| Basic Information | |
|---|---|
| Family ID | F082361 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MHIATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHARPSAWPL |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.46 % |
| % of genes from short scaffolds (< 2000 bps) | 93.81 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.115 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.469 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.088 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.133 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.03% Coil/Unstructured: 73.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF01520 | Amidase_3 | 2.65 |
| PF00041 | fn3 | 1.77 |
| PF00933 | Glyco_hydro_3 | 0.88 |
| PF13672 | PP2C_2 | 0.88 |
| PF00313 | CSD | 0.88 |
| PF01547 | SBP_bac_1 | 0.88 |
| PF01569 | PAP2 | 0.88 |
| PF01019 | G_glu_transpept | 0.88 |
| PF02653 | BPD_transp_2 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 2.65 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.88 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.12 % |
| Unclassified | root | N/A | 0.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_191281 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1119 | Open in IMG/M |
| 3300000956|JGI10216J12902_105408538 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 708 | Open in IMG/M |
| 3300000956|JGI10216J12902_108737434 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 708 | Open in IMG/M |
| 3300001139|JGI10220J13317_10021878 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 774 | Open in IMG/M |
| 3300003321|soilH1_10132893 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1404 | Open in IMG/M |
| 3300003997|Ga0055466_10070470 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 905 | Open in IMG/M |
| 3300003997|Ga0055466_10217289 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 568 | Open in IMG/M |
| 3300003999|Ga0055469_10098533 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 838 | Open in IMG/M |
| 3300003999|Ga0055469_10116748 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 783 | Open in IMG/M |
| 3300004081|Ga0063454_100610869 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300004081|Ga0063454_100847163 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 714 | Open in IMG/M |
| 3300004081|Ga0063454_101343142 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 601 | Open in IMG/M |
| 3300004114|Ga0062593_100775240 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 949 | Open in IMG/M |
| 3300004153|Ga0063455_100708371 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 679 | Open in IMG/M |
| 3300004157|Ga0062590_101897611 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 614 | Open in IMG/M |
| 3300004778|Ga0062383_10271168 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 806 | Open in IMG/M |
| 3300005329|Ga0070683_101754949 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 597 | Open in IMG/M |
| 3300005344|Ga0070661_101798982 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 520 | Open in IMG/M |
| 3300005347|Ga0070668_102015175 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 532 | Open in IMG/M |
| 3300005455|Ga0070663_101819828 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 546 | Open in IMG/M |
| 3300005458|Ga0070681_11578674 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 581 | Open in IMG/M |
| 3300005468|Ga0070707_100185096 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2030 | Open in IMG/M |
| 3300005518|Ga0070699_101488557 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 621 | Open in IMG/M |
| 3300005536|Ga0070697_100035321 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4032 | Open in IMG/M |
| 3300005545|Ga0070695_101634864 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 538 | Open in IMG/M |
| 3300005844|Ga0068862_100308391 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1458 | Open in IMG/M |
| 3300005878|Ga0075297_1018816 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 726 | Open in IMG/M |
| 3300005880|Ga0075298_1028108 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 561 | Open in IMG/M |
| 3300005887|Ga0075292_1010948 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1138 | Open in IMG/M |
| 3300006804|Ga0079221_10636305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 728 | Open in IMG/M |
| 3300006853|Ga0075420_101807220 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 523 | Open in IMG/M |
| 3300006876|Ga0079217_11315280 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 559 | Open in IMG/M |
| 3300006954|Ga0079219_12124291 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 538 | Open in IMG/M |
| 3300009147|Ga0114129_13367945 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 515 | Open in IMG/M |
| 3300009148|Ga0105243_12978679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 514 | Open in IMG/M |
| 3300009153|Ga0105094_10273574 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 971 | Open in IMG/M |
| 3300009156|Ga0111538_12301654 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 677 | Open in IMG/M |
| 3300009156|Ga0111538_12770819 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 614 | Open in IMG/M |
| 3300009162|Ga0075423_11277063 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 784 | Open in IMG/M |
| 3300009553|Ga0105249_11285450 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 803 | Open in IMG/M |
| 3300009840|Ga0126313_10611026 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 879 | Open in IMG/M |
| 3300010036|Ga0126305_10160980 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1402 | Open in IMG/M |
| 3300010039|Ga0126309_11045300 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 551 | Open in IMG/M |
| 3300010042|Ga0126314_10122585 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1789 | Open in IMG/M |
| 3300010044|Ga0126310_11876870 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 500 | Open in IMG/M |
| 3300010166|Ga0126306_11738413 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 521 | Open in IMG/M |
| 3300010375|Ga0105239_13475908 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 512 | Open in IMG/M |
| 3300010399|Ga0134127_10488125 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1240 | Open in IMG/M |
| 3300012019|Ga0120139_1081053 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300012093|Ga0136632_10521654 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 526 | Open in IMG/M |
| 3300012212|Ga0150985_120969730 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 748 | Open in IMG/M |
| 3300012360|Ga0137375_11241750 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 567 | Open in IMG/M |
| 3300012684|Ga0136614_10696284 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 716 | Open in IMG/M |
| 3300012914|Ga0157297_10379593 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 559 | Open in IMG/M |
| 3300012984|Ga0164309_11131414 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 653 | Open in IMG/M |
| 3300012986|Ga0164304_10869136 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 702 | Open in IMG/M |
| 3300012986|Ga0164304_10956867 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 674 | Open in IMG/M |
| 3300012986|Ga0164304_11357630 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 582 | Open in IMG/M |
| 3300013102|Ga0157371_10840647 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 694 | Open in IMG/M |
| 3300014263|Ga0075324_1039542 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 892 | Open in IMG/M |
| 3300014497|Ga0182008_10091749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1498 | Open in IMG/M |
| 3300015077|Ga0173483_10292538 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 794 | Open in IMG/M |
| 3300015371|Ga0132258_11255330 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1873 | Open in IMG/M |
| 3300017789|Ga0136617_11057402 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 614 | Open in IMG/M |
| 3300018422|Ga0190265_11364510 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 824 | Open in IMG/M |
| 3300018429|Ga0190272_11167207 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 753 | Open in IMG/M |
| 3300019888|Ga0193751_1190192 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 698 | Open in IMG/M |
| 3300024430|Ga0196962_10043116 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1360 | Open in IMG/M |
| 3300025795|Ga0210114_1028467 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1180 | Open in IMG/M |
| 3300025915|Ga0207693_10437251 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1023 | Open in IMG/M |
| 3300025944|Ga0207661_10613938 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 999 | Open in IMG/M |
| 3300025945|Ga0207679_10426500 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1171 | Open in IMG/M |
| 3300025961|Ga0207712_10649851 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 916 | Open in IMG/M |
| 3300025972|Ga0207668_11459591 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 617 | Open in IMG/M |
| 3300026020|Ga0208531_1005448 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1102 | Open in IMG/M |
| 3300026045|Ga0208535_1021552 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 608 | Open in IMG/M |
| 3300026088|Ga0207641_12313515 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 537 | Open in IMG/M |
| 3300027725|Ga0209178_1218229 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 680 | Open in IMG/M |
| 3300027843|Ga0209798_10002069 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 11908 | Open in IMG/M |
| 3300027964|Ga0256864_1070564 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 964 | Open in IMG/M |
| 3300028587|Ga0247828_10441659 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 759 | Open in IMG/M |
| 3300028592|Ga0247822_10901550 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 726 | Open in IMG/M |
| 3300028597|Ga0247820_10076720 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1992 | Open in IMG/M |
| 3300028597|Ga0247820_11212882 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 545 | Open in IMG/M |
| 3300028715|Ga0307313_10221367 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 588 | Open in IMG/M |
| 3300028784|Ga0307282_10502236 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 589 | Open in IMG/M |
| 3300028799|Ga0307284_10167421 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 854 | Open in IMG/M |
| 3300028799|Ga0307284_10343082 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 604 | Open in IMG/M |
| 3300028812|Ga0247825_10388681 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 984 | Open in IMG/M |
| 3300028824|Ga0307310_10000660 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 11920 | Open in IMG/M |
| 3300028824|Ga0307310_10200142 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 943 | Open in IMG/M |
| 3300028828|Ga0307312_10932030 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 575 | Open in IMG/M |
| 3300028872|Ga0307314_10139615 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 693 | Open in IMG/M |
| 3300028878|Ga0307278_10542856 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 507 | Open in IMG/M |
| 3300028881|Ga0307277_10459620 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 571 | Open in IMG/M |
| 3300028884|Ga0307308_10234825 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 879 | Open in IMG/M |
| 3300030619|Ga0268386_10962682 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 529 | Open in IMG/M |
| 3300031548|Ga0307408_100065381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2667 | Open in IMG/M |
| 3300031548|Ga0307408_101914438 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 569 | Open in IMG/M |
| 3300031548|Ga0307408_101928958 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 567 | Open in IMG/M |
| 3300031824|Ga0307413_10171682 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1535 | Open in IMG/M |
| 3300031824|Ga0307413_10187273 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1482 | Open in IMG/M |
| 3300031824|Ga0307413_10247464 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1320 | Open in IMG/M |
| 3300031852|Ga0307410_10221718 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1455 | Open in IMG/M |
| 3300031852|Ga0307410_11310891 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 633 | Open in IMG/M |
| 3300031903|Ga0307407_10004328 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 6005 | Open in IMG/M |
| 3300031911|Ga0307412_10432281 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1080 | Open in IMG/M |
| 3300031938|Ga0308175_102777578 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 547 | Open in IMG/M |
| 3300031995|Ga0307409_100364517 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1368 | Open in IMG/M |
| 3300032126|Ga0307415_101241051 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 704 | Open in IMG/M |
| 3300032179|Ga0310889_10641605 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 551 | Open in IMG/M |
| 3300033513|Ga0316628_100467309 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1620 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.47% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 10.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.19% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.31% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.42% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.54% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.54% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.65% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.65% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.77% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.89% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
| 3300005880 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 | Environmental | Open in IMG/M |
| 3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300024430 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 | Environmental | Open in IMG/M |
| 3300025795 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026020 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 (SPAdes) | Environmental | Open in IMG/M |
| 3300026045 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027964 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeq | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_03634850 | 2199352024 | Soil | AGVTQHLVQVEAQVKADTLVQPLLVLTHARPNAWPL |
| JGI10216J12902_1054085381 | 3300000956 | Soil | SGTPILGTDDSRADPLDRPLASLLMHIATFDTSTGVTQNMVQVEAQVKAETLVQPLLVLTHARPNAWPL* |
| JGI10216J12902_1087374342 | 3300000956 | Soil | SGTPILGTDDSRADPLDRPLASLLMHIATFDTSAGVTQNMVQVEAQVKAETLVQPLLVLTHARPNAWPL* |
| JGI10220J13317_100218781 | 3300001139 | Soil | GLTQHLVQVEALVKAETLVQPLLVLTHQRPEAWPL* |
| soilH1_101328932 | 3300003321 | Sugarcane Root And Bulk Soil | VDRPLASLLMHIATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHVRPAAWPL* |
| Ga0055466_100704701 | 3300003997 | Natural And Restored Wetlands | ADLRPLTSLVMHISTFDTSSGITQHLVQVEALVKAESLVQPLIVLTHERPGTWPL* |
| Ga0055466_102172891 | 3300003997 | Natural And Restored Wetlands | LASLLMHIATFDTSTGVTQHLVQVEAQVRAETLVQPLLVLTHARPSAWPL* |
| Ga0055469_100985332 | 3300003999 | Natural And Restored Wetlands | TFDTSTGVTQHLVQVEAVVKAESLVQPLLILAPSRPAAWPL* |
| Ga0055469_101167481 | 3300003999 | Natural And Restored Wetlands | AADVPLGQLVMHIATFDASAGITQNLVQVEAAIRADTLVQPLLVLTHARPDTWPA* |
| Ga0063454_1006108693 | 3300004081 | Soil | TFDTTSGVTQHLVQVEAQVKAETLVQPLLVLTHARPSAWPL* |
| Ga0063454_1008471631 | 3300004081 | Soil | QRPLASLVMHIATFDTTTGLTQHLVQVEALVKAEALVQPLLVLTPQRPEAWPL* |
| Ga0063454_1013431421 | 3300004081 | Soil | PLDRPLASLLMHIATFDTSTGVTQHMVQVEAQVKAETLVQPLLVLTHARPNAWPL* |
| Ga0062593_1007752402 | 3300004114 | Soil | PLASMLMHIATFDTSTGVTQHLVQVEAVVKAESLVQPLLILTPSRPPAWPL* |
| Ga0063455_1007083711 | 3300004153 | Soil | ADRPLSSLLMHIATFDTSTGITQHLVQVEAQVKAETLVQPLLVLTHARPYAWPL* |
| Ga0062590_1018976112 | 3300004157 | Soil | SMLMNIATFDTSTGVTQHLVQVEAVVKAESLVQPLLILTPTRPAAWPM* |
| Ga0062383_102711681 | 3300004778 | Wetland Sediment | ERKTAPADRPLSSLVMQIATFDTSAGVTQHLVQVEALVKAETLVQPLLVLTHERPAPWPL |
| Ga0070683_1017549491 | 3300005329 | Corn Rhizosphere | VMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL* |
| Ga0070661_1017989821 | 3300005344 | Corn Rhizosphere | VMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPAAWPL* |
| Ga0070692_103767191 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | RLDAAECPLSSLLMHIATFDASTGVTQHLVQVEATVKAEALVQPMLILTQQRPPTWPM* |
| Ga0070668_1020151752 | 3300005347 | Switchgrass Rhizosphere | SLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL* |
| Ga0070663_1018198282 | 3300005455 | Corn Rhizosphere | DTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPAAWPL* |
| Ga0070681_115786741 | 3300005458 | Corn Rhizosphere | KADPLDRPLSSLLMHIATFDTNAGVTQHLVQVEAQVKAETLVQPLLVLTHARPNAWPL* |
| Ga0070707_1001850961 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RPLVSLLMHIATFDTSAGVTQHLVQVEAQVKAETLVQPLLVLTHARPNAWPL* |
| Ga0070699_1014885571 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | SLLMHIATFDTTAGITQNLVQVEAQVKAETLVQPLLVLTHARPNAWPL* |
| Ga0070697_1000353213 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EAPDWGHADPLDRPLASLVMHISTFDHSAGVTQHLVQVEAMVKADTLVQPLLVLTPYRPSAWPM* |
| Ga0070695_1016348641 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIATFDTSTGVTQHLVQVEAVVKAESLVQPLLILTPSRPPAWPL* |
| Ga0068862_1003083911 | 3300005844 | Switchgrass Rhizosphere | PDQRPLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL* |
| Ga0075297_10188161 | 3300005878 | Rice Paddy Soil | SLVMHIATFDASSGVTQHLVQVEAQVKADTLVQPLLVLTHTRPEAWPL* |
| Ga0075298_10281081 | 3300005880 | Rice Paddy Soil | SSLVMHIATFDASSGVTQHLVQVEAQVKADTLVQPLPVLTHTRPEAWPL* |
| Ga0075292_10109481 | 3300005887 | Rice Paddy Soil | QRPLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPAAWPL* |
| Ga0079221_106363052 | 3300006804 | Agricultural Soil | SAGITQHLVQVEAQVKAETLVQPLLVLTHSRPTAWPL* |
| Ga0075420_1018072201 | 3300006853 | Populus Rhizosphere | LASLLMHIATFDTSTGVTQHLVQVEAVVKAESLVQPLLILTPTRPAAWPL* |
| Ga0079217_113152801 | 3300006876 | Agricultural Soil | DPTDADTPTAMQRPLASLVMHISTFDTSAGVTQHLVQVEALVKAETLVQPLLVLTHERPGAWPL* |
| Ga0079219_121242911 | 3300006954 | Agricultural Soil | LMHIATFDTSAGITQHLVQVEAQVKAETLVQPLLVLTHGRPSAWPL* |
| Ga0114129_133679452 | 3300009147 | Populus Rhizosphere | AGSEHSKADPLDRPLSSLLMHIATFDTSGGITQHLVQVEAQVKAETLVQPLLVLTHARPDAWPL* |
| Ga0105243_129786792 | 3300009148 | Miscanthus Rhizosphere | DTSTGVTQHLVQVEAVVKAESLVQPLLILTPSRPAAWPM* |
| Ga0105094_102735741 | 3300009153 | Freshwater Sediment | IATFDTSTGVTQHLVQVEAVVKAESLVQPLLILTPARPAAWPM* |
| Ga0111538_123016542 | 3300009156 | Populus Rhizosphere | TFDTSTGVTQHLVQVEAVVKAESLVQPLLILTPSRPAAWPM* |
| Ga0111538_127708192 | 3300009156 | Populus Rhizosphere | MHIATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHARPSAWPL* |
| Ga0075423_112770632 | 3300009162 | Populus Rhizosphere | EEDVDLQPLSSLLMHIATFDASAGVTQHLVQVEAQVKADTLVQLLLVLTHTRPESWPL* |
| Ga0105249_112854501 | 3300009553 | Switchgrass Rhizosphere | IATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL* |
| Ga0126313_106110262 | 3300009840 | Serpentine Soil | FDTSTGVTQHLVQVEAVVKAESLVQPLLILAPTRPAAWPL* |
| Ga0126305_101609801 | 3300010036 | Serpentine Soil | MLMHIATFDTSTGVTQHLVQVEAVVKAESLVQPLLILAPTRPAAWPL* |
| Ga0126309_110453001 | 3300010039 | Serpentine Soil | STGVTQHLVQVEAVVKAESLVQPLLILAPTRPTAWPL* |
| Ga0126314_101225852 | 3300010042 | Serpentine Soil | LMHIATFDTSTGVTQHLVQVEAVVKAESLVQPLLVLTPARPAAWPM* |
| Ga0126310_118768701 | 3300010044 | Serpentine Soil | TFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHVRPNAWPL* |
| Ga0126306_117384132 | 3300010166 | Serpentine Soil | AGFPMEKLHIATFDTSTGITQHLVQVEAQVKAETLVQPLLVLTHARPNAWPL* |
| Ga0105239_134759081 | 3300010375 | Corn Rhizosphere | KAEPDQRPLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL* |
| Ga0134127_104881251 | 3300010399 | Terrestrial Soil | LRPLTTLVMHISTFDTSSGLTQHLVQVEALVKAESLVQPLIVLTHERPGTWPL* |
| Ga0120139_10810532 | 3300012019 | Permafrost | MASLLMHIATFDTSTGVTQHLVQVEAQVRAETLVQPLLVLTHARPDAWPL* |
| Ga0136632_105216541 | 3300012093 | Polar Desert Sand | VMHISTFDATAGVTQHLVQVEALVKAETLVQPLLVLAHERPSAWPL* |
| Ga0150985_1209697302 | 3300012212 | Avena Fatua Rhizosphere | HIATFDTSTGITQHLVQVEAQVKAETLVQPLLVLAHARPGAWPL* |
| Ga0137375_112417501 | 3300012360 | Vadose Zone Soil | TTTGVTQHLVQVEAQVKAETLVQPLLVLTHTRPNAWPL* |
| Ga0136614_106962841 | 3300012684 | Polar Desert Sand | TFDTSTGVTQHLVQVEAIVKAESLVQPLLILTPSRPAAWPL* |
| Ga0157297_103795932 | 3300012914 | Soil | GSKAEPDQRPLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPEAWPL |
| Ga0164309_111314142 | 3300012984 | Soil | GITQHLVQVEAQVKAETLVQPLLVLTHARPDAWPL* |
| Ga0164304_108691362 | 3300012986 | Soil | PLDRPLSSLLMHIATFDTSAGITQHLVQVEAQVKAETLVQPLLVLTHARPDAWPL* |
| Ga0164304_109568671 | 3300012986 | Soil | PLSSLLMHIATFDASTGVTQHLVQVEATVKAEALVQPMLVLTQTRPPTWPM* |
| Ga0164304_113576301 | 3300012986 | Soil | PLASLLMHIATFDTSAGVTQHLVQVEAQVKAETLVQPLLVLTHTRPEAWPL* |
| Ga0157371_108406471 | 3300013102 | Corn Rhizosphere | MHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL* |
| Ga0075324_10395421 | 3300014263 | Natural And Restored Wetlands | PGKTNADLRPLTSLVMHISTFDTSSGITQHLVQVEALVKAESLVQPLIVLTHERPGTWPL |
| Ga0182008_100917491 | 3300014497 | Rhizosphere | RPLASMLMNIATFDTSTGVTQHLVQVEAVVKAESLVQPLLILTPSRPPAWPL* |
| Ga0173483_102925381 | 3300015077 | Soil | EPDQRPLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPEAWPL* |
| Ga0132258_112553302 | 3300015371 | Arabidopsis Rhizosphere | MHIATFDTSAGVTQHLVQVEAQVKAETLVQPLLVLTHSRPAAWPL* |
| Ga0136617_110574021 | 3300017789 | Polar Desert Sand | TFDTSTGVTQHLVQVEAVVKAESLVQPLLILAPTRPAAWPL |
| Ga0190265_113645101 | 3300018422 | Soil | STGVTQHLVQVEAVVKADSLVQPLLILAPTRPAAWPM |
| Ga0190272_111672071 | 3300018429 | Soil | ILGTDDSRADPMDRPLSCLLMHIATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHARPNAWPL |
| Ga0193751_11901922 | 3300019888 | Soil | SSMLMHIATFDTSTGVTQHLVQVEAVVRAESLVQPLLILTPSRPAAWPM |
| Ga0196962_100431161 | 3300024430 | Soil | RPLTSLVMHISTFDTTAGLTQHLVQVEALVKAETLVQPLIVLTHERPAAWPL |
| Ga0210114_10284672 | 3300025795 | Natural And Restored Wetlands | PDQRPLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL |
| Ga0207693_104372512 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SPLLGSENSKADPLDRPLASLLMHIATFDTSAGVTQHLVQVEAQVKAETLVQPLLVLTHTRPEAWPL |
| Ga0207661_106139381 | 3300025944 | Corn Rhizosphere | DASTGVTQHLVQVEATVKAEALVQPMLVLTQQRPPTWPM |
| Ga0207679_104265001 | 3300025945 | Corn Rhizosphere | GLTQNLVQVEALVKAETLVQPLLVLTHQRPGAWPL |
| Ga0207712_106498511 | 3300025961 | Switchgrass Rhizosphere | PLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL |
| Ga0207668_114595912 | 3300025972 | Switchgrass Rhizosphere | KPDQRPLTSLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL |
| Ga0208531_10054481 | 3300026020 | Rice Paddy Soil | QRPLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPAAWPL |
| Ga0208535_10215522 | 3300026045 | Natural And Restored Wetlands | ADLRPLTSLVMHISTFDTSSGITQHLVQVEALVKAESLVQPLIVLTHERPGTWPL |
| Ga0207641_123135152 | 3300026088 | Switchgrass Rhizosphere | GSENSKADPLDRPLSSLLMHIATFDTSAGITQHLVQVEAQVKAETLVQPLLVLTHARPDAWPL |
| Ga0209178_12182291 | 3300027725 | Agricultural Soil | PVAGSENSKADPLDRPLSSLLMHIATFDTSAGITQHLVQVEAQVKAETLVQPLLVLTHSRPGAWPL |
| Ga0209798_100020699 | 3300027843 | Wetland Sediment | DTNAGITQHLVQVEAQVKAETLVQPLLILTHTRPSAWPL |
| Ga0256864_10705642 | 3300027964 | Soil | FDTTTGVTQHLVQVEAVVKAESLVQPLLILTPSRPAAWPM |
| Ga0247828_104416591 | 3300028587 | Soil | HIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL |
| Ga0247822_109015501 | 3300028592 | Soil | TGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL |
| Ga0247820_100767202 | 3300028597 | Soil | MHISTFDTSSGLTQHLVQVEALVKAESLVQPLIVLTHERPGTWPL |
| Ga0247820_112128822 | 3300028597 | Soil | LVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL |
| Ga0307313_102213671 | 3300028715 | Soil | MLMHIATFDTSTGVTQHLVQVEAVVRAESLVQPLLILTPSRPAAWPM |
| Ga0307282_105022361 | 3300028784 | Soil | STGVTQHLVQVEAVVRAESLVQPLLILTPTRPAAWPM |
| Ga0307284_101674212 | 3300028799 | Soil | TTGVTQHLVQVEAVVRAESLVQPLLILTPTRPAAWPM |
| Ga0307284_103430821 | 3300028799 | Soil | ATFDTTTGITQHLVQVEAMVKAETLVQPLLVLTHARPAAWPL |
| Ga0247825_103886811 | 3300028812 | Soil | VEGAPDDPAKADDVPVGQLVMHIATFDASAGITQNLVQVEAAIRADTLVQPLLILTHARPEAWPA |
| Ga0307310_100006609 | 3300028824 | Soil | MHIATFDTSTGVTQHLVQVEAVVRAESLVQPLLILTPTRPAAWPM |
| Ga0307310_102001421 | 3300028824 | Soil | DPLDRPLASLLMHIATFDTSTGVTQNMVQVEAQVKAETLVQPLLVLTHARPNAWPL |
| Ga0307312_109320301 | 3300028828 | Soil | PLPGTDDNRADPMDRPLASLLMHIATFDTSSGVTQHLVQVEAQVKAETLVQPLLVLTHARPNAWPL |
| Ga0307314_101396151 | 3300028872 | Soil | TPVLGTEDSRADPMDRPLSCLLMHIATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHARPNAWPL |
| Ga0307278_105428561 | 3300028878 | Soil | PLDRPLASLLMHIATFDTSTGVTQNMVQVEAQVKAETLVQPLLVLTHARPNAWPL |
| Ga0307277_104596201 | 3300028881 | Soil | STGVTQHLVQVEAQVKAETLVQPLLVLTHARPNAWPL |
| Ga0307308_102348252 | 3300028884 | Soil | DSRADPMDRPLSCLLMHIATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHARPNAWPL |
| Ga0268386_109626822 | 3300030619 | Soil | TFDTSAGVTQHLVQVEALVKAETLVQPLLVLTHERPGAWPL |
| Ga0307408_1000653811 | 3300031548 | Rhizosphere | SMLMHIATFDTSTGVTQHLVQVEAVVKAESLVQPLLILAPSRPAAWPL |
| Ga0307408_1019144381 | 3300031548 | Rhizosphere | AGVTQHLVQVEALVKAESLVQPLIVLTHERPGAWPL |
| Ga0307408_1019289581 | 3300031548 | Rhizosphere | ANVDRPLSSLVMQIATFDTSAGVTQHLVQVEALVKAETLVQPLLVLTQERPAPWPM |
| Ga0307413_101716822 | 3300031824 | Rhizosphere | QMQIATFDAQTGVTKHLVQVEAVVKAETLVQPLVVLTTQRPSSWPL |
| Ga0307413_101872732 | 3300031824 | Rhizosphere | LASMLMHIATFDTSTGVTQHLVQVEAVVKAESLVQPLLILAPSRPAAWPL |
| Ga0307413_102474642 | 3300031824 | Rhizosphere | SLLMHIATFDTTTGVTQHLVQVEAQVKAETLVQPLLVLTHTRPGAWPL |
| Ga0307410_102217181 | 3300031852 | Rhizosphere | GVTQHLVQVEALVKAETLVQPLLVLTQERPAPWPM |
| Ga0307410_113108911 | 3300031852 | Rhizosphere | ATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHVRPNAWPL |
| Ga0307407_100043281 | 3300031903 | Rhizosphere | MNIATFDTSTGITQHLVQVEAVVKAESLVQPLLILTPSRPAAWPM |
| Ga0307412_104322811 | 3300031911 | Rhizosphere | GTDNSKADPLDRPLASLLMHIATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHVRPNAWPL |
| Ga0308175_1027775782 | 3300031938 | Soil | LMHIATFDANTGVTQNLVQVEAVVKAETLVQPLLILTPGRPGTWPY |
| Ga0307409_1003645172 | 3300031995 | Rhizosphere | TFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHVRPNAWPL |
| Ga0307415_1012410511 | 3300032126 | Rhizosphere | VIGTDNSKADPLDRPLASLLMHIATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHVRPNAWPL |
| Ga0310889_106416051 | 3300032179 | Soil | TLEAAEGSKAEPDQRPLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL |
| Ga0316628_1004673092 | 3300033513 | Soil | FDTCTGVTQHLVQVEAQVKAETLVQPLLVLTHSRPGPWPL |
| ⦗Top⦘ |