| Basic Information | |
|---|---|
| Family ID | F082330 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MKRLIIVLVLLACIAAVAYASLRSNKQKAAIKTEKKEIKKKHECSHTCAYS |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.88 % |
| % of genes near scaffold ends (potentially truncated) | 46.90 % |
| % of genes from short scaffolds (< 2000 bps) | 80.53 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (48.673 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.159 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.867 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.522 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 59.49% β-sheet: 0.00% Coil/Unstructured: 40.51% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00970 | FAD_binding_6 | 46.90 |
| PF01791 | DeoC | 15.04 |
| PF00202 | Aminotran_3 | 2.65 |
| PF02518 | HATPase_c | 2.65 |
| PF14079 | DUF4260 | 0.88 |
| PF10543 | ORF6N | 0.88 |
| PF08022 | FAD_binding_8 | 0.88 |
| PF13620 | CarboxypepD_reg | 0.88 |
| PF05635 | 23S_rRNA_IVP | 0.88 |
| PF00521 | DNA_topoisoIV | 0.88 |
| PF12681 | Glyoxalase_2 | 0.88 |
| PF02276 | CytoC_RC | 0.88 |
| PF08874 | DUF1835 | 0.88 |
| PF07681 | DoxX | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.88 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.88 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.33 % |
| Unclassified | root | N/A | 48.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101844816 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 9162 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1001787 | All Organisms → cellular organisms → Bacteria | 4362 | Open in IMG/M |
| 3300004114|Ga0062593_101801454 | Not Available | 673 | Open in IMG/M |
| 3300004114|Ga0062593_102051620 | Not Available | 636 | Open in IMG/M |
| 3300004463|Ga0063356_100101887 | All Organisms → cellular organisms → Bacteria | 3118 | Open in IMG/M |
| 3300004479|Ga0062595_100582379 | Not Available | 866 | Open in IMG/M |
| 3300004480|Ga0062592_101452625 | Not Available | 655 | Open in IMG/M |
| 3300005168|Ga0066809_10036604 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300005328|Ga0070676_10006331 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 6323 | Open in IMG/M |
| 3300005328|Ga0070676_10191058 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1337 | Open in IMG/M |
| 3300005329|Ga0070683_100014205 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 6958 | Open in IMG/M |
| 3300005330|Ga0070690_100010323 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 5431 | Open in IMG/M |
| 3300005332|Ga0066388_101466438 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1191 | Open in IMG/M |
| 3300005335|Ga0070666_11165763 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005344|Ga0070661_100055615 | All Organisms → cellular organisms → Bacteria | 2897 | Open in IMG/M |
| 3300005344|Ga0070661_100117841 | Not Available | 1987 | Open in IMG/M |
| 3300005347|Ga0070668_101389438 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005354|Ga0070675_100045751 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 3582 | Open in IMG/M |
| 3300005354|Ga0070675_100206800 | Not Available | 1705 | Open in IMG/M |
| 3300005355|Ga0070671_100243870 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300005355|Ga0070671_100277142 | Not Available | 1426 | Open in IMG/M |
| 3300005365|Ga0070688_100039717 | All Organisms → cellular organisms → Bacteria | 2881 | Open in IMG/M |
| 3300005365|Ga0070688_101678851 | Not Available | 520 | Open in IMG/M |
| 3300005438|Ga0070701_10697086 | Not Available | 683 | Open in IMG/M |
| 3300005441|Ga0070700_100339319 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1110 | Open in IMG/M |
| 3300005446|Ga0066686_10523026 | Not Available | 807 | Open in IMG/M |
| 3300005456|Ga0070678_101296391 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 678 | Open in IMG/M |
| 3300005539|Ga0068853_100604332 | Not Available | 1042 | Open in IMG/M |
| 3300005547|Ga0070693_100373109 | Not Available | 982 | Open in IMG/M |
| 3300005547|Ga0070693_101022528 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005561|Ga0066699_10843329 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 643 | Open in IMG/M |
| 3300005574|Ga0066694_10109968 | Not Available | 1293 | Open in IMG/M |
| 3300005578|Ga0068854_101910847 | Not Available | 546 | Open in IMG/M |
| 3300005616|Ga0068852_100121115 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
| 3300005840|Ga0068870_10133801 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. CCMP2592 | 1443 | Open in IMG/M |
| 3300005842|Ga0068858_100289305 | Not Available | 1561 | Open in IMG/M |
| 3300005842|Ga0068858_100748329 | Not Available | 952 | Open in IMG/M |
| 3300005895|Ga0075277_1019405 | Not Available | 939 | Open in IMG/M |
| 3300006806|Ga0079220_11579826 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 567 | Open in IMG/M |
| 3300006954|Ga0079219_12432710 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 509 | Open in IMG/M |
| 3300009098|Ga0105245_11953691 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300009101|Ga0105247_10459090 | Not Available | 920 | Open in IMG/M |
| 3300009101|Ga0105247_10786233 | Not Available | 725 | Open in IMG/M |
| 3300010043|Ga0126380_12225062 | Not Available | 507 | Open in IMG/M |
| 3300010048|Ga0126373_10459089 | Not Available | 1310 | Open in IMG/M |
| 3300010358|Ga0126370_10605448 | Not Available | 947 | Open in IMG/M |
| 3300010359|Ga0126376_12408058 | Not Available | 573 | Open in IMG/M |
| 3300010360|Ga0126372_11550862 | Not Available | 700 | Open in IMG/M |
| 3300010398|Ga0126383_12712326 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300011119|Ga0105246_10114047 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1990 | Open in IMG/M |
| 3300011119|Ga0105246_10772193 | Not Available | 850 | Open in IMG/M |
| 3300012207|Ga0137381_11194597 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300012349|Ga0137387_10550637 | Not Available | 837 | Open in IMG/M |
| 3300012910|Ga0157308_10297072 | Not Available | 590 | Open in IMG/M |
| 3300012957|Ga0164303_10299347 | Not Available | 947 | Open in IMG/M |
| 3300012961|Ga0164302_10566842 | Not Available | 816 | Open in IMG/M |
| 3300012971|Ga0126369_10556610 | Not Available | 1212 | Open in IMG/M |
| 3300012985|Ga0164308_11764017 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012986|Ga0164304_11142830 | Not Available | 626 | Open in IMG/M |
| 3300012987|Ga0164307_10225534 | Not Available | 1292 | Open in IMG/M |
| 3300013102|Ga0157371_11179034 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300013307|Ga0157372_12705190 | Not Available | 569 | Open in IMG/M |
| 3300013307|Ga0157372_12931467 | Not Available | 546 | Open in IMG/M |
| 3300014969|Ga0157376_10616086 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300015371|Ga0132258_10289415 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4024 | Open in IMG/M |
| 3300015372|Ga0132256_100429197 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1426 | Open in IMG/M |
| 3300015372|Ga0132256_102170508 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300015374|Ga0132255_100090695 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 4121 | Open in IMG/M |
| 3300015374|Ga0132255_102688807 | Not Available | 761 | Open in IMG/M |
| 3300017654|Ga0134069_1369150 | Not Available | 517 | Open in IMG/M |
| 3300017792|Ga0163161_12031514 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus | 511 | Open in IMG/M |
| 3300017927|Ga0187824_10147062 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300017947|Ga0187785_10653960 | Not Available | 547 | Open in IMG/M |
| 3300018032|Ga0187788_10018561 | All Organisms → cellular organisms → Bacteria | 2201 | Open in IMG/M |
| 3300018482|Ga0066669_10723144 | Not Available | 878 | Open in IMG/M |
| 3300019888|Ga0193751_1081137 | Not Available | 1295 | Open in IMG/M |
| 3300020021|Ga0193726_1001711 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 16345 | Open in IMG/M |
| 3300021560|Ga0126371_13659451 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300021968|Ga0193698_1055298 | Not Available | 505 | Open in IMG/M |
| 3300025315|Ga0207697_10024038 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2496 | Open in IMG/M |
| 3300025893|Ga0207682_10168553 | Not Available | 995 | Open in IMG/M |
| 3300025899|Ga0207642_10596254 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300025903|Ga0207680_10099429 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1866 | Open in IMG/M |
| 3300025903|Ga0207680_10976490 | Not Available | 607 | Open in IMG/M |
| 3300025923|Ga0207681_10130770 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1856 | Open in IMG/M |
| 3300025925|Ga0207650_10293389 | Not Available | 1326 | Open in IMG/M |
| 3300025931|Ga0207644_10175066 | Not Available | 1678 | Open in IMG/M |
| 3300025932|Ga0207690_10017900 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4336 | Open in IMG/M |
| 3300025933|Ga0207706_10006384 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 10953 | Open in IMG/M |
| 3300025936|Ga0207670_10617524 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 891 | Open in IMG/M |
| 3300025941|Ga0207711_10439973 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. CCMP2592 | 1213 | Open in IMG/M |
| 3300025944|Ga0207661_10676616 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300025945|Ga0207679_10079697 | All Organisms → cellular organisms → Bacteria | 2498 | Open in IMG/M |
| 3300025945|Ga0207679_10619575 | Not Available | 977 | Open in IMG/M |
| 3300025945|Ga0207679_11317741 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 663 | Open in IMG/M |
| 3300025981|Ga0207640_11198262 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300026035|Ga0207703_12073126 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus | 545 | Open in IMG/M |
| 3300026041|Ga0207639_11205257 | Not Available | 710 | Open in IMG/M |
| 3300026116|Ga0207674_11572723 | Not Available | 626 | Open in IMG/M |
| 3300026121|Ga0207683_10365310 | Not Available | 1325 | Open in IMG/M |
| 3300026142|Ga0207698_10316384 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. CCMP2592 | 1460 | Open in IMG/M |
| 3300031231|Ga0170824_100784939 | Not Available | 780 | Open in IMG/M |
| 3300031716|Ga0310813_10023570 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 4242 | Open in IMG/M |
| 3300031716|Ga0310813_10373927 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1220 | Open in IMG/M |
| 3300031716|Ga0310813_11372993 | Not Available | 655 | Open in IMG/M |
| 3300031740|Ga0307468_101334106 | Not Available | 655 | Open in IMG/M |
| 3300031740|Ga0307468_102508582 | Not Available | 505 | Open in IMG/M |
| 3300032770|Ga0335085_10232136 | Not Available | 2233 | Open in IMG/M |
| 3300033004|Ga0335084_11904440 | Not Available | 581 | Open in IMG/M |
| 3300033412|Ga0310810_10045638 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium IBVUCB2 | 5350 | Open in IMG/M |
| 3300033412|Ga0310810_10737019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 907 | Open in IMG/M |
| 3300033412|Ga0310810_11386716 | Not Available | 539 | Open in IMG/M |
| 3300033475|Ga0310811_10051131 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 5503 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 7.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.19% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 6.19% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.54% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.77% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021968 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1018448162 | 3300000364 | Soil | MKRLVFVLVLLACIAAVAFASLRSNKQKPAIKTEKKEIKKKHECSHTCMYS* |
| AP72_2010_repI_A01DRAFT_10017873 | 3300000579 | Forest Soil | MKRLIVILLLLACVVAVAYASLRTTRQKAAIKTEKKDLKKQHHCSHTCMFS* |
| Ga0062593_1018014541 | 3300004114 | Soil | MKRLIFVLVLLACIAVVAYASLRGNKQKAAIKTEKKDIKKKHECSHTCPYS* |
| Ga0062593_1020516201 | 3300004114 | Soil | MKRLIIVLVLLACIAAVAYASLRSNKQKAAIKTEKKEFKKKHECS |
| Ga0063356_1001018874 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKRLIIVLVLLACIAAVAYASLRSNKQKAAIKTEKKDIKKKHECSHTCAYS* |
| Ga0062595_1005823792 | 3300004479 | Soil | MKRLIIVLVLLACIAAMAYASLRSNKQKAAIKTEKKELKKKHECSHTCAYS* |
| Ga0062592_1014526252 | 3300004480 | Soil | MKRLIFVLVLLACIAAVAYASLRSNKQKAAIKTEKKDIKKKHDCSHTCPY |
| Ga0066809_100366042 | 3300005168 | Soil | LLACIAAVAYASLRSNKQKAAIKTEKKELKKKHECSHTCAYS* |
| Ga0070676_100063316 | 3300005328 | Miscanthus Rhizosphere | MKRLIIVLVLLACIAAVAYASLRSNKQKAAIKTEKKEIKKKHECSHTCAYS* |
| Ga0070676_101910582 | 3300005328 | Miscanthus Rhizosphere | MKRLIIVLVLLACIAAVAYASLRSTRQKAAIKTEKKEIKKKQECSHTCAYS* |
| Ga0070683_1000142053 | 3300005329 | Corn Rhizosphere | MKRLIIVLVLLACIAAVTYASLHTNKQRAGIKTEKKEIKKKHECSRTCAYS* |
| Ga0070690_1000103233 | 3300005330 | Switchgrass Rhizosphere | MKRLIIVLVLLACIAAVAYASLRSNKQKAAIKTEKKELKKKHECSHTCAYS* |
| Ga0066388_1014664383 | 3300005332 | Tropical Forest Soil | MKRLVFVLVLLACIAAVAYASLRSNKQKPAIKTEKKEIKKKHDCSHSCMYS* |
| Ga0070666_111657632 | 3300005335 | Switchgrass Rhizosphere | LVLLACIAAVAYASLRSNKQKAAIKTEKKEIKKKHECSHTCAYS* |
| Ga0070661_1000556152 | 3300005344 | Corn Rhizosphere | MKRLIFVLVLLSCIAAVAYASLRGNKQKAAIKTEKKDIKKKHECSHTCPYS* |
| Ga0070661_1001178411 | 3300005344 | Corn Rhizosphere | TKFTAMKRLIIVLVLLACIAAMAYASLRSNKQKAAIKTEKKELKKKHECSHTCAYS* |
| Ga0070668_1013894381 | 3300005347 | Switchgrass Rhizosphere | TKFTAMKRLIIVLVLLACIAAVAYASLRSTRQKAAIKTEKKEIKKKQECSHTCAYS* |
| Ga0070675_1000457511 | 3300005354 | Miscanthus Rhizosphere | MKRLIIVLVLLACIAAVTYASLHTNKQRAGIKTEKKEIKKKHEC |
| Ga0070675_1002068001 | 3300005354 | Miscanthus Rhizosphere | MKRLIIVLVLLACIAAVAYASLRTNKQRADIKTEKKELKKKHECSRTCAYS* |
| Ga0070671_1002438702 | 3300005355 | Switchgrass Rhizosphere | MKRLIIVLVLLACIAAVAYASLRTNKQKAAIKTEKKEIKKKHECSHTCAYS* |
| Ga0070671_1002771422 | 3300005355 | Switchgrass Rhizosphere | IVLVLLACIAAVAYASLRSTRQKAAIKTEKKEIKKKQECSHTCAYS* |
| Ga0070688_1000397171 | 3300005365 | Switchgrass Rhizosphere | TKFTAMKRLIIVLVLLACIAAVAYASLRTNKQKAGIKTEKKEIKKKHECSRTCAYS* |
| Ga0070688_1016788511 | 3300005365 | Switchgrass Rhizosphere | MKRLIIVLVLLACIAAVAYASLRSNKQKAAIKTEKKEIKKKHECSR |
| Ga0070701_106970862 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRLIIVLVLLACIAAVAYASLRTNKQKAGIKTEKKEIKKKHECSHTCAYS* |
| Ga0070700_1003393192 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRLIIVLVLLACIAAVAYASLRTNKQKAGIKTEKKEIKKKHECSRTCAYS* |
| Ga0066686_105230262 | 3300005446 | Soil | MKRIVFVLILLACIAAVAYASLRTNKQKPAIKTEKKEINKKHECSHTCMFS* |
| Ga0070678_1012963911 | 3300005456 | Miscanthus Rhizosphere | MKRLIIVLVLLACIAAVAYASLRNNKQKAAIKTEKKELKKKHECSHT |
| Ga0068853_1006043322 | 3300005539 | Corn Rhizosphere | MKRLIIVLVLLACIAVVAFASLRTNKQRAGIKTEKKEIKKKHECSRTCAYS* |
| Ga0070693_1003731092 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRLIIVLVLLACIAAMAYASLRSNKQKAAIKTEKKDIKKKHECSHTCPYS* |
| Ga0070693_1010225282 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRLVIVLVLLACIAAVAYASLRSNKQKPAIKTEKKEIKKKHECSHTCAYS* |
| Ga0066699_108433292 | 3300005561 | Soil | MKRLVFVLILLACIAAVAYASLRTTKQRPANKTEKKEIKKKHECSHTCMYS* |
| Ga0066694_101099682 | 3300005574 | Soil | MKRIVFVLILLACIAAVAYASLRTNKQKPAIKTEKKEIKKKHECSHTCMFS* |
| Ga0068854_1019108471 | 3300005578 | Corn Rhizosphere | RLVIVLVLLACIAAVAYASLRSNKQKAAIKTEKKEIKKKHECSHTCAYS* |
| Ga0068852_1001211154 | 3300005616 | Corn Rhizosphere | MKRLIIVLVLLACIAAVAYASLRSNKQKSAIKTEKKELKKKHECSHTCAYS* |
| Ga0068870_101338011 | 3300005840 | Miscanthus Rhizosphere | CIAAVAYASLRSNKQKAAIKTEKKELKKKHECSHTCAYS* |
| Ga0068858_1002893052 | 3300005842 | Switchgrass Rhizosphere | AVAYASLRSTRQKAAIKTEKKEIKKKQECSHTCAYS* |
| Ga0068858_1007483292 | 3300005842 | Switchgrass Rhizosphere | MKRLIIVLVLLACIAAVAYASLRSNKQKAAIKTEKKEIKKKH |
| Ga0075277_10194051 | 3300005895 | Rice Paddy Soil | MKRLIIVLVLLACVVAVAYASLRTTKQKAANKTEKKAIKKHHHCSHTCLFS* |
| Ga0079220_115798262 | 3300006806 | Agricultural Soil | MKGLVIVLVLLACIAAVAYASLRANKQKAAIKTEKKEIKKKHECSH |
| Ga0079219_124327101 | 3300006954 | Agricultural Soil | MKRLIMVLVLLACIAAVAFASLRGNKQKPAIKTEKKEIKE |
| Ga0105245_119536912 | 3300009098 | Miscanthus Rhizosphere | CNFSTQNFTAMKRLIIVLVLLACIAAMAYASLRSNKQKAAIKTEKKELKKKHECSHTCAYS* |
| Ga0105247_104590902 | 3300009101 | Switchgrass Rhizosphere | MKRLVVVFVLLVCIAAVAFASLRTNKHKAATKTEKKEIKK |
| Ga0105247_107862332 | 3300009101 | Switchgrass Rhizosphere | MKRLIIVLVLLACIAAVTYASLHTNKQRAGIKTEKKEIKKKHECSR |
| Ga0126380_122250622 | 3300010043 | Tropical Forest Soil | MKRLVFVLVLLACIAAVAYASLRSNKQKPGIKTEKKEIKKK |
| Ga0126373_104590892 | 3300010048 | Tropical Forest Soil | MSTKFTAMKQFIVILVLLACVVAVAYASLRSIKQKAAVKSEKKEVKKHHQCSHTCMFS* |
| Ga0126370_106054482 | 3300010358 | Tropical Forest Soil | MSIKFTAMKRFIVILVLLACVVAVTYASLRSIKQKAAVKSEKKETKKHHQCSHACMFS* |
| Ga0126376_124080582 | 3300010359 | Tropical Forest Soil | IGTNFTAMKRLIVILLLLACVVAVAYASLRTTRQKAAIKTEKKDLKKQHHCSHSCMFS* |
| Ga0126372_115508622 | 3300010360 | Tropical Forest Soil | MKRLVIVLVLLACIAAVAYASLRSNKQKPAIKTEKK |
| Ga0126383_127123262 | 3300010398 | Tropical Forest Soil | LIGTKFTAMKRLIVILLLLACVAAVAYASLRTTKQKAAIKTEKKDMKKQHHCSHTCMYS* |
| Ga0105246_101140471 | 3300011119 | Miscanthus Rhizosphere | LLACIAAVAYASLRTNKQRAGIKTEKKELKKKHECSRTCAYS* |
| Ga0105246_107721931 | 3300011119 | Miscanthus Rhizosphere | MKRLIIVLVLLACIAAVAYASLRTNKQKAGIKTEKKEIKKKHECSRTC |
| Ga0137381_111945971 | 3300012207 | Vadose Zone Soil | KIICRKSLNLYLIDIKFTAMKRFIVILILLACVAAVAYASLRTTKQKAAIKTEKKEIKKKHHCSHTCFFS* |
| Ga0137387_105506371 | 3300012349 | Vadose Zone Soil | MKRFIVVLILLACVAAVAYASLRTTKQKAAIKTEKKEIKKKHHCSHTCLFS* |
| Ga0157308_102970721 | 3300012910 | Soil | MKRLIIVLVLLACIAAVAYASLRSTKQKAAIKTEKKEIRKKHECSHTCAYS* |
| Ga0164303_102993472 | 3300012957 | Soil | MKRLIIVLVLLACIAAVAYESLRSNKQKAAIKTEKKELKKKHECSHTCAYS* |
| Ga0164302_105668421 | 3300012961 | Soil | MKRLIIVLVLIACIAAVAYASLRTNKQKAAIKTEKKEIKKKHEC |
| Ga0126369_105566102 | 3300012971 | Tropical Forest Soil | MKRLVFVLVLLACIAAVAYASLRSNKQKPAIKTEKKEIKKKHECSHTCMFSA* |
| Ga0164308_117640172 | 3300012985 | Soil | AMKRLIIVLVLLACIAAVAYASLRSNKQKAAIKTEKKELKKKHECSHTCAYS* |
| Ga0164304_111428302 | 3300012986 | Soil | MKRLIIVLVLLACIAAVAYASLRSNKQKAAIKTEKKEIKKKHECSHT |
| Ga0164307_102255342 | 3300012987 | Soil | LLACIAAVAYASLRSNKQKAAVKTEKKELKKKHACSHTCAYS* |
| Ga0157371_111790341 | 3300013102 | Corn Rhizosphere | VVAYASLRGNKQKAAIKTEKKDIKKKHECSHTCPYS* |
| Ga0157372_127051901 | 3300013307 | Corn Rhizosphere | MKRLIFVLVLLACIAVVAYASLRGNKQKAAIKTEKKD |
| Ga0157372_129314671 | 3300013307 | Corn Rhizosphere | MKRLIIVLVLLACIAAMAYASLRSNKQKAAIKTEKKE |
| Ga0157376_106160862 | 3300014969 | Miscanthus Rhizosphere | MKRLIIVLVLLACIAVVAFASLRTSKQRAGIKTEKKEIKKKHECSHTCAYS* |
| Ga0132258_102894154 | 3300015371 | Arabidopsis Rhizosphere | MKRFIIVLVLLACIAAVAYASLRSNKQKAAIKTEKKEIKKKHECSHTCAYS* |
| Ga0132256_1004291971 | 3300015372 | Arabidopsis Rhizosphere | MKKLIIVLVLLACIAAVAYASLRTNKQKAGIKTEKKEIKKKH |
| Ga0132256_1021705082 | 3300015372 | Arabidopsis Rhizosphere | MKRLIIVLVLLACIAAVAYASLRTNKQRAGIKTEKKEIKKKHECSRTCAYS* |
| Ga0132255_1000906953 | 3300015374 | Arabidopsis Rhizosphere | MKRLIFVLVLLACIAAVAYASLRSNKQKAAIKTEKKEMKKKHECSHTCPYS* |
| Ga0132255_1026888072 | 3300015374 | Arabidopsis Rhizosphere | MKRLIIVLVLLACIAAVAYASLRTNKQKAGIKTEKKEIKKKRECSHTCAYS* |
| Ga0134069_13691502 | 3300017654 | Grasslands Soil | MKRLIIVLVLLACIAAVAYASLRTTKQKAAIKTEKKEIKKKHECSH |
| Ga0163161_120315141 | 3300017792 | Switchgrass Rhizosphere | MKRLIIVLVLLACIAAVAYASLRTNKQKAGIKTEKKEIKKKHECSRTCAYS |
| Ga0187824_101470621 | 3300017927 | Freshwater Sediment | MKRFIVVLILLACVAAVAYASLRTTKQKAAIKTEKKELKKHHCSHSCSMFS |
| Ga0187785_106539601 | 3300017947 | Tropical Peatland | MKRLIVILLLLACVVAVAYASLRTTRQKAAIKTEKKD |
| Ga0187788_100185613 | 3300018032 | Tropical Peatland | MKRLIVILLLLACVAAVTYASLRTTKQKAVIKTEKKQMKQHHCSHTCMFS |
| Ga0066669_107231441 | 3300018482 | Grasslands Soil | MKRFIVVLILLACVAAVAYASLRTTKQKAAIKTEKKEIKKKHHCSHTCLFS |
| Ga0193751_10811371 | 3300019888 | Soil | MDIKFTAMKRFIVVLILLACVAVVAYASLRTTKQKAAIKTEKKEMKKHHCSHTCMFS |
| Ga0193726_10017118 | 3300020021 | Soil | MKRFIIVLLLLACVAAVTYASLRTTKQKAATKTGNKEMKHHRCSHSCMST |
| Ga0126371_136594511 | 3300021560 | Tropical Forest Soil | SIKFTAMKRFIVILVLLACVVAVAYASLRSIKQKAAVKSEKKEVKKHHQCSHTCMFS |
| Ga0193698_10552981 | 3300021968 | Soil | AMKKITLLVILLACIAAVAFASLRSSKHKAAIKTDKKEIKKKHHCSFTCPFS |
| Ga0207697_100240382 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRLIIVLVLLACIAAVTYASLHTNKQRAGIKTEKKEIKKKHECSRTCAYS |
| Ga0207682_101685532 | 3300025893 | Miscanthus Rhizosphere | MKRLIIVLVLLACIAAVAYASLRSTRQKAAIKTEKKEIKKKQECSHTCAYS |
| Ga0207642_105962542 | 3300025899 | Miscanthus Rhizosphere | MKRLIIVLVLLACIAAVAYASLRSNKQKAAIKTEKKELKKKHECSHTCAYS |
| Ga0207680_100994291 | 3300025903 | Switchgrass Rhizosphere | MKRLIIVLVLLACIAAMAYASLRSNKQKAAIKTEKKELKKKHECSHTCA |
| Ga0207680_109764901 | 3300025903 | Switchgrass Rhizosphere | MKRLIIVLVLLACIAAVAYASLRSNKQKAAIKTEKKEIKKKHECSHTCAYS |
| Ga0207681_101307702 | 3300025923 | Switchgrass Rhizosphere | MKRLIIVLVLLACIAAMAYASLRSNKQKAAIKTEKKEIKKKHECSRTCAYS |
| Ga0207650_102933893 | 3300025925 | Switchgrass Rhizosphere | MKRLIIVLVLLACIAAMAYASLRSNKQKAAIKTEKKELKKKHECSHTCAYS |
| Ga0207644_101750664 | 3300025931 | Switchgrass Rhizosphere | MKRLIIVLVLLACIAAVAYASLRSNKQKAAIKTEKKELKK |
| Ga0207690_100179006 | 3300025932 | Corn Rhizosphere | MKRLIFVLVLLACIAVVAYASLRGNKQKAAIKTEKKDIKKKHECSHTCPYS |
| Ga0207706_100063847 | 3300025933 | Corn Rhizosphere | MKRLIIVLVLLACIAAVAYASLRSNKQKASIKTEKKELKKKHECSHTCAYS |
| Ga0207670_106175242 | 3300025936 | Switchgrass Rhizosphere | MKRLIIVLVLLACIAAMAYASLRSNKQKAAIKTEKKEIKKKHECSHTCAYS |
| Ga0207711_104399732 | 3300025941 | Switchgrass Rhizosphere | IVLVLLACIAAVAYASLRSNKQKAAIKTEKKEIKKKHECSHTCAYS |
| Ga0207661_106766162 | 3300025944 | Corn Rhizosphere | KFTAMKRLIIVLVLLACIAAVAYASLRSNKQKAAIKTEKKEIKKKHECSHTCAYS |
| Ga0207679_100796973 | 3300025945 | Corn Rhizosphere | MKRLIIVLVLLACIAAVAYASLRSNKQKSAIKTEKKELKKKHECSHTCAYS |
| Ga0207679_106195751 | 3300025945 | Corn Rhizosphere | MKRLIIVLVLLACIAAVAYASLRSNKQKAAIKTEKKEIKKKHECSRT |
| Ga0207679_113177412 | 3300025945 | Corn Rhizosphere | MKRLIFVLVLLACIAAVAYASLRSNKQKAAIKTEKKDIKKKHDCSHTCPYS |
| Ga0207640_111982621 | 3300025981 | Corn Rhizosphere | RCAKICNFSTQNFTAMKRLIIVLVLLACIAAVAYASLRSTRQKAAIKTEKKEIKKKQECSHTCAYS |
| Ga0207703_120731261 | 3300026035 | Switchgrass Rhizosphere | TKFAAMKRLIIVLVLLACIAAVAYASLRTNKQKAGIKTEKKEIKKKHECSRTCAYS |
| Ga0207639_112052572 | 3300026041 | Corn Rhizosphere | MKRLIIVLVLLACIAVVAFASLRTNKQRAGIKTEKKEIKKKHECSRTCAYS |
| Ga0207674_115727231 | 3300026116 | Corn Rhizosphere | MKRLIIVLVLLACIAAVAYASLRTNKQRAGIKTEKKELKKKHECSRTCAYS |
| Ga0207683_103653102 | 3300026121 | Miscanthus Rhizosphere | IAAVAYASLRSNKQKAAIKTEKKELKKKHECSHTCAYS |
| Ga0207698_103163843 | 3300026142 | Corn Rhizosphere | LIIVLVLLACIAAVAYASLRSNKQKSAIKTEKKELKKKHECSHTCAYS |
| Ga0170824_1007849392 | 3300031231 | Forest Soil | MKRLIIVLVLLACIAAVAYASLRSTKQKAAIKTEKKEIKKKHECSHMCAYS |
| Ga0310813_100235705 | 3300031716 | Soil | MKRLIIVLVLLACIAAVAYASLRSTKQKAAIKTEKKEIRKKHECSHTCAYS |
| Ga0310813_103739272 | 3300031716 | Soil | MKRLIFVLVLLACIAAVAYASLRGNKQKAAIKTEKKDIKKKHECSHTCPYS |
| Ga0310813_113729931 | 3300031716 | Soil | MKRLIIVLVLLACIAAVAYASLRSTRQKAAIKTEKKEIKKK |
| Ga0307468_1013341062 | 3300031740 | Hardwood Forest Soil | MKRLIIVFVLLACIAVVAYASLRSNKQKAAIKTEKKEI |
| Ga0307468_1025085822 | 3300031740 | Hardwood Forest Soil | NTKFTAMKRLIIVFVLLACIAAVAYASLRSNKQKAAIKTEKKEIKKKHECSHTCAYS |
| Ga0335085_102321362 | 3300032770 | Soil | MKRLIVVLLLLACVAAVAYASLRATKQKAAIKTEKKQMKEHHCSQTCMFS |
| Ga0335084_119044402 | 3300033004 | Soil | MKRLIVILLLLACVVAVAYASLRTTKQKAAIKTEKKDLKKQHHCSHTCMFS |
| Ga0310810_100456381 | 3300033412 | Soil | MKRLIIVLVLLACIAAVTYASLHTNKQRAGIKTEKKEIKKET |
| Ga0310810_107370192 | 3300033412 | Soil | LLACVAAVAFASLRTNKQKAPIKTEKKEIKKKQCTHTCMYS |
| Ga0310810_113867161 | 3300033412 | Soil | MKRLIIVLVLLACIAAVAYASLRTNKQRAGIKTEKKEIKKKHECSRTCAYS |
| Ga0310811_100511312 | 3300033475 | Soil | MKRLIIVLVLLACIAAVAYASLRTNKQRADIKTEKKELKKKHECSRTCAYS |
| ⦗Top⦘ |