| Basic Information | |
|---|---|
| Family ID | F082342 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MFYFWHTAIVILFLAFSFFMGYRLGKKKVNKPEEIKRKCPMGFN |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 54.87 % |
| % of genes near scaffold ends (potentially truncated) | 19.47 % |
| % of genes from short scaffolds (< 2000 bps) | 72.57 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.752 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (23.009 % of family members) |
| Environment Ontology (ENVO) | Unclassified (69.027 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.257 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 63.64% β-sheet: 0.00% Coil/Unstructured: 36.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00534 | Glycos_transf_1 | 23.89 |
| PF13640 | 2OG-FeII_Oxy_3 | 4.42 |
| PF13759 | 2OG-FeII_Oxy_5 | 3.54 |
| PF01832 | Glucosaminidase | 0.88 |
| PF07596 | SBP_bac_10 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG2165 | Type II secretory pathway, pseudopilin PulG | Cell motility [N] | 1.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.26 % |
| Unclassified | root | N/A | 32.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109022102 | Not Available | 569 | Open in IMG/M |
| 3300002408|B570J29032_109414597 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300003277|JGI25908J49247_10071759 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 866 | Open in IMG/M |
| 3300003388|JGI25910J50241_10055837 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1206 | Open in IMG/M |
| 3300003395|JGI25917J50250_1081106 | Not Available | 676 | Open in IMG/M |
| 3300003412|JGI25912J50252_10086133 | Not Available | 779 | Open in IMG/M |
| 3300004240|Ga0007787_10587064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 558 | Open in IMG/M |
| 3300005581|Ga0049081_10022597 | All Organisms → cellular organisms → Bacteria | 2388 | Open in IMG/M |
| 3300005581|Ga0049081_10090349 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1145 | Open in IMG/M |
| 3300005582|Ga0049080_10258992 | Not Available | 566 | Open in IMG/M |
| 3300005805|Ga0079957_1067640 | All Organisms → cellular organisms → Bacteria | 2081 | Open in IMG/M |
| 3300006030|Ga0075470_10218950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 542 | Open in IMG/M |
| 3300006805|Ga0075464_10324309 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 929 | Open in IMG/M |
| 3300006805|Ga0075464_10506784 | Not Available | 739 | Open in IMG/M |
| 3300006805|Ga0075464_10568099 | Not Available | 697 | Open in IMG/M |
| 3300006805|Ga0075464_10617360 | All Organisms → Viruses → environmental samples → uncultured virus | 668 | Open in IMG/M |
| 3300006875|Ga0075473_10202736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 801 | Open in IMG/M |
| 3300006917|Ga0075472_10450373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 639 | Open in IMG/M |
| 3300007344|Ga0070745_1134453 | All Organisms → Viruses | 946 | Open in IMG/M |
| 3300008267|Ga0114364_1034378 | All Organisms → cellular organisms → Bacteria | 2764 | Open in IMG/M |
| 3300008448|Ga0114876_1218757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 624 | Open in IMG/M |
| 3300008450|Ga0114880_1085719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1248 | Open in IMG/M |
| 3300009068|Ga0114973_10528022 | Not Available | 609 | Open in IMG/M |
| 3300009075|Ga0105090_10534439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 713 | Open in IMG/M |
| 3300009152|Ga0114980_10014073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5082 | Open in IMG/M |
| 3300009152|Ga0114980_10179593 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1248 | Open in IMG/M |
| 3300009158|Ga0114977_10109403 | All Organisms → Viruses | 1671 | Open in IMG/M |
| 3300009159|Ga0114978_10869375 | Not Available | 505 | Open in IMG/M |
| 3300009165|Ga0105102_10105767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1326 | Open in IMG/M |
| 3300009165|Ga0105102_10819834 | Not Available | 531 | Open in IMG/M |
| 3300009170|Ga0105096_10213497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
| 3300009170|Ga0105096_10433719 | Not Available | 679 | Open in IMG/M |
| 3300009181|Ga0114969_10038545 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 3260 | Open in IMG/M |
| 3300009181|Ga0114969_10764432 | Not Available | 515 | Open in IMG/M |
| 3300009183|Ga0114974_10405300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 780 | Open in IMG/M |
| 3300010370|Ga0129336_10542149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 624 | Open in IMG/M |
| 3300012013|Ga0153805_1008450 | All Organisms → Viruses | 1784 | Open in IMG/M |
| 3300012666|Ga0157498_1002490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3164 | Open in IMG/M |
| 3300013004|Ga0164293_10143371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1783 | Open in IMG/M |
| 3300013004|Ga0164293_10185839 | Not Available | 1513 | Open in IMG/M |
| 3300013004|Ga0164293_10489154 | All Organisms → Viruses | 814 | Open in IMG/M |
| 3300013005|Ga0164292_10037636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3871 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10272848 | Not Available | 1014 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10012123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 10160 | Open in IMG/M |
| 3300013295|Ga0170791_13787442 | Not Available | 839 | Open in IMG/M |
| 3300013372|Ga0177922_10803266 | All Organisms → Viruses | 617 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10332825 | Not Available | 895 | Open in IMG/M |
| 3300014811|Ga0119960_1041348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 725 | Open in IMG/M |
| 3300017722|Ga0181347_1016798 | All Organisms → cellular organisms → Bacteria | 2337 | Open in IMG/M |
| 3300017722|Ga0181347_1052092 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300017747|Ga0181352_1008147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3452 | Open in IMG/M |
| 3300017747|Ga0181352_1192220 | Not Available | 527 | Open in IMG/M |
| 3300017754|Ga0181344_1127455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 732 | Open in IMG/M |
| 3300017754|Ga0181344_1179836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 597 | Open in IMG/M |
| 3300017766|Ga0181343_1022352 | Not Available | 1945 | Open in IMG/M |
| 3300019784|Ga0181359_1014836 | All Organisms → cellular organisms → Bacteria | 2870 | Open in IMG/M |
| 3300019784|Ga0181359_1017181 | All Organisms → Viruses | 2698 | Open in IMG/M |
| 3300019784|Ga0181359_1213449 | Not Available | 612 | Open in IMG/M |
| 3300020141|Ga0211732_1542847 | Not Available | 591 | Open in IMG/M |
| 3300020530|Ga0208235_1016050 | Not Available | 932 | Open in IMG/M |
| 3300020533|Ga0208364_1027108 | Not Available | 787 | Open in IMG/M |
| 3300022190|Ga0181354_1051720 | All Organisms → Viruses | 1368 | Open in IMG/M |
| 3300022190|Ga0181354_1075434 | Not Available | 1116 | Open in IMG/M |
| 3300022190|Ga0181354_1243868 | Not Available | 515 | Open in IMG/M |
| 3300022407|Ga0181351_1032781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2209 | Open in IMG/M |
| 3300022407|Ga0181351_1140759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 880 | Open in IMG/M |
| 3300022752|Ga0214917_10047037 | Not Available | 2969 | Open in IMG/M |
| 3300022752|Ga0214917_10073894 | Not Available | 2124 | Open in IMG/M |
| 3300025889|Ga0208644_1297449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 643 | Open in IMG/M |
| 3300025896|Ga0208916_10245631 | All Organisms → Viruses | 778 | Open in IMG/M |
| 3300027581|Ga0209651_1122543 | Not Available | 720 | Open in IMG/M |
| 3300027608|Ga0208974_1029377 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
| 3300027608|Ga0208974_1036082 | Not Available | 1472 | Open in IMG/M |
| 3300027659|Ga0208975_1001208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 11264 | Open in IMG/M |
| 3300027697|Ga0209033_1022727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2519 | Open in IMG/M |
| 3300027707|Ga0209443_1115841 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1002 | Open in IMG/M |
| 3300027721|Ga0209492_1258294 | Not Available | 588 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1095112 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300027732|Ga0209442_1274588 | Not Available | 592 | Open in IMG/M |
| 3300027733|Ga0209297_1000420 | All Organisms → cellular organisms → Bacteria | 27620 | Open in IMG/M |
| 3300027733|Ga0209297_1080298 | All Organisms → Viruses | 1424 | Open in IMG/M |
| 3300027734|Ga0209087_1002458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 10437 | Open in IMG/M |
| 3300027736|Ga0209190_1028284 | All Organisms → cellular organisms → Bacteria | 3040 | Open in IMG/M |
| 3300027756|Ga0209444_10070796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 1505 | Open in IMG/M |
| 3300027760|Ga0209598_10060034 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1915 | Open in IMG/M |
| 3300027760|Ga0209598_10343898 | Not Available | 567 | Open in IMG/M |
| 3300027763|Ga0209088_10041052 | Not Available | 2286 | Open in IMG/M |
| 3300027782|Ga0209500_10237231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 803 | Open in IMG/M |
| 3300027804|Ga0209358_10005172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9198 | Open in IMG/M |
| 3300027900|Ga0209253_10135744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2000 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1097018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1330 | Open in IMG/M |
| 3300028025|Ga0247723_1017604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2495 | Open in IMG/M |
| 3300028025|Ga0247723_1152056 | Not Available | 541 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1124198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1174 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1007278 | All Organisms → cellular organisms → Bacteria | 13753 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1088813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1476 | Open in IMG/M |
| 3300029930|Ga0119944_1039358 | Not Available | 589 | Open in IMG/M |
| 3300031707|Ga0315291_10249547 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1773 | Open in IMG/M |
| 3300031746|Ga0315293_10065855 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 3117 | Open in IMG/M |
| 3300031857|Ga0315909_10284978 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1245 | Open in IMG/M |
| 3300032118|Ga0315277_10157235 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 2512 | Open in IMG/M |
| 3300032156|Ga0315295_10186929 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 2076 | Open in IMG/M |
| 3300032173|Ga0315268_11737903 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 637 | Open in IMG/M |
| 3300034061|Ga0334987_0120917 | All Organisms → cellular organisms → Bacteria | 1973 | Open in IMG/M |
| 3300034073|Ga0310130_0288801 | Not Available | 521 | Open in IMG/M |
| 3300034101|Ga0335027_0010828 | All Organisms → cellular organisms → Bacteria | 7880 | Open in IMG/M |
| 3300034101|Ga0335027_0020772 | All Organisms → cellular organisms → Bacteria | 5575 | Open in IMG/M |
| 3300034101|Ga0335027_0578529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 688 | Open in IMG/M |
| 3300034102|Ga0335029_0036627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3666 | Open in IMG/M |
| 3300034111|Ga0335063_0474049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 615 | Open in IMG/M |
| 3300034112|Ga0335066_0719366 | Not Available | 502 | Open in IMG/M |
| 3300034120|Ga0335056_0544552 | Not Available | 606 | Open in IMG/M |
| 3300034272|Ga0335049_0626639 | Not Available | 663 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 23.01% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 20.35% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 14.16% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.31% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.31% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.77% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.77% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.77% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.89% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.89% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.89% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.89% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.89% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.89% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.89% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.89% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1090221021 | 3300002408 | Freshwater | MFYFWHTAIVILFLVFSFFMGYKLGKKNVNKTEEIKRKCPMGFN* |
| B570J29032_1094145972 | 3300002408 | Freshwater | MFYFWHTAIVILFLVFSFFMGYKLGKKNVNKTEEIKTKCPMGFN* |
| JGI25908J49247_100717591 | 3300003277 | Freshwater Lake | MFYIWHTLLVLLFIGFAFFMGYRLGRSKPVESKQEVKTKCPMGFN* |
| JGI25910J50241_100558373 | 3300003388 | Freshwater Lake | MFYIWHTLLVLLFIGFAFFMGYRLGRNKPVESKQEVKTKCPMGFN* |
| JGI25917J50250_10811062 | 3300003395 | Freshwater Lake | MFYIWHTLLVLLFIGFAFFMGYRLGRSKPVESKQEVKAKCPMGFN* |
| JGI25912J50252_100861332 | 3300003412 | Freshwater Lake | MFYIWHTLLVLLFIGFAFFMGYRLGRSKPVESKQEVKXKCPMGFN* |
| Ga0007787_105870641 | 3300004240 | Freshwater Lake | MFYFWHTALVILFIAFSFCLGYKLGKNKSDKKEEVKRKCPMGFN* |
| Ga0049081_100225975 | 3300005581 | Freshwater Lentic | MMFYIWHTLIVLLFVAFSFFMGYKLGKSKSDKKEEVKLKCPMGFN* |
| Ga0049081_100903493 | 3300005581 | Freshwater Lentic | MFYIWHTLLVLLFIGFAFFMGYRLGRNKPVESKQEVKAKCPMGFN* |
| Ga0049080_102589922 | 3300005582 | Freshwater Lentic | MMFYIWHTLIVLLFVAFSFFMGYKLGKSKSDKKEEVKRKCPMGFN* |
| Ga0079957_10676402 | 3300005805 | Lake | MMFYIWHTLIVLLFVAFSFFMGYKLGKSKSNKEEVKRKCPMGFN* |
| Ga0075470_102189503 | 3300006030 | Aqueous | MFYFWHTAIVILFLAFSFFMGYRMGKKTINKTEEVKRKCPMGFN* |
| Ga0075464_103243093 | 3300006805 | Aqueous | MFYIWHTLLVLLFITFAFFMGYRLGKNKVVENKEVKRKCPMGFN* |
| Ga0075464_105067842 | 3300006805 | Aqueous | MFYFWHTALVILFLVFSFFMGYRLGKKNVNKTEEVKRKCPMGFN* |
| Ga0075464_105680993 | 3300006805 | Aqueous | MFYIWHTLLVLLFIAFAFFMGYRLGRNKSVESKQEVKAKCPMGFN**HKKQ* |
| Ga0075464_106173603 | 3300006805 | Aqueous | MMFYIWHTLIVLLFIAFSFFMGYKMGKKNVNKKEEIKRKCPMGFN* |
| Ga0075473_102027362 | 3300006875 | Aqueous | MFYFWHTAIVILFLAFSFFMGYRLGKKKVNKPEEIKRKCPMGFN* |
| Ga0075472_104503731 | 3300006917 | Aqueous | VILFLAFSFFMGYKMGKKNVNKTEETKRKCPMGFN* |
| Ga0070745_11344533 | 3300007344 | Aqueous | MFYFWHTAIVILFLAFSFFMGYKFGKKKTNEEPKRKCPMGFN* |
| Ga0114364_10343787 | 3300008267 | Freshwater, Plankton | MFYIWHTLLVLLFIGFAFFMGYRLGRSKPVESKQEV |
| Ga0114876_12187573 | 3300008448 | Freshwater Lake | WHTAIVILFLIFSFFMGYKLGKKNVNKTEEIKTKCPMGFN* |
| Ga0114880_10857193 | 3300008450 | Freshwater Lake | MFYFWHTAIVILFLVFSFFMGYRLGKKNVNKPEEIKRKCPMGFN* |
| Ga0114973_105280222 | 3300009068 | Freshwater Lake | MFYIWHTLLVLLFIAFAFFMGYRLGRNKSVESKQEIKAKCPMGFN* |
| Ga0105090_105344393 | 3300009075 | Freshwater Sediment | LYAKINMFYFWHTAIVILFLAFSFFMGYKMGKKNVNKTEEPKRKCPMGFN* |
| Ga0114980_100140737 | 3300009152 | Freshwater Lake | MFYFWHTAIVILFLVFSFFMGYRMGKKTINKTEEVKRKCPMGFN* |
| Ga0114980_101795933 | 3300009152 | Freshwater Lake | MFYIWHTLLVLLFIAFAFFMGYRLGRNKPVESKQEVKAKCPMGFN* |
| Ga0114977_101094033 | 3300009158 | Freshwater Lake | MFYFWHTAIVILFLVFSFFMGYRLGKKNVNKPEEVKRKCPMGFN* |
| Ga0114978_108693752 | 3300009159 | Freshwater Lake | MFYIWHTLLVLLFIVFAFFMGYRLGRNKPVESKQEVKAKCPMGFN* |
| Ga0105102_101057673 | 3300009165 | Freshwater Sediment | MFYFWHTTIVILFLAFSFFMGYKMGKKNVNKTEEPKKKCPMGFN* |
| Ga0105102_108198342 | 3300009165 | Freshwater Sediment | MFYIWHTLIVLLFVAFSFFMGYKLGKSKSDKKEEVKRKCPMGFN* |
| Ga0105096_102134973 | 3300009170 | Freshwater Sediment | MFYFWHTAIVILFLVFSFFMGYRLGKKNGNKPEEIKRKCPMGFN* |
| Ga0105096_104337192 | 3300009170 | Freshwater Sediment | MFYFWHTTIVILFLAFSFFMGYKMGKKNVNKTEEPKRKCPMGFN* |
| Ga0114969_100385453 | 3300009181 | Freshwater Lake | MFYIWHTLLVLLFIAFAFFMGYRLGRSKPVESKQEIKAKCPMGFN* |
| Ga0114969_107644322 | 3300009181 | Freshwater Lake | MFYIWHTLLVLLFITFAFFMGYRLGKNKTVESKQEVKKCPMGFN* |
| Ga0114974_104053003 | 3300009183 | Freshwater Lake | MFYFWHTAIVVLFLAFSFFMGYRMGKKTINKTEEVKRKCPMGFN* |
| Ga0129336_105421492 | 3300010370 | Freshwater To Marine Saline Gradient | MFYFWHTAIVILFLAFSFFMGYRFGKKKTNEEPKRKCPMGFN* |
| Ga0153805_10084504 | 3300012013 | Surface Ice | MFYFWHTAIVILFLIFSFFMGYKLGKKNVNKTEEIKTKCPMGFN* |
| Ga0157498_10024905 | 3300012666 | Freshwater, Surface Ice | MMFYIWHTLIILLFVAFSFFMGYKLGKSKSDKKEEVKRKCPMGFN* |
| Ga0164293_101433714 | 3300013004 | Freshwater | WHTLIVLLFVAFSFFMGYKLGKSKSDKKEEVKRKCPMGFN* |
| Ga0164293_101858393 | 3300013004 | Freshwater | MFYFWHTAIVILFLVFSFFMGYRLGKKNVNKTEEIKR |
| Ga0164293_104891543 | 3300013004 | Freshwater | NMFYFWHTAIVILFLVFSFFMGYRLGKKNVNKTEEIKRKCPMGFN* |
| Ga0164292_100376363 | 3300013005 | Freshwater | MFYFWHTAIVILFLIFSFFMGYKLGKKNVNKTEEIKRKCPMGFN* |
| (restricted) Ga0172367_102728484 | 3300013126 | Freshwater | MMFYIWHTLIVLLFVAFSFFMGYKLGKNKSDKKEEVKRKCPMGFN* |
| (restricted) Ga0172373_1001212315 | 3300013131 | Freshwater | MMFYIWHTLIVLLFIAFSFFMGYKLGKSKSDKKEEVKRKCPMGFN* |
| Ga0170791_137874422 | 3300013295 | Freshwater | MFYIWHTLLVLLFIAFAFFMGYRLGRNKPVESKQEIKAKCPMGFN* |
| Ga0177922_108032663 | 3300013372 | Freshwater | SRKKMMFYIWHTLIVLLFVAFSFFMGYKLGKSKSDKKEEVKRKCPMGFN* |
| (restricted) Ga0172376_103328254 | 3300014720 | Freshwater | MFYIWHTLIVLLFVAFSFFMGYKLGKNKSDKKEEVKRKCPMGFN |
| Ga0119960_10413483 | 3300014811 | Aquatic | MMFYFWHTAIVVLFIAFSFFLGYKLGKNKSSKKEEVKRKCPMGFN* |
| Ga0181347_10167984 | 3300017722 | Freshwater Lake | MFYFWHTTIVILFLIFSFFMGYKLGKKNVNKTEEIKRKCPMGFN |
| Ga0181347_10520925 | 3300017722 | Freshwater Lake | MMFYIWHTLIVLLFVAFSFYLGYKLGKSKSNKEQVKRKCPMGFN |
| Ga0181352_10081475 | 3300017747 | Freshwater Lake | MMFYFWHTALVILFIAFSFCLGYKLGKNKSDKKEEVKRKCPMGFN |
| Ga0181352_11922203 | 3300017747 | Freshwater Lake | MMFYIWHTLLVLLFVAFSFFMGYKLGKSKSEKKEEVKRKCPMGFN |
| Ga0181344_11274551 | 3300017754 | Freshwater Lake | RKKMMFYFWHTALVILFIAFSFCLGYKLGKNKSDKKEEVKRKCPMGFN |
| Ga0181344_11798363 | 3300017754 | Freshwater Lake | MFYFWHTAIVILFLVFSFFMGYKMGKKNVNKTEEIKRKCPMGFN |
| Ga0181343_10223522 | 3300017766 | Freshwater Lake | MFYFWHTAIVILFLVFSFFMGYRLGKKKVNKPEEIKRKCPMGFN |
| Ga0181359_10148363 | 3300019784 | Freshwater Lake | MFYIWHTLLVLLFIGFAFFMGYRLGRSKPVESKQEVKAKCPMGFN |
| Ga0181359_10171813 | 3300019784 | Freshwater Lake | MMFYIWHTLIVLLFVAFSFYLGYKLGKSKSNREQVKRKCPMGFN |
| Ga0181359_12134491 | 3300019784 | Freshwater Lake | MFYFWHTAIVILFLIFSFFMGYKLGKKNANKTEEIKRKCPMGFN |
| Ga0211732_15428472 | 3300020141 | Freshwater | MFYFWHTAIVILFLAFSFFMGYKMGKKNVNKPEEIKRKCPMGFN |
| Ga0208235_10160503 | 3300020530 | Freshwater | MFYFWHTAIVILFLVFSFFMGYKLGKKNVNKTEEIKTKCPMGFN |
| Ga0208364_10271084 | 3300020533 | Freshwater | MFYIWHTLIVLLFVAFSFFMGYKLGKSKSDKKEEVKRKCPMGFN |
| Ga0181354_10517203 | 3300022190 | Freshwater Lake | MMFYFWHTALVILFIAFSFFLGYKLGKNKSNKKEEVKSKCPMGFN |
| Ga0181354_10754342 | 3300022190 | Freshwater Lake | MFYIWHTLLVLLFIGFAFFMGYRLGRNKPVESKQEVKAKCPMGFN |
| Ga0181354_12438682 | 3300022190 | Freshwater Lake | MFYFWHTAIVILFLAFSFFMGYRLGKKKVNKPEEIKRKCPMGFN |
| Ga0181351_10327814 | 3300022407 | Freshwater Lake | FWHTAIVILFLVFSFFMGYKLGKKNVNKTEEIKRKCPMGFN |
| Ga0181351_11407592 | 3300022407 | Freshwater Lake | MFYFWHTAIVILFLIFSFFMGYKLGKKNVNKTEEIKTKCPMGFN |
| Ga0214917_100470375 | 3300022752 | Freshwater | MFYIWHTLLVLLFITFAFFMGYRLGKNKVVENKEVKRKCPMGFN |
| Ga0214917_100738942 | 3300022752 | Freshwater | MFYIWHTLLVLVFITFAFFMGYRLGKNKVVENKEVKRKCPMGFN |
| Ga0208644_12974493 | 3300025889 | Aqueous | MFYFWHTAIVILFLAFSFFMGYRFGKKKTNEEPKRKCPMGFN |
| Ga0208916_102456312 | 3300025896 | Aqueous | MFYFWHTALVILFLVFSFFMGYRLGKKNVNKTEEVKRKCPMGFN |
| Ga0209651_11225432 | 3300027581 | Freshwater Lake | MMFYIWHTLLVLLFIGFAFFMGYRLGRSKPVESKQEVKAKCPMGFN |
| Ga0208974_10293775 | 3300027608 | Freshwater Lentic | MMFYIWHTLIVLLFVAFSFFMGYKLGKSKSDKKEEVKLKCPMGFN |
| Ga0208974_10360824 | 3300027608 | Freshwater Lentic | MMFYIWHTLIVLLFVAFSFFMGYKLGKNKSNKKEEVKRKCPMGFN |
| Ga0208975_10012089 | 3300027659 | Freshwater Lentic | MFYFWHTAIVILFLVFSFFMGYKLGKKNANKTEEIKRKCPMGFN |
| Ga0209033_10227275 | 3300027697 | Freshwater Lake | IVILFLAFSFFMGYRLGKKNVNKSEEVKRKCPMGFN |
| Ga0209443_11158413 | 3300027707 | Freshwater Lake | YILKFMFYIWHTLLVLLFIGFAFFMGYRLGRSKPVESKQEVKAKCPMGFN |
| Ga0209492_12582943 | 3300027721 | Freshwater Sediment | MFYFWHTAIVILFLVFSFFMGYRLGKKNVNKPEEIKRK |
| (restricted) Ga0247836_10951122 | 3300027728 | Freshwater | MMFYIWHTLIVLLFVAFSFFMGYRLGKSKSNKEEVKRKCPMGFN |
| Ga0209442_12745883 | 3300027732 | Freshwater Lake | LLVLLFIGFAFFMGYRLGRSKPVESKQEVKTKCPMGFN |
| Ga0209297_10004208 | 3300027733 | Freshwater Lake | MFYIWHTLLVLLFIVFAFFMGYRLGRNKPVESKQEVKAKCPMGFN |
| Ga0209297_10802984 | 3300027733 | Freshwater Lake | MFYFWHTAIVILFLVFSFFMGYRLGKKNVNKPEEVKRKCPMGFN |
| Ga0209087_10024589 | 3300027734 | Freshwater Lake | MFYFWHTAIVVLFLAFSFFMGYRMGKKTINKTEEVKRKCPMGFN |
| Ga0209190_10282844 | 3300027736 | Freshwater Lake | MFYIWHTLLVLLFIAFAFFMGYRLGRSKPVESKQEIKAKCPMGFN |
| Ga0209444_100707961 | 3300027756 | Freshwater Lake | LLVLLFIGFAFFMGYRLGRNKPVESKQEVKVKCPMGFN |
| Ga0209598_100600345 | 3300027760 | Freshwater Lake | MFYIWHTLLVLLFIAFAFFMGYRLGRNKSVESKQEIKAKCPMGFN |
| Ga0209598_103438982 | 3300027760 | Freshwater Lake | MFYIWHTLLVLLFITFAFFMGYRLGKNKTVESKQEVKKCPMGFN |
| Ga0209088_100410526 | 3300027763 | Freshwater Lake | MFYIWHTLLVLLFIAFAFFMGYRLGRNKPVESKQEVKAKCPMGFN |
| Ga0209500_102372312 | 3300027782 | Freshwater Lake | MFYFWHTAIVILFLVFSFFMGYRMGKKTINKTEEVKRKCPMGFN |
| Ga0209358_100051729 | 3300027804 | Freshwater Lake | MFYFWHTAIVILFLAFSFFMGYRLGKKNVNKSEEVKRKCPMGFN |
| Ga0209253_101357443 | 3300027900 | Freshwater Lake Sediment | MFYFWHTAIVILFLAFSFFMGYKMGKKNVNKTEEVKRKCPMGFN |
| (restricted) Ga0247834_10970182 | 3300027977 | Freshwater | MFYIWHTLIVLLFIAFSFFMGYKLGKSKSNKEEVKRKCPMGFN |
| Ga0247723_10176044 | 3300028025 | Deep Subsurface Sediment | MMFYIWHTLIVLLFVAFSFFMGYKLGKSKSEKKEEVKRKCPMGFN |
| Ga0247723_11520561 | 3300028025 | Deep Subsurface Sediment | MFYFWHTAIVILFLAFSFFMGYRLGKKKINKPEEIKRKCPMGFN |
| (restricted) Ga0247839_11241981 | 3300028553 | Freshwater | WHTLIVLLFVAFSFFMGYKLGKSKSSKEEVKRKCPMGFN |
| (restricted) Ga0247843_100727817 | 3300028569 | Freshwater | MFYIWHTLIVLLFVAFSFFMGYKLGKSKSNKEEVKRKCPMGFN |
| (restricted) Ga0247844_10888134 | 3300028571 | Freshwater | IIMFYIWHTLIVLLFVAFSFFMGYKLGKSKSSKEEVKRKCPMGFN |
| Ga0119944_10393581 | 3300029930 | Aquatic | MFYFWHTAIVILFLAFSFFMGYKMGKKNVNKTEEIKRKCPMGFN |
| Ga0315291_102495473 | 3300031707 | Sediment | MFYIWHTLLVLLFICFAFFMGYRLGRNKPVESKKEVKAKCPMGFN |
| Ga0315293_100658555 | 3300031746 | Sediment | MFYIWHTLLVLLFITFAFFMGYRLGKSKPVESKQEVKAKCPMGFN |
| Ga0315909_102849783 | 3300031857 | Freshwater | MFYIWHTLLVLLFIGFAFFMGYRLGRSKPVESKQEVKTKCPMGFN |
| Ga0315277_101572354 | 3300032118 | Sediment | MFYIWHTLLVLLFICFAFFMGYRLGRSKTVESKKEVKAKCPMGFN |
| Ga0315295_101869293 | 3300032156 | Sediment | MFYIWHTILVLLFICFAFFMGYRLGRSKTVESKQEVKAKCPMGFN |
| Ga0315268_117379033 | 3300032173 | Sediment | LKFMFYIWHTLLVLLFICFAFFMRYRLGRNKPVESKKEVKAKCPMGFN |
| Ga0334987_0120917_390_524 | 3300034061 | Freshwater | MFYIWHTLIILLFVAFSFFMGYKLGKSKSDKKEEVKRKCPMGFN |
| Ga0310130_0288801_52_186 | 3300034073 | Fracking Water | MFYIWHTLLVLLFVAFSFFMGYKLGKSKSDKKEEVKRKCPMGFN |
| Ga0335027_0010828_5079_5213 | 3300034101 | Freshwater | MFYFWHTAIVILFLVLSFFMGYRLGKKNVNKPEEIKRKCPMGFN |
| Ga0335027_0020772_5012_5146 | 3300034101 | Freshwater | MFYFWHTAIVILFLIFSFFMGYKMGKKNVNKTEEIKKKCPMGFN |
| Ga0335027_0578529_420_554 | 3300034101 | Freshwater | MFYFWHTAIVILFLAFSFFMGYKMGKKNVNKTEEIKKKCPMGFN |
| Ga0335029_0036627_398_532 | 3300034102 | Freshwater | MFYFWHTAIVILFLVFSFFMGYKLGKKNVNKTEEIKRKCPMGFN |
| Ga0335063_0474049_2_109 | 3300034111 | Freshwater | IVLLFVAFSFFMGYKLGKSKSNKEEVKRKCPMGFN |
| Ga0335066_0719366_376_501 | 3300034112 | Freshwater | MFYFWHTAIVILFLVFSFFMGYRLGKKNVNKPEEIKRKCPMG |
| Ga0335056_0544552_455_604 | 3300034120 | Freshwater | MMFYIWHTLIVLLFVAFSFFMGYKLGKSKSNKEQVKRKCPMGFNWYGWWN |
| Ga0335049_0626639_187_321 | 3300034272 | Freshwater | MFYFWHTAIVILFLVFSFFMGYKLGKKNVNKPEEIKRKCPMGFN |
| ⦗Top⦘ |