNVETGVTSIVEYTPEEQATHDAAVAAQVA |
Ga0209353_103070122 | 3300027798 | Freshwater Lake | MTHRIEVNATTGETKMVEYTADEQAAHDAAVAAQQAEEAALQAEEAA |
Ga0209354_103147741 | 3300027808 | Freshwater Lake | MTHRIVVNVETGVVTQVEYTAEEQAVHDAALAAQALAE |
Ga0209777_1000616419 | 3300027896 | Freshwater Lake Sediment | MHRIVVDVQTGEVTQVEYTAEEQAAYDAAIATQNEGASQ |
Ga0209777_1001087311 | 3300027896 | Freshwater Lake Sediment | MHRIVVDVQTGEVTQVEYTAEEQAAYDAAIAAQALEQPPTA |
Ga0209777_100341138 | 3300027896 | Freshwater Lake Sediment | MHRIVVDCQTGEVTQVEYTAEEQAAYDAAIAEQTA |
Ga0209777_102499694 | 3300027896 | Freshwater Lake Sediment | MHRIVVDCQTGEVTQVEYTAEEQAAYDAAIADQALEQPPTA |
Ga0209298_100001311 | 3300027973 | Freshwater Lake | MTHRIVVNVETGEVTQVEYTAEEQAAYDAAVAQQAAELEAQQAAE |
Ga0135224_10197752 | 3300029753 | Marine Harbor | MTHRIVVNVQTGETTIVEYTPEEQAEYDAAVAAQAQEQQAPSGS |
Ga0315291_109776442 | 3300031707 | Sediment | MTHRIVVNVETGVVSQVEYTPEEQVAYDAAVAQQAAEQAAAEALA |
Ga0315288_104620135 | 3300031772 | Sediment | HRTVVNCETGQVTQVEYTAEEQAAHDAAVAAQQAQEQASPTEPV |
Ga0315288_115846792 | 3300031772 | Sediment | MTHRIVVNVETGEVKQIEYTPEEQAAYDAAVAAQQQQTNESA |
Ga0315909_108233742 | 3300031857 | Freshwater | MKDKKMTHRIVVNVETGVTTQVEYTPEEQAIHDAAVAAQQAEA |
Ga0315901_108465431 | 3300031963 | Freshwater | MTHRIVVNCETGVTSIVEYTPEEQAVHDAAVAAQQAEAEA |
Ga0315274_101334812 | 3300031999 | Sediment | MTHRTVVNCETGQVTQVEYTAEEQAAHDAAVAAQQAQEQASPTEPV |
Ga0315284_112083111 | 3300032053 | Sediment | MTHRIEVNVETGEVKQVEYTPEEQAAHDAAEAARLAAEQ |
Ga0315905_102981885 | 3300032092 | Freshwater | MTHRIVVNVETGVTSIVEYTPEEQATHDAAVAAQV |
Ga0315905_108049801 | 3300032092 | Freshwater | MTHRIVVNVQTGETSMVQYTPEEQATHDAAVAAQQAEAEAKAL |
Ga0315903_110705032 | 3300032116 | Freshwater | MTHRIVVNVETGVTSIVEYTAEEQAVHDAAVAAQAEAQALADAA |
Ga0334995_0394296_350_484 | 3300034062 | Freshwater | MTHRIVVNCETGVTTQVEYTAEEQAIHDAAVAAQEPVIEAPADE |
Ga0335048_0503547_3_125 | 3300034356 | Freshwater | MTHRIVVNVETGVTSIVEYTAEEQATHDAAVAAQQAEAEAE |
⦗Top⦘ |