| Basic Information | |
|---|---|
| Family ID | F082363 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 43 residues |
| Representative Sequence | ESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.57 % |
| % of genes near scaffold ends (potentially truncated) | 77.88 % |
| % of genes from short scaffolds (< 2000 bps) | 81.42 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.690 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (12.389 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.593 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.283 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 32.86% Coil/Unstructured: 67.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF13240 | zinc_ribbon_2 | 18.58 |
| PF06271 | RDD | 16.81 |
| PF00886 | Ribosomal_S16 | 4.42 |
| PF00069 | Pkinase | 4.42 |
| PF06835 | LptC | 3.54 |
| PF01741 | MscL | 2.65 |
| PF01156 | IU_nuc_hydro | 1.77 |
| PF02272 | DHHA1 | 1.77 |
| PF13083 | KH_4 | 1.77 |
| PF04963 | Sigma54_CBD | 0.88 |
| PF01047 | MarR | 0.88 |
| PF01972 | SDH_sah | 0.88 |
| PF02517 | Rce1-like | 0.88 |
| PF08448 | PAS_4 | 0.88 |
| PF10825 | DUF2752 | 0.88 |
| PF01782 | RimM | 0.88 |
| PF11154 | DUF2934 | 0.88 |
| PF03544 | TonB_C | 0.88 |
| PF13620 | CarboxypepD_reg | 0.88 |
| PF00118 | Cpn60_TCP1 | 0.88 |
| PF12399 | BCA_ABC_TP_C | 0.88 |
| PF01145 | Band_7 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 17.70 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 16.81 |
| COG0228 | Ribosomal protein S16 | Translation, ribosomal structure and biogenesis [J] | 4.42 |
| COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 2.65 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.77 |
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 1.77 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG0806 | Ribosomal 30S subunit maturation factor RimM, required for 16S rRNA processing | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 0.88 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.69 % |
| Unclassified | root | N/A | 5.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10342395 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100104152 | All Organisms → cellular organisms → Bacteria | 2659 | Open in IMG/M |
| 3300004092|Ga0062389_102938511 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300004474|Ga0068968_1274003 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300004633|Ga0066395_10002353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 6558 | Open in IMG/M |
| 3300005468|Ga0070707_101713783 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005602|Ga0070762_10134375 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300005712|Ga0070764_10163591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1230 | Open in IMG/M |
| 3300006052|Ga0075029_100224182 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300006052|Ga0075029_100934403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 596 | Open in IMG/M |
| 3300006162|Ga0075030_100487872 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300006804|Ga0079221_10358737 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300009088|Ga0099830_11543134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300009523|Ga0116221_1063470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1687 | Open in IMG/M |
| 3300009623|Ga0116133_1187060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300009630|Ga0116114_1135309 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300009632|Ga0116102_1007812 | All Organisms → cellular organisms → Bacteria | 4004 | Open in IMG/M |
| 3300009641|Ga0116120_1244632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300009645|Ga0116106_1082301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1049 | Open in IMG/M |
| 3300010339|Ga0074046_10122279 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300010341|Ga0074045_10718504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300010343|Ga0074044_10077574 | Not Available | 2246 | Open in IMG/M |
| 3300012189|Ga0137388_10254842 | Not Available | 1598 | Open in IMG/M |
| 3300012189|Ga0137388_10384290 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300012200|Ga0137382_11048762 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300012211|Ga0137377_11328159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300012350|Ga0137372_10113063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2260 | Open in IMG/M |
| 3300012361|Ga0137360_11365984 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300012363|Ga0137390_10190911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2035 | Open in IMG/M |
| 3300012685|Ga0137397_10551186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 858 | Open in IMG/M |
| 3300012923|Ga0137359_10269344 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
| 3300012925|Ga0137419_10565898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
| 3300014155|Ga0181524_10467652 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300014156|Ga0181518_10149726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1252 | Open in IMG/M |
| 3300014156|Ga0181518_10559852 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300014159|Ga0181530_10360785 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300014162|Ga0181538_10160611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1283 | Open in IMG/M |
| 3300014162|Ga0181538_10418613 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300014169|Ga0181531_10064230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2159 | Open in IMG/M |
| 3300014498|Ga0182019_11411787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300014638|Ga0181536_10140065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1290 | Open in IMG/M |
| 3300015264|Ga0137403_11511383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300016730|Ga0181515_1134241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300017823|Ga0187818_10003213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6895 | Open in IMG/M |
| 3300017823|Ga0187818_10038501 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
| 3300017931|Ga0187877_1007170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7649 | Open in IMG/M |
| 3300017932|Ga0187814_10267388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300017941|Ga0187850_10515394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300017943|Ga0187819_10022431 | All Organisms → cellular organisms → Bacteria | 3682 | Open in IMG/M |
| 3300017946|Ga0187879_10345902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 825 | Open in IMG/M |
| 3300017955|Ga0187817_10433207 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300018003|Ga0187876_1168586 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300018006|Ga0187804_10041018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1782 | Open in IMG/M |
| 3300018007|Ga0187805_10221668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300018008|Ga0187888_1135319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1020 | Open in IMG/M |
| 3300018009|Ga0187884_10052407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1900 | Open in IMG/M |
| 3300018012|Ga0187810_10129716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1004 | Open in IMG/M |
| 3300018012|Ga0187810_10214822 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300018019|Ga0187874_10275049 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300018020|Ga0187861_10238204 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300018033|Ga0187867_10818802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300018035|Ga0187875_10177325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1183 | Open in IMG/M |
| 3300018035|Ga0187875_10404244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
| 3300018044|Ga0187890_10638257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300018047|Ga0187859_10071222 | All Organisms → cellular organisms → Bacteria | 1830 | Open in IMG/M |
| 3300018085|Ga0187772_11166391 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300018086|Ga0187769_10803336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 711 | Open in IMG/M |
| 3300018088|Ga0187771_11772219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300018090|Ga0187770_10055806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2856 | Open in IMG/M |
| 3300018431|Ga0066655_10475847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300019787|Ga0182031_1535674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1759 | Open in IMG/M |
| 3300021181|Ga0210388_10638233 | Not Available | 930 | Open in IMG/M |
| 3300021478|Ga0210402_10754912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
| 3300021861|Ga0213853_10873151 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300022873|Ga0224550_1024243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
| 3300025419|Ga0208036_1012874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1885 | Open in IMG/M |
| 3300027545|Ga0209008_1057401 | Not Available | 883 | Open in IMG/M |
| 3300027591|Ga0209733_1081987 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300027633|Ga0208988_1105638 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300027678|Ga0209011_1103496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300027738|Ga0208989_10069097 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300027824|Ga0209040_10536389 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300027853|Ga0209274_10011691 | All Organisms → cellular organisms → Bacteria | 3937 | Open in IMG/M |
| 3300027874|Ga0209465_10053577 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
| 3300027875|Ga0209283_10164263 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300027884|Ga0209275_10374125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
| 3300027898|Ga0209067_10818130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300027905|Ga0209415_10045651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5785 | Open in IMG/M |
| 3300028652|Ga0302166_10000706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7130 | Open in IMG/M |
| 3300028740|Ga0302294_10060180 | Not Available | 895 | Open in IMG/M |
| 3300028780|Ga0302225_10343476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300028870|Ga0302254_10207668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300029817|Ga0247275_1035788 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300029903|Ga0247271_101634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5505 | Open in IMG/M |
| 3300029903|Ga0247271_105613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2226 | Open in IMG/M |
| 3300029907|Ga0311329_10037382 | All Organisms → cellular organisms → Bacteria | 4323 | Open in IMG/M |
| 3300029956|Ga0302150_10384808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300029989|Ga0311365_10659983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
| 3300030054|Ga0302182_10292705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300031234|Ga0302325_11311064 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300031247|Ga0265340_10173779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
| 3300031446|Ga0170820_17564866 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300031708|Ga0310686_109937245 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300031753|Ga0307477_10904583 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300032205|Ga0307472_100825395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
| 3300033797|Ga0334815_000808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2988 | Open in IMG/M |
| 3300033807|Ga0314866_084796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300033826|Ga0334847_001074 | All Organisms → cellular organisms → Bacteria | 2316 | Open in IMG/M |
| 3300033891|Ga0334811_135640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300033983|Ga0371488_0547558 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300034090|Ga0326723_0527238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300034282|Ga0370492_0228234 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 12.39% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.96% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 7.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.08% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.54% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.54% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.54% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.65% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.65% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.65% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.77% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.77% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.77% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.89% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.89% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.89% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004474 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300025419 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300028740 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033797 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-S | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
| 3300033891 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-D | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_103423952 | 3300001661 | Forest Soil | LQLLAGERLDIAYSLGMNDHPEFGGLELTLRDVVRAR* |
| JGIcombinedJ26739_1001041523 | 3300002245 | Forest Soil | RLQLLAGDRLDIAYTLGLNDHPEFGGLELTLRDLARTRS* |
| Ga0062389_1029385112 | 3300004092 | Bog Forest Soil | WGLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVLRSG* |
| Ga0068968_12740032 | 3300004474 | Peatlands Soil | GLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELALRDVLRAR* |
| Ga0066395_100023531 | 3300004633 | Tropical Forest Soil | SCDSLQLLAGDRLDIAYSLGMNDHPEFGGLELTLQDVQRSR* |
| Ga0070707_1017137831 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | SCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRTR* |
| Ga0070762_101343753 | 3300005602 | Soil | GMKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR* |
| Ga0070764_101635911 | 3300005712 | Soil | CDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRSA* |
| Ga0075029_1002241823 | 3300006052 | Watersheds | LQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRRLP* |
| Ga0075029_1009344031 | 3300006052 | Watersheds | LQLLAGDRLDIAYALGMNDHPEFGGLELTLRDVVRRLQ* |
| Ga0075030_1004878723 | 3300006162 | Watersheds | DRLQLLAGDQLDIAYSIGMNDHPEFGGLELTLRDVLRPR* |
| Ga0079221_103587372 | 3300006804 | Agricultural Soil | CEAMQLLAGDRLDIAYCVGINEHPEFGGLELTLKDVARAS* |
| Ga0099830_115431341 | 3300009088 | Vadose Zone Soil | LLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRTR* |
| Ga0116221_10634704 | 3300009523 | Peatlands Soil | CDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR* |
| Ga0116133_11870602 | 3300009623 | Peatland | QLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVLRSN* |
| Ga0116114_11353091 | 3300009630 | Peatland | GLKESCDRLQLLAGDRLDIAYSVGMNDHPEFGGLELTLRDVVRAR* |
| Ga0116102_10078121 | 3300009632 | Peatland | LKESCDQLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR* |
| Ga0116120_12446322 | 3300009641 | Peatland | LLAGDRIDIAYTLGMNDHPEFGGLELTLRDVRRCR* |
| Ga0116106_10823013 | 3300009645 | Peatland | LLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRSR* |
| Ga0074046_101222793 | 3300010339 | Bog Forest Soil | WGLKESCDRLQLLAGDRLDIAYSLGMNDHAEFGGLELTLRDVLRAR* |
| Ga0074045_107185041 | 3300010341 | Bog Forest Soil | KESCDRLQLLAGDRIDIAYSIGLNDHPEFGGLELTLRDVLRAG* |
| Ga0074044_100775743 | 3300010343 | Bog Forest Soil | LQLLAGDRLDIAYSLGMNDHPEFGGLELTMRDVVRSA* |
| Ga0137388_102548421 | 3300012189 | Vadose Zone Soil | RLQLLSGDRLDIAYSLGMNDHPEFGGLELILRDVVRGR* |
| Ga0137388_103842904 | 3300012189 | Vadose Zone Soil | MGWGLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLREVRRTSV* |
| Ga0137382_110487622 | 3300012200 | Vadose Zone Soil | LQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR* |
| Ga0137377_113281592 | 3300012211 | Vadose Zone Soil | LLQGDRLDVVYSLGMNDHPEFGGLELTIRDVARTR* |
| Ga0137372_101130631 | 3300012350 | Vadose Zone Soil | CDRLQLLAGDRLDIAYTLGMNDHPEFGGLELTLRDVRRNS* |
| Ga0137360_113659841 | 3300012361 | Vadose Zone Soil | QLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVMRAR* |
| Ga0137390_101909114 | 3300012363 | Vadose Zone Soil | LQLLAGDRLDIAYSLGMNDHPEFGGLELILRDVVRGR* |
| Ga0137397_105511862 | 3300012685 | Vadose Zone Soil | MGWGLKESCDQLQLLAGDRLDIAYSLGMNDHPEFGGLELTLQDVTQSK* |
| Ga0137359_102693443 | 3300012923 | Vadose Zone Soil | AMGWGLKESCDQLQLLAGDRLDVAYSLGMNDHPEFGGLELTLRDVARTR* |
| Ga0137419_105658982 | 3300012925 | Vadose Zone Soil | MGWGLKESCDQLQLLAGDRLDIAYSLGMNDHPEFGGLELTLQDATQSK* |
| Ga0181524_104676521 | 3300014155 | Bog | CDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVLRAR* |
| Ga0181518_101497261 | 3300014156 | Bog | ESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR* |
| Ga0181518_105598522 | 3300014156 | Bog | WGLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR* |
| Ga0181530_103607851 | 3300014159 | Bog | RLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR* |
| Ga0181538_101606113 | 3300014162 | Bog | CERLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR* |
| Ga0181538_104186131 | 3300014162 | Bog | MKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRSR* |
| Ga0181531_100642301 | 3300014169 | Bog | MKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELSLKDVVRTR* |
| Ga0182019_114117872 | 3300014498 | Fen | LAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR* |
| Ga0181536_101400654 | 3300014638 | Bog | LLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR* |
| Ga0137403_115113831 | 3300015264 | Vadose Zone Soil | LLAGDHLDVAYSLGMNDHPEFGGLELTLRDVVRSG* |
| Ga0181515_11342411 | 3300016730 | Peatland | ESCDRLQLLAGDRLDIAYSVGMNDHPEFGGLELTLRDVVRAR |
| Ga0187818_100032138 | 3300017823 | Freshwater Sediment | LQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR |
| Ga0187818_100385011 | 3300017823 | Freshwater Sediment | RLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR |
| Ga0187877_10071706 | 3300017931 | Peatland | MGWGLKESSDRLQLLAGDCLDIAYSLSMNDHPEFGGLELTLRDVARVR |
| Ga0187814_102673881 | 3300017932 | Freshwater Sediment | MGWGLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAG |
| Ga0187850_105153941 | 3300017941 | Peatland | SDRLQLLAGDCLDIAYSLSMNDHPEFGGLELTLRDVARVR |
| Ga0187819_100224315 | 3300017943 | Freshwater Sediment | GLRESCDRLTLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR |
| Ga0187879_103459021 | 3300017946 | Peatland | KESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDLVRAR |
| Ga0187817_104332071 | 3300017955 | Freshwater Sediment | SCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRSR |
| Ga0187876_11685861 | 3300018003 | Peatland | RLQLLAGDCLDIAYSLSMNDHPEFGGLELTLRDVVRSR |
| Ga0187804_100410182 | 3300018006 | Freshwater Sediment | MGWGLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRSR |
| Ga0187805_102216682 | 3300018007 | Freshwater Sediment | LLAGDRLDIAYTLGLNDHPEFGGLELTLRDLVRTSNK |
| Ga0187888_11353192 | 3300018008 | Peatland | MKESCDRLQLLAGDRLDIAYSPGMNDHPEFGGLELTLRDVMRAR |
| Ga0187884_100524073 | 3300018009 | Peatland | MGWGLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR |
| Ga0187810_101297162 | 3300018012 | Freshwater Sediment | GWGLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR |
| Ga0187810_102148221 | 3300018012 | Freshwater Sediment | MGWGLKESCDQLQTLAGDRLDIAYKLGMNDHPEFGGLELTLRDVVRRIR |
| Ga0187874_102750492 | 3300018019 | Peatland | MGWGLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVLRAH |
| Ga0187861_102382041 | 3300018020 | Peatland | TFKAMGWGLQECCDRLQLLSGDRLDIAYSLGMNDHPEFGGLELTLRDVVRSR |
| Ga0187867_108188022 | 3300018033 | Peatland | RLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVLRSN |
| Ga0187875_101773251 | 3300018035 | Peatland | ESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVLRSN |
| Ga0187875_104042441 | 3300018035 | Peatland | FCDKLQLLAGDRLDIAYTLGMNDHPEFGGLELTLRDLRRTG |
| Ga0187890_106382571 | 3300018044 | Peatland | QTMGWSLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVLRSN |
| Ga0187859_100712221 | 3300018047 | Peatland | KESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDIVRS |
| Ga0187772_111663912 | 3300018085 | Tropical Peatland | GWGLRESCERLQLLAGDRLDIAYTLGINDHPEFGGLELTLRDIIRSGN |
| Ga0187769_108033362 | 3300018086 | Tropical Peatland | MGWGLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDLVRSR |
| Ga0187771_117722192 | 3300018088 | Tropical Peatland | LAGDRLDIAYSLSTNDHPEFGGLELTLRDLVRTNNPHK |
| Ga0187770_100558065 | 3300018090 | Tropical Peatland | LLAGDRLDIAYALAMNDHPEFGGLELTLRDALRNG |
| Ga0066655_104758471 | 3300018431 | Grasslands Soil | GWGLKETCDQLQLLAGDNVEIAYCLGMNDHPEYGGLELALRDIRRTRP |
| Ga0182031_15356742 | 3300019787 | Bog | MAQQHCVKAMGWRMKESCDRLQLLAGDRLDIAYSPGMNDHPEFGGLELTLRDVMRAR |
| Ga0210388_106382332 | 3300021181 | Soil | GLRESCERLQLLAGDRLDIAYTLGLNDHPEFGGLELTLRDIARA |
| Ga0210402_107549121 | 3300021478 | Soil | LQLLAGDRLDIAYSLGMNHHPEFGGLELTLRDVVRTP |
| Ga0213853_108731512 | 3300021861 | Watersheds | DKLQLLAGDRLDIAYTLGMNDHPEFGGLELTLRDLRRGA |
| Ga0224550_10242432 | 3300022873 | Soil | WGLKESCDRLQLLAGDRLDIAYSLGMNDHPDFGGPELTLRDVVRTE |
| Ga0208036_10128741 | 3300025419 | Peatland | AMGWGLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRTR |
| Ga0209421_10879351 | 3300027432 | Forest Soil | CDRLQLLAGDRLDIAYTLGLNDHPEIGGLELTLRDIMRHNVDVVTRAG |
| Ga0209008_10574012 | 3300027545 | Forest Soil | ERLQLLAGDRLDIAYTLGLNDHPEFGGLELTLRDLARTRS |
| Ga0209733_10819872 | 3300027591 | Forest Soil | MGWGLKESCDRLQLLAGDRIDIAYSLGMNDHPEFGGLELTLRDVVRERRTE |
| Ga0208988_11056382 | 3300027633 | Forest Soil | MGWGLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRSS |
| Ga0209011_11034962 | 3300027678 | Forest Soil | QLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRSR |
| Ga0208989_100690971 | 3300027738 | Forest Soil | SCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDLVRAR |
| Ga0209040_105363892 | 3300027824 | Bog Forest Soil | QLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAG |
| Ga0209274_100116911 | 3300027853 | Soil | LQLLTGDRLDIAYSLGMNDHPEFGGLELALRDVMRSK |
| Ga0209465_100535773 | 3300027874 | Tropical Forest Soil | SCDSLQLLAGDRLDIAYSLGMNDHPEFGGLELTLQDVQRSR |
| Ga0209283_101642633 | 3300027875 | Vadose Zone Soil | KESCDRLRLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRTR |
| Ga0209275_103741251 | 3300027884 | Soil | GMKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR |
| Ga0209067_108181302 | 3300027898 | Watersheds | LLAGDQLDIAYTLGLNDHPEFGGLELTLRDLVRTSNK |
| Ga0209415_100456511 | 3300027905 | Peatlands Soil | ESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAR |
| Ga0302166_100007061 | 3300028652 | Fen | MQLLAGDRLDIAYQLGMNDHPEFGGLELTLQDVVRSK |
| Ga0302294_100601802 | 3300028740 | Fen | MGWGKKESCDRLQLLAGDHLDIAYILGMNDHPEFGGLELTLRDIARSR |
| Ga0302225_103434761 | 3300028780 | Palsa | LQLLAGDRLDIAYSIGMNDHPEFGGLELGLRDVVRAR |
| Ga0302254_102076682 | 3300028870 | Fen | KESCDQMQLLAGDRLDIAYQLGMNDHPEFGGLELTLQDVVRSK |
| Ga0247275_10357881 | 3300029817 | Soil | WGLKESSDRLQLLAGDCLDIAYSLSMNDHPEFGGLELTLRDVARVR |
| Ga0247271_1016342 | 3300029903 | Soil | MGWGLKESCDSLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRAP |
| Ga0247271_1056132 | 3300029903 | Soil | MGWSLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVLRSN |
| Ga0311329_100373823 | 3300029907 | Bog | MKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELSLKDVVRTR |
| Ga0302150_103848082 | 3300029956 | Bog | SCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELSLKDVVRTR |
| Ga0311365_106599832 | 3300029989 | Fen | LQLLAGDTLDIAYKLGMNDHPEFGGLELTLQDVARARLDH |
| Ga0302182_102927052 | 3300030054 | Palsa | KESCERLQLLAGDRLDIAYSIGMNDHPEFGGLELGLRDVVRAR |
| Ga0302325_113110642 | 3300031234 | Palsa | KAMGWGLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELSLRDVVRTP |
| Ga0265340_101737792 | 3300031247 | Rhizosphere | EACDRLHLLAGDQLDIAYSVGMNDHPDFGGLELTLRDVVRAA |
| Ga0170820_175648662 | 3300031446 | Forest Soil | MGWGLKETCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTVRDVVRAAR |
| Ga0310686_1099372451 | 3300031708 | Soil | MGWGLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELSLRDVVRTP |
| Ga0307477_109045832 | 3300031753 | Hardwood Forest Soil | MGWGLKETCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTVRDVVRAVR |
| Ga0307472_1008253952 | 3300032205 | Hardwood Forest Soil | SCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRTR |
| Ga0334815_000808_499_645 | 3300033797 | Soil | MGWGLKESCDQMQLLAGDRLDIAYQLGMNDHPEFGGLELTLQDVVRSK |
| Ga0314866_084796_101_250 | 3300033807 | Peatland | MGWGLRESCERLQLLAGDRLDIAYTLGINDHPEFGGLELTLRDIMRSGN |
| Ga0334847_001074_2099_2245 | 3300033826 | Soil | MGWGLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDLVRAR |
| Ga0334811_135640_446_592 | 3300033891 | Soil | MGWGLKESCDRLQLLAGDRLDIAYSLGMNDHPEFGGLELTLRDVVRVR |
| Ga0371488_0547558_370_504 | 3300033983 | Peat Soil | MKESCDRLQLLAGDRLDIAYSLGMNEHPEFGGLELNLRDVVRAR |
| Ga0326723_0527238_411_542 | 3300034090 | Peat Soil | KEACDQLQLLAGDRLDIAYTLGMNEHPEFGGLELTLQDVVRSK |
| Ga0370492_0228234_442_588 | 3300034282 | Untreated Peat Soil | MGWGLKESCDRLQLLAGDRLDIAYSIGMNDHPEFGGLELTLRDVLRSS |
| ⦗Top⦘ |