| Basic Information | |
|---|---|
| Family ID | F082287 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 38 residues |
| Representative Sequence | QVRFAGASATVPMLAEPTSTQREAFDLIGVPIPLTLK |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.82 % |
| % of genes near scaffold ends (potentially truncated) | 87.61 % |
| % of genes from short scaffolds (< 2000 bps) | 91.15 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.292 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.699 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.124 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.788 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.77% β-sheet: 9.23% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00196 | GerE | 2.65 |
| PF04655 | APH_6_hur | 2.65 |
| PF00106 | adh_short | 2.65 |
| PF13561 | adh_short_C2 | 1.77 |
| PF13020 | NOV_C | 1.77 |
| PF00589 | Phage_integrase | 1.77 |
| PF00239 | Resolvase | 1.77 |
| PF00348 | polyprenyl_synt | 1.77 |
| PF04672 | Methyltransf_19 | 0.88 |
| PF06527 | TniQ | 0.88 |
| PF05726 | Pirin_C | 0.88 |
| PF13006 | Nterm_IS4 | 0.88 |
| PF00266 | Aminotran_5 | 0.88 |
| PF08388 | GIIM | 0.88 |
| PF00392 | GntR | 0.88 |
| PF02371 | Transposase_20 | 0.88 |
| PF01609 | DDE_Tnp_1 | 0.88 |
| PF00941 | FAD_binding_5 | 0.88 |
| PF13814 | Replic_Relax | 0.88 |
| PF11774 | Lsr2 | 0.88 |
| PF11139 | SfLAP | 0.88 |
| PF08352 | oligo_HPY | 0.88 |
| PF02518 | HATPase_c | 0.88 |
| PF07730 | HisKA_3 | 0.88 |
| PF02899 | Phage_int_SAM_1 | 0.88 |
| PF00723 | Glyco_hydro_15 | 0.88 |
| PF01179 | Cu_amine_oxid | 0.88 |
| PF00078 | RVT_1 | 0.88 |
| PF00501 | AMP-binding | 0.88 |
| PF13091 | PLDc_2 | 0.88 |
| PF00149 | Metallophos | 0.88 |
| PF01037 | AsnC_trans_reg | 0.88 |
| PF02852 | Pyr_redox_dim | 0.88 |
| PF13359 | DDE_Tnp_4 | 0.88 |
| PF01106 | NifU | 0.88 |
| PF00795 | CN_hydrolase | 0.88 |
| PF00583 | Acetyltransf_1 | 0.88 |
| PF01184 | Gpr1_Fun34_YaaH | 0.88 |
| PF01670 | Glyco_hydro_12 | 0.88 |
| PF00400 | WD40 | 0.88 |
| PF02775 | TPP_enzyme_C | 0.88 |
| PF01042 | Ribonuc_L-PSP | 0.88 |
| PF05721 | PhyH | 0.88 |
| PF01546 | Peptidase_M20 | 0.88 |
| PF05610 | DUF779 | 0.88 |
| PF01472 | PUA | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG3570 | Streptomycin 6-kinase | Defense mechanisms [V] | 2.65 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.77 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.77 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 1.77 |
| COG3564 | Uncharacterized conserved protein, DUF779 family | Function unknown [S] | 0.88 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.88 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.88 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.88 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.88 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.88 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.88 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.88 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.88 |
| COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.88 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.88 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.88 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.88 |
| COG1584 | Succinate-acetate transporter SatP | Energy production and conversion [C] | 0.88 |
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.18 % |
| Unclassified | root | N/A | 39.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02FPU74 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300001867|JGI12627J18819_10340355 | Not Available | 606 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10084601 | Not Available | 1249 | Open in IMG/M |
| 3300004080|Ga0062385_10930643 | Not Available | 579 | Open in IMG/M |
| 3300004152|Ga0062386_101156071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
| 3300005172|Ga0066683_10696306 | Not Available | 603 | Open in IMG/M |
| 3300005186|Ga0066676_10214808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1242 | Open in IMG/M |
| 3300005764|Ga0066903_108126733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
| 3300006028|Ga0070717_10012187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6555 | Open in IMG/M |
| 3300006050|Ga0075028_100960185 | Not Available | 530 | Open in IMG/M |
| 3300006852|Ga0075433_10872818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 785 | Open in IMG/M |
| 3300007788|Ga0099795_10050076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1518 | Open in IMG/M |
| 3300009090|Ga0099827_11276029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
| 3300009101|Ga0105247_10219274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1287 | Open in IMG/M |
| 3300009524|Ga0116225_1007778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6081 | Open in IMG/M |
| 3300009525|Ga0116220_10255775 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300009525|Ga0116220_10565127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300009545|Ga0105237_11956295 | Not Available | 595 | Open in IMG/M |
| 3300009700|Ga0116217_10283526 | Not Available | 1068 | Open in IMG/M |
| 3300009824|Ga0116219_10419383 | Not Available | 745 | Open in IMG/M |
| 3300010046|Ga0126384_12445135 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300010047|Ga0126382_12350237 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010320|Ga0134109_10136531 | Not Available | 875 | Open in IMG/M |
| 3300010320|Ga0134109_10237730 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR_3 bacterium SM23_42 | 683 | Open in IMG/M |
| 3300010337|Ga0134062_10803489 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300010360|Ga0126372_11469425 | Not Available | 716 | Open in IMG/M |
| 3300010361|Ga0126378_10125668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2577 | Open in IMG/M |
| 3300010361|Ga0126378_10797658 | Not Available | 1054 | Open in IMG/M |
| 3300010373|Ga0134128_11876648 | Not Available | 659 | Open in IMG/M |
| 3300010376|Ga0126381_104522147 | Not Available | 537 | Open in IMG/M |
| 3300010379|Ga0136449_102976388 | Not Available | 662 | Open in IMG/M |
| 3300010396|Ga0134126_10838567 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300010400|Ga0134122_12204367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
| 3300010876|Ga0126361_10787967 | Not Available | 557 | Open in IMG/M |
| 3300010880|Ga0126350_11942228 | Not Available | 769 | Open in IMG/M |
| 3300012206|Ga0137380_10856747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 782 | Open in IMG/M |
| 3300012206|Ga0137380_11491465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 561 | Open in IMG/M |
| 3300012210|Ga0137378_11158208 | Not Available | 689 | Open in IMG/M |
| 3300012211|Ga0137377_10288033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea fuscirosea | 1576 | Open in IMG/M |
| 3300012349|Ga0137387_11192385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces kanamyceticus | 538 | Open in IMG/M |
| 3300012360|Ga0137375_11335392 | Not Available | 539 | Open in IMG/M |
| 3300012362|Ga0137361_11666802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300012363|Ga0137390_11835062 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012532|Ga0137373_10756555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
| 3300012948|Ga0126375_10986265 | Not Available | 685 | Open in IMG/M |
| 3300013102|Ga0157371_10811166 | Not Available | 706 | Open in IMG/M |
| 3300015265|Ga0182005_1279736 | Not Available | 523 | Open in IMG/M |
| 3300016294|Ga0182041_10088177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2241 | Open in IMG/M |
| 3300016319|Ga0182033_10125157 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300016387|Ga0182040_11743328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 532 | Open in IMG/M |
| 3300016404|Ga0182037_10288686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1314 | Open in IMG/M |
| 3300016422|Ga0182039_10387669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1183 | Open in IMG/M |
| 3300016445|Ga0182038_10182906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. AX2bis | 1633 | Open in IMG/M |
| 3300017821|Ga0187812_1032059 | All Organisms → cellular organisms → Bacteria | 1796 | Open in IMG/M |
| 3300017821|Ga0187812_1277434 | Not Available | 534 | Open in IMG/M |
| 3300017942|Ga0187808_10342681 | Not Available | 677 | Open in IMG/M |
| 3300018017|Ga0187872_10269699 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300021180|Ga0210396_10955285 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR_3 bacterium SM23_42 | 728 | Open in IMG/M |
| 3300021181|Ga0210388_10100588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2475 | Open in IMG/M |
| 3300021405|Ga0210387_11717243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 531 | Open in IMG/M |
| 3300021861|Ga0213853_11311231 | Not Available | 589 | Open in IMG/M |
| 3300025320|Ga0209171_10215778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1072 | Open in IMG/M |
| 3300025634|Ga0208589_1081097 | Not Available | 778 | Open in IMG/M |
| 3300025900|Ga0207710_10129990 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 1209 | Open in IMG/M |
| 3300025914|Ga0207671_11315123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia sputi | 563 | Open in IMG/M |
| 3300025929|Ga0207664_11950199 | Not Available | 510 | Open in IMG/M |
| 3300025934|Ga0207686_11273226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 603 | Open in IMG/M |
| 3300026277|Ga0209350_1062714 | Not Available | 1058 | Open in IMG/M |
| 3300027166|Ga0208729_113668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300027625|Ga0208044_1216111 | Not Available | 507 | Open in IMG/M |
| 3300027767|Ga0209655_10065409 | Not Available | 1210 | Open in IMG/M |
| 3300027767|Ga0209655_10175988 | Not Available | 706 | Open in IMG/M |
| 3300027884|Ga0209275_10056391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1906 | Open in IMG/M |
| 3300027889|Ga0209380_10828024 | Not Available | 523 | Open in IMG/M |
| 3300027910|Ga0209583_10122514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1030 | Open in IMG/M |
| 3300028715|Ga0307313_10218996 | Not Available | 591 | Open in IMG/M |
| 3300028717|Ga0307298_10257339 | Not Available | 519 | Open in IMG/M |
| 3300028782|Ga0307306_10011601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1894 | Open in IMG/M |
| 3300029943|Ga0311340_10381309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1303 | Open in IMG/M |
| 3300029988|Ga0302190_10216188 | Not Available | 781 | Open in IMG/M |
| 3300030707|Ga0310038_10457636 | Not Available | 545 | Open in IMG/M |
| 3300031525|Ga0302326_10687928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1498 | Open in IMG/M |
| 3300031543|Ga0318516_10480070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 714 | Open in IMG/M |
| 3300031549|Ga0318571_10150049 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300031564|Ga0318573_10061068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1863 | Open in IMG/M |
| 3300031572|Ga0318515_10160974 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300031682|Ga0318560_10056213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1952 | Open in IMG/M |
| 3300031708|Ga0310686_107618477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia → Kineosporia corallincola | 828 | Open in IMG/M |
| 3300031713|Ga0318496_10016944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3550 | Open in IMG/M |
| 3300031713|Ga0318496_10059510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 1241 | 1994 | Open in IMG/M |
| 3300031748|Ga0318492_10059032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1811 | Open in IMG/M |
| 3300031770|Ga0318521_10043773 | All Organisms → cellular organisms → Bacteria | 2276 | Open in IMG/M |
| 3300031771|Ga0318546_10482440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 869 | Open in IMG/M |
| 3300031788|Ga0302319_10622796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1116 | Open in IMG/M |
| 3300031792|Ga0318529_10265207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 799 | Open in IMG/M |
| 3300031796|Ga0318576_10411498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 639 | Open in IMG/M |
| 3300031798|Ga0318523_10656295 | Not Available | 515 | Open in IMG/M |
| 3300031859|Ga0318527_10068168 | Not Available | 1422 | Open in IMG/M |
| 3300032009|Ga0318563_10528165 | Not Available | 637 | Open in IMG/M |
| 3300032010|Ga0318569_10110149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1250 | Open in IMG/M |
| 3300032076|Ga0306924_10269017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Salinispora → Salinispora pacifica | 1957 | Open in IMG/M |
| 3300032160|Ga0311301_10354058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2293 | Open in IMG/M |
| 3300032180|Ga0307471_101796375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Microlunatus → Microlunatus flavus | 765 | Open in IMG/M |
| 3300032205|Ga0307472_102566248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300032261|Ga0306920_101947324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 825 | Open in IMG/M |
| 3300032828|Ga0335080_11152756 | Not Available | 781 | Open in IMG/M |
| 3300032829|Ga0335070_10464273 | Not Available | 1203 | Open in IMG/M |
| 3300032892|Ga0335081_10481784 | Not Available | 1567 | Open in IMG/M |
| 3300032895|Ga0335074_10626156 | Not Available | 1064 | Open in IMG/M |
| 3300032895|Ga0335074_11499774 | Not Available | 536 | Open in IMG/M |
| 3300032897|Ga0335071_10110460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2695 | Open in IMG/M |
| 3300032898|Ga0335072_10759505 | Not Available | 936 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.73% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.19% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.65% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.77% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.77% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.77% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.77% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.89% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.89% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027166 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF033 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029988 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPINP_03814020 | 2065487018 | Soil | RYTGTQVTIAMLAEPTSAQRQAFELIGAPIPLTLK |
| JGI12627J18819_103403552 | 3300001867 | Forest Soil | LTCDQVRLAGTRATEPVLSEPTSTQREAFDLIGILIRSP* |
| JGIcombinedJ51221_100846011 | 3300003505 | Forest Soil | LTRKQVPFAGTRATVPVLAEPTSAQREAFDLIGVPIPLTVR* |
| Ga0062385_109306432 | 3300004080 | Bog Forest Soil | TRNQVRFAGTRATVPVLAEPTSAQREAFDLIGVPIPVTLR* |
| Ga0062386_1011560711 | 3300004152 | Bog Forest Soil | RNQVRYTGTQVTIPMLTEPTSTQREAFSLLGAAIPLTLT* |
| Ga0066683_106963061 | 3300005172 | Soil | TRNQIRYAGTQVTIPVLAEPTSAQREAFRLIGVPIPLILK* |
| Ga0066676_102148083 | 3300005186 | Soil | RNQVRFTGTAVTTPMLTEPTSAQREAFDLIGAPIPLTLK* |
| Ga0066903_1081267332 | 3300005764 | Tropical Forest Soil | FAGARAAVPMLAEPTSTQREAFDLIGAPIPLTLK* |
| Ga0070717_100121871 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FAGATADVPMLTEPTSAQREAFDLIGVPIPLTLK* |
| Ga0075028_1009601852 | 3300006050 | Watersheds | TRNQVRYTGTQVTIAMLAEPTSAQRHAFELLGTPIPLTSK* |
| Ga0075433_108728182 | 3300006852 | Populus Rhizosphere | YTGTQVTIAMLAEPTSAQQQAFKLIGAPIPLTLK* |
| Ga0099795_100500761 | 3300007788 | Vadose Zone Soil | QVRFAGATDTVPMPAEPTTTQRRAFDLIGVAIPLTLK* |
| Ga0099827_112760291 | 3300009090 | Vadose Zone Soil | NQVRFTGTTATVPMLTEPTSTQRQAFHLIGVPIPLTLK* |
| Ga0105247_102192741 | 3300009101 | Switchgrass Rhizosphere | LTRNQVRFAGATATVPMLAEPTADQRQAFDLIGVPVPLTLK* |
| Ga0116225_10077781 | 3300009524 | Peatlands Soil | QVRFAGTRATVPVLAEPTSTQREAFDLIGVPIPVTLR* |
| Ga0116220_102557751 | 3300009525 | Peatlands Soil | NQVRYTGTQVTIPMLTEPTSAQREAFSLLGTPIPLTLT* |
| Ga0116220_105651273 | 3300009525 | Peatlands Soil | RFAGTRATVPVLAEPTSTQRKAFDLIGAPIPVTLR* |
| Ga0105237_119562951 | 3300009545 | Corn Rhizosphere | TRNQVRLAGAQATVPMLAEPTSTQREAFDLISVPIPLALK* |
| Ga0116217_102835261 | 3300009700 | Peatlands Soil | QVRFTGTQVTIPMLTEPTSAQREAFTLLGTTIPLTLT* |
| Ga0116219_104193832 | 3300009824 | Peatlands Soil | VRYTGTQVTIPMLTEPTSTQREAFTLLGTAIPLNLT* |
| Ga0126384_124451351 | 3300010046 | Tropical Forest Soil | QVRFTGATATVPMLTEPTSAQREAFDLIGVPIPLILK* |
| Ga0126382_123502372 | 3300010047 | Tropical Forest Soil | FTATNVTVPMLTEPTSAQREAFTLIGAPIPLTLT* |
| Ga0134109_101365311 | 3300010320 | Grasslands Soil | LTRNQVRYTGTQVTIAMLTEPTSIQRQAFQLLGAAIPLTSK* |
| Ga0134109_102377301 | 3300010320 | Grasslands Soil | VRFAGATTTVPMLAEPTSAQHEAFDLIGAPIPLTLK* |
| Ga0134062_108034891 | 3300010337 | Grasslands Soil | LIDQIRYAGTQVTIPVLAEPTSAQREAFRLIGVQIPLMLK* |
| Ga0126372_114694251 | 3300010360 | Tropical Forest Soil | NDVRFAGTTATVPMLAEPTSAQREAFDLIGAPIPLTLK* |
| Ga0126378_101256684 | 3300010361 | Tropical Forest Soil | FAGTTATVPMLTEPTSEQREAFQLIGAPIPLTLK* |
| Ga0126378_107976582 | 3300010361 | Tropical Forest Soil | VKFAGVKDTVPMLAEPTGIQRRAFDLIGVPIPPP* |
| Ga0134128_118766482 | 3300010373 | Terrestrial Soil | QVRFAGPQATVPMLAEPTSTQREAFDLISVPIPLTLK* |
| Ga0126381_1045221471 | 3300010376 | Tropical Forest Soil | GGTGTEIPVLAEPTSEQRQAFDLIGAPIPLTLKT* |
| Ga0136449_1029763882 | 3300010379 | Peatlands Soil | NQVRYTGGPVTIPMLTEPTSIQREAFTLLGTAIPLTLK* |
| Ga0134126_108385671 | 3300010396 | Terrestrial Soil | QVRYTGTQVTIAMLAEPTSAQRQAFELIGAPIPLTLK* |
| Ga0134122_122043672 | 3300010400 | Terrestrial Soil | LTRNQVRFTGTQVTTAMLTEPTSAQRQAFHLLGAAIPLTLK* |
| Ga0126361_107879672 | 3300010876 | Boreal Forest Soil | VRYTGTDVTIAMLAEPTSTQRQAFELIGAPIPLTLK* |
| Ga0126350_119422282 | 3300010880 | Boreal Forest Soil | LTRNQVRFTGTRATMPMVAEPTSAQREAFRLIGVRSR* |
| Ga0137380_108567471 | 3300012206 | Vadose Zone Soil | RFADAAATIPMLAEPTPAQRQAFDLIGVPIPLTMK* |
| Ga0137380_114914652 | 3300012206 | Vadose Zone Soil | NQVRFGATGTEIPVLAEPTSAQRQAFDLIGAAIPLALT* |
| Ga0137378_111582081 | 3300012210 | Vadose Zone Soil | VRFAGTQATVPMLTEPTSIQRDAFDLIGVPAPLTLK* |
| Ga0137377_102880331 | 3300012211 | Vadose Zone Soil | NQVRFAGTRATMPMLAEPTSTQREAFDLISVPIPLTLK* |
| Ga0137387_111923852 | 3300012349 | Vadose Zone Soil | VRYTGTQVTIPMLTEPTSTQRQAFQLLGAAIPLTLT* |
| Ga0137375_113353922 | 3300012360 | Vadose Zone Soil | QVRYTGTQVTIAMLTEPTSAQREAFSLLGAAIPLTLT* |
| Ga0137361_116668022 | 3300012362 | Vadose Zone Soil | FTGTTATVPMLAEPTSTQREAFSLLGASIPLTLK* |
| Ga0137390_118350622 | 3300012363 | Vadose Zone Soil | VRFAGTTATVPILADPTSTQREAFQLIGAPIPLTLK* |
| Ga0137373_107565552 | 3300012532 | Vadose Zone Soil | RYTGTQVTIPMLTEPTSTQRQAFHLIGAAIPLTLK* |
| Ga0126375_109862651 | 3300012948 | Tropical Forest Soil | RNQVRFASASADVPLLTEPTSTQRDAYDLIGVPIPLTLK* |
| Ga0157371_108111662 | 3300013102 | Corn Rhizosphere | PRNQVRFAGATADVPMLTEPTSAQREAFDLIGVPIPLALK* |
| Ga0182005_12797362 | 3300015265 | Rhizosphere | QVRLAGAPADVPMLAQPTSAQREAFDLIGVPIPLTLK* |
| Ga0182041_100881771 | 3300016294 | Soil | QVRFVGATATVPMLAEPTSAQQEAFDLISVPIPLTLK |
| Ga0182033_101251571 | 3300016319 | Soil | VRFAGTPAEVPMLTEPTSEQRQAFDLIGVPIPLTLT |
| Ga0182040_117433281 | 3300016387 | Soil | TRNQVRFAGAAVTVPMLAEPTSDQRQAFELIGAPIPLTLK |
| Ga0182037_102886863 | 3300016404 | Soil | NQVRFAGATTTLPMLAEPTATQRQALDLIGVPIPLTLK |
| Ga0182039_103876691 | 3300016422 | Soil | TRNQVRFAGATATVLMLAEPTSTQREAFHLIGVPVPLLLK |
| Ga0182038_101829061 | 3300016445 | Soil | NDVRFAGNAATLPMLAEPTSAQREAFHLIGTPIPLTLK |
| Ga0187812_10320591 | 3300017821 | Freshwater Sediment | QVRFAGTRVTVPVLAEPTSTQRQAFDLIGAPIPLTLK |
| Ga0187812_12774341 | 3300017821 | Freshwater Sediment | QVRFSGTQATVPMLTEPTSIQREAFHLLGTPIPLTLK |
| Ga0187808_103426811 | 3300017942 | Freshwater Sediment | TRNEVRFAGATTTVPMLAEPTSLQRDAFALIGAPIPLTLA |
| Ga0187872_102696991 | 3300018017 | Peatland | RFAGATATVPMLAEPTSEQRAAFQLIGAPIPLTLT |
| Ga0210396_109552852 | 3300021180 | Soil | QVRFAGATTTVPMLAEPTSAQHEAFDLIGAPIPLTLK |
| Ga0210388_101005884 | 3300021181 | Soil | LTRKQVPFAGTRATVPVLAEPTSAQREAFDLIGVPIPLTVR |
| Ga0210387_117172431 | 3300021405 | Soil | TRNQVRFAGAQVTISMLAEPTSAQREAFELIGVPIPLTLK |
| Ga0213853_113112311 | 3300021861 | Watersheds | RFAGAAATVPMLTEPTPAQRQAFDLIGVPIPLTLK |
| Ga0209171_102157781 | 3300025320 | Iron-Sulfur Acid Spring | LTRNQVRFTGTRATMPMLAEPTSAQREVFRLIGVPIPLMLK |
| Ga0208589_10810971 | 3300025634 | Arctic Peat Soil | VDEVFGTHRFAGTHATVPVLAEPTSAQREAFDLIGVPIPLTLR |
| Ga0207710_101299901 | 3300025900 | Switchgrass Rhizosphere | LTRNQVRFAGATATVPMLAEPTADQRQAFDLIGVPVPLTLK |
| Ga0207671_113151231 | 3300025914 | Corn Rhizosphere | VRFAGARADVPMLTEPTSTQREAFDLIGIPIPLTLK |
| Ga0207664_119501991 | 3300025929 | Agricultural Soil | QVRFTGAQTTVPMLTEPTSTQREAFRLIGTPIPLTLK |
| Ga0207686_112732262 | 3300025934 | Miscanthus Rhizosphere | LPRNQVRFAGATADVPMLTEPTSAQREAFDLIGVPIPLALK |
| Ga0209350_10627143 | 3300026277 | Grasslands Soil | RNQVRYTGTQVTIAMLTEPTSIQRQAFQLLGAAIPLTSK |
| Ga0208729_1136682 | 3300027166 | Forest Soil | LTRNQVRYTGTQVTIAMLAEPTSIQRQAFELLGAAIPLSLK |
| Ga0208044_12161112 | 3300027625 | Peatlands Soil | RFTGARATVPMLTEPTSIQREAFHLLGAPIPLSLK |
| Ga0209655_100654091 | 3300027767 | Bog Forest Soil | CHQVRFAGIRAAVPVLAGRASTQREAFRLIGVPVPLIVK |
| Ga0209655_101759882 | 3300027767 | Bog Forest Soil | CHQVRFAGIRAAVPVLAGRASTQREAFRLIGVPIPLIVK |
| Ga0209275_100563912 | 3300027884 | Soil | LTRKQVPFAGTRATVPVLAELTSAQREAFDLIGVPIPLTVR |
| Ga0209380_108280241 | 3300027889 | Soil | NQVRYTGTQVTIPMLTEPTSIQRQAFQLLGAAIPLTLK |
| Ga0209583_101225141 | 3300027910 | Watersheds | VRYTGTQVTVAMLAEPTSTQRQAFELIGAPIPLTLT |
| Ga0307313_102189961 | 3300028715 | Soil | RNQVRFTGTAVTVPILTEPTSAQQEAFDLIGTPIPLTLK |
| Ga0307298_102573391 | 3300028717 | Soil | RNQVRYTGTQVTIPMLTEPTAAQRQAFSLLGVPIPLTLK |
| Ga0307306_100116013 | 3300028782 | Soil | VRFTGAPATVPMLTEPTSTQREAFYLLGATIPLTLK |
| Ga0311340_103813091 | 3300029943 | Palsa | LTRNQVRYTGTQATISMLTEPTIAQRQAFELLGVPI |
| Ga0302190_102161882 | 3300029988 | Bog | RFAGTRATVAMLTEPTSTQRQAFELIGAAIPLTLK |
| Ga0310038_104576363 | 3300030707 | Peatlands Soil | RFAGTRATVPMLAEPTSAQREAFELIGVPIPLALR |
| Ga0302326_106879282 | 3300031525 | Palsa | RYTGTDVTIAMLAEPTSTQRQAFELIGAPIPLTLK |
| Ga0318516_104800702 | 3300031543 | Soil | VRFAGAPATVPMLTEPTSAQRDAFELLGVPIPLTLK |
| Ga0318571_101500492 | 3300031549 | Soil | NQVRFAGTAVTLPMLTEPTSTQRQAFDLIGAPIPLTMT |
| Ga0318573_100610681 | 3300031564 | Soil | TRNQVRFAGATTTLPMLAEPTATQRQALDLIGVPIPLTLK |
| Ga0318515_101609742 | 3300031572 | Soil | VRFAGATADVPMLTEPTSAQRQAFDLVGVPIPLTLK |
| Ga0318555_104199501 | 3300031640 | Soil | NQVRFGGTGTEIPVLAEPTSAQRHAFDLIGAAIPLALT |
| Ga0318560_100562134 | 3300031682 | Soil | RNQVRFAGATTTLPMLAEPTATQRQALDLIGVPIPLTLK |
| Ga0310686_1076184772 | 3300031708 | Soil | RNQVRYTGTQVTIPMLTEPTSAQREAFTLLGTAIPLTLK |
| Ga0318496_100169448 | 3300031713 | Soil | LTRNQVRFAGATADVPMLTEPTSAQRAAFDLIGVPILLTVK |
| Ga0318496_100595101 | 3300031713 | Soil | FLVRFADASTTVPMLAEPTSAQREAFELIGATIPLTLR |
| Ga0318492_100590321 | 3300031748 | Soil | QVRFTGTNAITDMLTEPTSTQREAFGLIGVPIPLTLK |
| Ga0318521_100437731 | 3300031770 | Soil | WPGGRNQVRFAGTPAEVPMLTEPTSEQRQAFDLIGVPIPLTLT |
| Ga0318546_104824403 | 3300031771 | Soil | TLTRNQVRFAGARATVPVLADPTSVQREAFELIGAPIPIAFK |
| Ga0302319_106227962 | 3300031788 | Bog | QVRFAGTRATVAMLTEPTSTQRQAFDLLGAPIPLTLK |
| Ga0318529_102652071 | 3300031792 | Soil | RFAGATTTLPMLAEPTATQRQALDLIGVPIPLTLK |
| Ga0318576_104114982 | 3300031796 | Soil | NQVRFAGTTATVPMLAEPTSTQREAFDLVGAPIPLTLK |
| Ga0318523_106562952 | 3300031798 | Soil | LRVAGASATVPMLAEPTSTQREAFDLIGVPIPLTLK |
| Ga0318527_100681681 | 3300031859 | Soil | QVRFAGAPATVPMLAEPTSHQREAFDLLGLPIPLALK |
| Ga0318563_105281651 | 3300032009 | Soil | TRNQVRFTGTNAITDMLTEPTSTQREAFGLIGVPIPLTLK |
| Ga0318569_101101491 | 3300032010 | Soil | QVRFAGASATVPMLAEPTSTQREAFDLIGVPIPLTLK |
| Ga0306924_102690173 | 3300032076 | Soil | NQVRFAGTRATVPMLAEPTSTQREAFRLLGVPIPLTSK |
| Ga0311301_103540581 | 3300032160 | Peatlands Soil | NQVRFTGTQVTIPMLTEPTSAQREAFTLLGTTIPLTLT |
| Ga0307471_1017963752 | 3300032180 | Hardwood Forest Soil | QFAAAAATVPMLAEPTSTQRDAFDLIDVPVPLTLK |
| Ga0307472_1025662481 | 3300032205 | Hardwood Forest Soil | MTRNQVRFAGATATMPMLAEPTSAQRQAFDLIGIPVPLTLR |
| Ga0306920_1019473241 | 3300032261 | Soil | LTRNDVSFADATTTVPMLAEPTRTQREAFDLIGAPLPLTLK |
| Ga0335080_111527561 | 3300032828 | Soil | QVRFAGAPATVPMLAEPTPAQRQAFDLIGTPIPLTLT |
| Ga0335070_104642732 | 3300032829 | Soil | LTRNQIRLAGAPADVPMLAQPTSAQREAFELLGVPIPL |
| Ga0335081_104817841 | 3300032892 | Soil | NQVRFASATATVPMLAEPTSTQRQAFDLIGVPIPLTLK |
| Ga0335074_106261561 | 3300032895 | Soil | LTRNRVRFAGTQTDIPMLAEPTSAQREAFNLIGIPIPL |
| Ga0335074_114997742 | 3300032895 | Soil | VRFTGAQATVPMLAEPTSAQREAFDLIGTAIPLSLK |
| Ga0335071_101104602 | 3300032897 | Soil | LTRNQIRLAGAPADVPMLAQPTSAQREAFELIGVPIPLTLK |
| Ga0335072_107595052 | 3300032898 | Soil | RFAGATATVPMLAEPTSAQREAFELIGTPIPLTLR |
| ⦗Top⦘ |