| Basic Information | |
|---|---|
| Family ID | F082283 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPALVLYLF |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 33.63 % |
| % of genes near scaffold ends (potentially truncated) | 97.35 % |
| % of genes from short scaffolds (< 2000 bps) | 94.69 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.115 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (11.504 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.664 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.823 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF13769 | Virulence_fact | 46.90 |
| PF02596 | DUF169 | 18.58 |
| PF03949 | Malic_M | 10.62 |
| PF00486 | Trans_reg_C | 2.65 |
| PF00076 | RRM_1 | 1.77 |
| PF07690 | MFS_1 | 1.77 |
| PF16177 | ACAS_N | 0.88 |
| PF02954 | HTH_8 | 0.88 |
| PF01208 | URO-D | 0.88 |
| PF02254 | TrkA_N | 0.88 |
| PF00082 | Peptidase_S8 | 0.88 |
| PF03446 | NAD_binding_2 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG2043 | Uncharacterized conserved protein, DUF169 family | Function unknown [S] | 18.58 |
| COG0281 | Malic enzyme | Energy production and conversion [C] | 10.62 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 10.62 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.12 % |
| Unclassified | root | N/A | 0.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918004|FACENC_F56XM5W01D7ZUV | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 527 | Open in IMG/M |
| 3300000550|F24TB_10412395 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300002560|JGI25383J37093_10190178 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300002911|JGI25390J43892_10099620 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300004157|Ga0062590_100412970 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300005180|Ga0066685_10325174 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300005186|Ga0066676_10616206 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005295|Ga0065707_10262165 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300005345|Ga0070692_10195766 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300005536|Ga0070697_101262737 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300005546|Ga0070696_101219446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300005558|Ga0066698_10797848 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005713|Ga0066905_100388802 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300005718|Ga0068866_10755574 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005764|Ga0066903_102571712 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300005764|Ga0066903_102934705 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300005764|Ga0066903_104761357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 722 | Open in IMG/M |
| 3300005829|Ga0074479_10267412 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005844|Ga0068862_100978132 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300006853|Ga0075420_101596943 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300006871|Ga0075434_100414815 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300006881|Ga0068865_100908755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
| 3300006914|Ga0075436_100775789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 713 | Open in IMG/M |
| 3300009078|Ga0105106_11340398 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 507 | Open in IMG/M |
| 3300009094|Ga0111539_13475559 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
| 3300009100|Ga0075418_10272700 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1802 | Open in IMG/M |
| 3300009792|Ga0126374_10669742 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 776 | Open in IMG/M |
| 3300009810|Ga0105088_1029238 | Not Available | 886 | Open in IMG/M |
| 3300009810|Ga0105088_1112136 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
| 3300010043|Ga0126380_10738350 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 797 | Open in IMG/M |
| 3300010043|Ga0126380_11637217 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 576 | Open in IMG/M |
| 3300010358|Ga0126370_11804837 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 592 | Open in IMG/M |
| 3300010359|Ga0126376_11132248 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 793 | Open in IMG/M |
| 3300010361|Ga0126378_11662803 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300010361|Ga0126378_12411042 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 601 | Open in IMG/M |
| 3300010362|Ga0126377_10893697 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300010376|Ga0126381_104874346 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 515 | Open in IMG/M |
| 3300010391|Ga0136847_11664992 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 671 | Open in IMG/M |
| 3300010398|Ga0126383_12855406 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 564 | Open in IMG/M |
| 3300010398|Ga0126383_13033860 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300010400|Ga0134122_12473771 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 568 | Open in IMG/M |
| 3300012202|Ga0137363_11559208 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 552 | Open in IMG/M |
| 3300012285|Ga0137370_10860290 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 561 | Open in IMG/M |
| 3300012354|Ga0137366_10065790 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2765 | Open in IMG/M |
| 3300012511|Ga0157332_1062365 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 562 | Open in IMG/M |
| 3300012917|Ga0137395_10358000 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300012923|Ga0137359_10890586 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300012931|Ga0153915_12024278 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 674 | Open in IMG/M |
| 3300012948|Ga0126375_10406720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 986 | Open in IMG/M |
| 3300012971|Ga0126369_11143189 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300012976|Ga0134076_10126443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1032 | Open in IMG/M |
| 3300012984|Ga0164309_10724379 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 792 | Open in IMG/M |
| 3300013307|Ga0157372_11411137 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 803 | Open in IMG/M |
| 3300014269|Ga0075302_1176746 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 533 | Open in IMG/M |
| 3300014745|Ga0157377_11436569 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 546 | Open in IMG/M |
| 3300014884|Ga0180104_1235482 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 546 | Open in IMG/M |
| 3300015258|Ga0180093_1182791 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 533 | Open in IMG/M |
| 3300015371|Ga0132258_10719802 | All Organisms → cellular organisms → Bacteria | 2514 | Open in IMG/M |
| 3300015372|Ga0132256_101338270 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300017936|Ga0187821_10044787 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300017974|Ga0187777_11136366 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 569 | Open in IMG/M |
| 3300018052|Ga0184638_1268265 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 583 | Open in IMG/M |
| 3300018053|Ga0184626_10357743 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 593 | Open in IMG/M |
| 3300018078|Ga0184612_10378396 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300018078|Ga0184612_10458217 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 632 | Open in IMG/M |
| 3300019229|Ga0180116_1256476 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
| 3300019458|Ga0187892_10246532 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300019789|Ga0137408_1025516 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1316 | Open in IMG/M |
| 3300020150|Ga0187768_1154074 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 530 | Open in IMG/M |
| 3300021344|Ga0193719_10423160 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 545 | Open in IMG/M |
| 3300024224|Ga0247673_1029846 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300025796|Ga0210113_1011839 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1839 | Open in IMG/M |
| 3300025904|Ga0207647_10434361 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300025910|Ga0207684_10542745 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 995 | Open in IMG/M |
| 3300025917|Ga0207660_10256541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1381 | Open in IMG/M |
| 3300025930|Ga0207701_10651224 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300025949|Ga0207667_11496034 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 646 | Open in IMG/M |
| 3300025961|Ga0207712_10604541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 949 | Open in IMG/M |
| 3300025961|Ga0207712_11730321 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 560 | Open in IMG/M |
| 3300026285|Ga0209438_1088089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 977 | Open in IMG/M |
| 3300026309|Ga0209055_1182073 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 649 | Open in IMG/M |
| 3300026360|Ga0257173_1036309 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 668 | Open in IMG/M |
| 3300026376|Ga0257167_1034290 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300026376|Ga0257167_1036851 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 737 | Open in IMG/M |
| 3300026469|Ga0257169_1004849 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300026494|Ga0257159_1095296 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 520 | Open in IMG/M |
| 3300026498|Ga0257156_1121708 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 543 | Open in IMG/M |
| 3300026537|Ga0209157_1010054 | All Organisms → cellular organisms → Bacteria | 6412 | Open in IMG/M |
| 3300027605|Ga0209329_1106307 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 615 | Open in IMG/M |
| 3300027748|Ga0209689_1411100 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
| 3300028381|Ga0268264_10122861 | All Organisms → cellular organisms → Bacteria | 2291 | Open in IMG/M |
| 3300028716|Ga0307311_10124336 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 732 | Open in IMG/M |
| 3300028881|Ga0307277_10445138 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 580 | Open in IMG/M |
| 3300028906|Ga0308309_10287351 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1387 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10195923 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 564 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1016822 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
| 3300031720|Ga0307469_11209435 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 714 | Open in IMG/M |
| 3300031771|Ga0318546_10052859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2536 | Open in IMG/M |
| 3300031820|Ga0307473_11572547 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 501 | Open in IMG/M |
| 3300032008|Ga0318562_10371626 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 831 | Open in IMG/M |
| 3300032055|Ga0318575_10600440 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 558 | Open in IMG/M |
| 3300032126|Ga0307415_102187903 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 541 | Open in IMG/M |
| 3300032163|Ga0315281_11006842 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300032205|Ga0307472_100899916 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300032397|Ga0315287_11148661 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300032397|Ga0315287_12938107 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 501 | Open in IMG/M |
| 3300032516|Ga0315273_11480764 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300033289|Ga0310914_10591074 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1001 | Open in IMG/M |
| 3300033433|Ga0326726_11938640 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 573 | Open in IMG/M |
| 3300033475|Ga0310811_10704455 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300033486|Ga0316624_10383558 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300033811|Ga0364924_006489 | All Organisms → cellular organisms → Bacteria | 2086 | Open in IMG/M |
| 3300033812|Ga0364926_009282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1620 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.31% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.42% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.54% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.65% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.77% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.77% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.77% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.89% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300019229 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
| 3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCA_6517300 | 2035918004 | Soil | MKAVELLVACFLLFGACLVWPLLAIANHPVLILGVPAL |
| F24TB_104123951 | 3300000550 | Soil | MKAAELVVACFLLFGACLVWPLLSIANRPTLILGVPALVVYLFAVWAAMV |
| JGI25383J37093_101901781 | 3300002560 | Grasslands Soil | MKARELLAACFFLFGALLIWPLLTIANRPVLVGGVPALVVYLFAVWAIIVS |
| JGI25390J43892_100996201 | 3300002911 | Grasslands Soil | VKAKELLAACFVLFGALLVWPLLSXPNRAVLVAGVPALVLYLFGV |
| Ga0062590_1004129703 | 3300004157 | Soil | MKATERIVAWFLLFGACLVWPLLSIANRPRLIAGVPALVLYLFAVWSAIVVVL |
| Ga0066685_103251743 | 3300005180 | Soil | MKAAELVVACFLLFGACLVWPLLAIANRSVLVLGIPGLVLYLFVLWGAMVV |
| Ga0066676_106162063 | 3300005186 | Soil | MKAAELVMACFLLFGACLVWPLLAIANRPVFVLGIPLLVLYLFAVWVAIV |
| Ga0065707_102621653 | 3300005295 | Switchgrass Rhizosphere | MKARELLVACFALFGACLLWPLLAIANRPVLILGVPALVLYLLAVWVAIVTVLV |
| Ga0070692_101957663 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MKAAELVVACFLLFGACLVWPLLAIANRPTLVFGVPPLVLYLFGLWAA |
| Ga0070697_1012627372 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VKAKDLLSACFFLFGALLVWPLVTIANRTTLVAGVPALVLYLFVVWAA |
| Ga0070696_1012194462 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKARELLVACFALFGACLLWPLLAIANRSVLILGVPALVLYLLAVWVAI |
| Ga0066698_107978481 | 3300005558 | Soil | MRAAELAVACFLLFGACLMWPLLAIANRPVLILGVPALVLYLFG |
| Ga0066905_1003888021 | 3300005713 | Tropical Forest Soil | MKATELLVACFALFGACLLWPLLAIANRPLLVLGVPALALYLFAVWAAIVVVLIV |
| Ga0068866_107555742 | 3300005718 | Miscanthus Rhizosphere | MKAAELVVACFLLFGACLVWPLLAIANRPTLVVGVPPLVLYLFGLW |
| Ga0066903_1025717121 | 3300005764 | Tropical Forest Soil | MKATELLVACCALFGACLLWPLLAIANRPVLVLGVPALALYLFAVWAAIV |
| Ga0066903_1029347052 | 3300005764 | Tropical Forest Soil | MKATELLVACFALFAACLLWPLLAIANRPVLVLGVPALALYLFAVWAAIVV |
| Ga0066903_1047613572 | 3300005764 | Tropical Forest Soil | VKAKGFLAACFVFFGGLLVWPLLTAANKPVLIAGIPALVLYLFAVWAAIV |
| Ga0074479_102674121 | 3300005829 | Sediment (Intertidal) | MKARELLAACFLLFGALLLWPLVTIANRPVLIWGVPALVLYLFVV |
| Ga0068862_1009781322 | 3300005844 | Switchgrass Rhizosphere | VRGKELLAVLFPLFAALLVWPLLTVANRPVLVAGIPALVLYLFAVWAVIVA |
| Ga0075420_1015969432 | 3300006853 | Populus Rhizosphere | VKPRELLAACVVLFGALLGWPLLTIPNRPVLIWGVPALVLYLF |
| Ga0075434_1004148151 | 3300006871 | Populus Rhizosphere | MKATERIVAWFLLFGACLVWPLLSIANRPRLIAGVPALVLYLFAVW |
| Ga0068865_1009087551 | 3300006881 | Miscanthus Rhizosphere | MKAVELVLACFVLFAACLVWPLLAIANRLVLVAGVPALVLYLFGVWTAMVVVLI |
| Ga0075436_1007757891 | 3300006914 | Populus Rhizosphere | VKAKEFLAACFVFFGGLLVWPLLTAANRPVLVAGIPALVLYLF |
| Ga0105106_113403981 | 3300009078 | Freshwater Sediment | MKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPALVLYLFAVWAAMVA |
| Ga0111539_134755591 | 3300009094 | Populus Rhizosphere | MRELLAACFGLFAALLVWSLLGILNRPVLIGGIPMLVLYLFVVWVAIVIVL |
| Ga0075418_102727001 | 3300009100 | Populus Rhizosphere | MKAAELVVACFVLFGACLVWPLLAIANRPVLVFGVPALVLYLFLVW |
| Ga0126374_106697421 | 3300009792 | Tropical Forest Soil | MKATELLVACCALFGACLLWPLLAIANRPVLVLGVPALALYLFAVWAAIVV |
| Ga0105088_10292381 | 3300009810 | Groundwater Sand | VTPRRGLLAVCFALFAALLVWPLLSIPNRLTLIAGVPALVLYLFAVWA |
| Ga0105088_11121362 | 3300009810 | Groundwater Sand | VTAKELLGTCFVLFGALLVWPLLSIPNRLVLIAGVPALVVYLFAVWATIVGV |
| Ga0126380_107383502 | 3300010043 | Tropical Forest Soil | MREFLAACFGLFAALLVWPLLGIPNRPVLVAGVPMLVLYLFSVWAAI |
| Ga0126380_116372172 | 3300010043 | Tropical Forest Soil | MKATELLVACFALFGACLLWPLLAIANRPVLVLGVPALALYLFAVWAAIV |
| Ga0126370_118048371 | 3300010358 | Tropical Forest Soil | MKATELLVACFALFGACLLWPLLAIANRPVLVLGVPALALYLFAVWAA |
| Ga0126376_111322481 | 3300010359 | Tropical Forest Soil | MKATELLVACFALFGACLLWPLLAIANRPVLILGVPALALYLFAVWA |
| Ga0126378_116628031 | 3300010361 | Tropical Forest Soil | MRAAELVVACFLLFGACLVWPLLTIANRPGLILGVPVL |
| Ga0126378_124110421 | 3300010361 | Tropical Forest Soil | MKATELLVACFALFGACLLWPLLAIANRPVLVLGVPALA |
| Ga0126377_108936973 | 3300010362 | Tropical Forest Soil | MKATELLVACFALFGACLLWPLLAIANRPVLVLGVPALALYLFA |
| Ga0126381_1048743462 | 3300010376 | Tropical Forest Soil | MKAPELLVACFALFGACLLWPLLAIANRPVLVLGVPALALYLF |
| Ga0136847_116649921 | 3300010391 | Freshwater Sediment | MKARELLAACFLLFGALLVWPLLTIANRPVLIWGVPALVLYLFAVWVAIVA |
| Ga0126383_128554062 | 3300010398 | Tropical Forest Soil | MKAAELVVACFLLFGACLVWPLLAIANRPILLLGVPALVLYIFAVWGAMV |
| Ga0126383_130338601 | 3300010398 | Tropical Forest Soil | VKGKGFLAACFVFFGGLLVWPLLTAANKQVLIAGIPALVL |
| Ga0134122_124737712 | 3300010400 | Terrestrial Soil | MKAAELLVACFLLFGACLVWPLLAIANHPVLVLGVPSLVLYLFAVWAA |
| Ga0137363_115592081 | 3300012202 | Vadose Zone Soil | MKARELLVACFALFGACLLWPLLAIANRPVVILGVPALVLYL |
| Ga0137370_108602901 | 3300012285 | Vadose Zone Soil | MKARELLAACFLFFGTLLLWPLLTIANRPVLIAGVPALALYLFTVWA |
| Ga0137366_100657901 | 3300012354 | Vadose Zone Soil | MKARELLAACFVLFGALLLWPLLTIANRPVLIWGVPALVLYLFAVW |
| Ga0157332_10623651 | 3300012511 | Soil | MKARELLVACFALFGACLLWPLLAIANHPVLILGMPALVLYLLAVWVAI |
| Ga0137395_103580001 | 3300012917 | Vadose Zone Soil | MKARELLAACFFLFGALLIWPLLTIANRPVLVGGVPA |
| Ga0137359_108905861 | 3300012923 | Vadose Zone Soil | MKAAELVVACFLLFGTCLVWPLLAIANRPVLVAGVPALVLY |
| Ga0153915_120242781 | 3300012931 | Freshwater Wetlands | MKAREILAACFIFFGALLLWPLLTIANHLVLIGGVPA |
| Ga0126375_104067201 | 3300012948 | Tropical Forest Soil | MKATELLVACFALFGACLLWPLLAIANRPVLVLGVPALALYLFAVWAAIVVVLV |
| Ga0126369_111431891 | 3300012971 | Tropical Forest Soil | MKATELLVACFALFGACLLWPLLAIANRPVLVLGVPALALYLFTVWA |
| Ga0134076_101264431 | 3300012976 | Grasslands Soil | VRAKELLATCFVLFGALLVWPLLSIPNRLVLIAGVPA |
| Ga0164309_107243793 | 3300012984 | Soil | MKARELLVACFALFGACLLWPLLAIANRSVLILGVPALVLYLLAGERAA |
| Ga0157372_114111372 | 3300013307 | Corn Rhizosphere | MKPLLAVCFGLFAALLVWPLLGIPNRPVLLAGIPALVLYLFAVWG |
| Ga0075302_11767462 | 3300014269 | Natural And Restored Wetlands | MRARELLAACFLLFAALLLWPLLTIANRPVLIWGVPALVLYLF |
| Ga0157377_114365691 | 3300014745 | Miscanthus Rhizosphere | MKAAELVVACFLLFGACLVWPLLAIANCPTLVFGVPP |
| Ga0180104_12354822 | 3300014884 | Soil | MKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPALVL* |
| Ga0180093_11827911 | 3300015258 | Soil | MERMVAGFLLFGACLVWPLLSIANRPVLFLGIPVMVLYLFG |
| Ga0132258_107198021 | 3300015371 | Arabidopsis Rhizosphere | MKARELLVACFALFGACLLWPLLAIANHPVLILGMPALVLYL |
| Ga0132256_1013382701 | 3300015372 | Arabidopsis Rhizosphere | MKAAELVVACFVLFGACLVWPLLAIANRPVLVFGVPALVLYLFLV |
| Ga0187821_100447871 | 3300017936 | Freshwater Sediment | MKAAELVVACFLLFGACLVWPLLAIANRPALVAGVPALVLYLFVVWTGMVV |
| Ga0187777_111363661 | 3300017974 | Tropical Peatland | MKAKELLAACFLLFGALLLPPLLTIANRPVLVAGVPALVLYLFGIWIA |
| Ga0184638_12682651 | 3300018052 | Groundwater Sediment | MKAKELLAACFLLFGALLIWPLLTIANRPVLVGGVPALAVYLFTLWGIMVVVLV |
| Ga0184626_103577431 | 3300018053 | Groundwater Sediment | MKALLAVCFGLFAALLVWPLLGIPNRPVLLAGVPALVLYLFSVW |
| Ga0184612_103783961 | 3300018078 | Groundwater Sediment | VKALLAVCFGLFAALLVWPLLGIPNRPVLLGGIPALVLYLFAVWAAIVVVL |
| Ga0184612_104582171 | 3300018078 | Groundwater Sediment | MKALLAVCFGLFAALLVWPLLGIPNRPVLLGGIPALVLYLFAVWAAIVVVL |
| Ga0180116_12564761 | 3300019229 | Groundwater Sediment | VRAKELLGACFVVFAALLVWPLLSIPNRPVLVAGLPALVLYLFV |
| Ga0187892_102465323 | 3300019458 | Bio-Ooze | MKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPALVL |
| Ga0137408_10255161 | 3300019789 | Vadose Zone Soil | VTAKELLATCFVLFGALLVWPLLSIPNRLVLIAGDWC |
| Ga0187768_11540742 | 3300020150 | Tropical Peatland | MRATELVVACFLLFGACLVWPLLAIANRPVLLLGVPAL |
| Ga0193719_104231601 | 3300021344 | Soil | MKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPALVLYLFS |
| Ga0247673_10298463 | 3300024224 | Soil | MKAAELVVACFLLFGTCLVWPLLAIANRPVLVAGVPALVL |
| Ga0210113_10118392 | 3300025796 | Natural And Restored Wetlands | MRSKSLLSVCFALFGALLVWPLLSIANRPVLVAGLPALVVYLF |
| Ga0207647_104343613 | 3300025904 | Corn Rhizosphere | MKAAELLVACFLLFGACLVWPLLAIANHPVLVLGVPSLVLYLFAVW |
| Ga0207684_105427451 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKAAELVVACFLLFGACLVWPLLAIANRPVLVLGVPALVLYLFGLW |
| Ga0207660_102565411 | 3300025917 | Corn Rhizosphere | MVASFLLFGACLVWPLLSIANRPVLFLGIPVMVLYLFGV |
| Ga0207701_106512243 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATERIVAWFLLFGACLVWPLLSIANRPRLIAGVPALVLYLFAVWSAIVVV |
| Ga0207667_114960341 | 3300025949 | Corn Rhizosphere | MKAAELVLACFLLFGACLVWPLLSIANRPVLILGV |
| Ga0207712_106045411 | 3300025961 | Switchgrass Rhizosphere | MKAAELVVACFLLFGACLVWPLLAIANRPTLVFGVPPLVLYLFGL |
| Ga0207712_117303212 | 3300025961 | Switchgrass Rhizosphere | MRAMERMVASFLLFGACLVWPLLSIANRPVLFLGIPVMVL |
| Ga0209438_10880893 | 3300026285 | Grasslands Soil | MKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPALVLYLFSVWAAMVA |
| Ga0209055_11820731 | 3300026309 | Soil | VKAKELLAACFVLLGALLVWPLLSIPNRAVLVAGVPAMVLYLFGVW |
| Ga0257173_10363092 | 3300026360 | Soil | VTAKELLATCFVLFGALLVWPLLSIPNRLVLIAGVPALVVYL |
| Ga0257167_10342901 | 3300026376 | Soil | MKARELLAACFFLFGALLIWPLLTIANRPVLVGGVPALV |
| Ga0257167_10368513 | 3300026376 | Soil | MKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPALVLYLFAVWAAM |
| Ga0257169_10048493 | 3300026469 | Soil | MKAAELVVACFLLFGTCLVWPLLAIANRPVLVAGVPALVLYLFA |
| Ga0257159_10952961 | 3300026494 | Soil | MKARELLAACFLFFGTLLLWPLLTIANRPVLIAGV |
| Ga0257156_11217081 | 3300026498 | Soil | MKARELLVACFLFFGTMLLWPLLTIANRPVLIAGVPALA |
| Ga0209157_10100546 | 3300026537 | Soil | VRAKELLATCFVLFGALLVWPLLSIPNRLVLIAGVP |
| Ga0209329_11063071 | 3300027605 | Forest Soil | MKAAELVVACFLLFGTCLVWPLLAIANRPVLVAGVPALVLYLFVV |
| Ga0209689_14111002 | 3300027748 | Soil | MKAAELVVACFLLFGTCLVWPLLAIANRPVLVAGVPALVLYLFAVWTGMVVVLIA |
| Ga0268264_101228611 | 3300028381 | Switchgrass Rhizosphere | MKAAELVVACFLLFGACLVWPLLAIANRPTLVFGVPPLVL |
| Ga0307311_101243361 | 3300028716 | Soil | MKAAELLVACFLLFGACLVWPLLAIANHPVLILGVP |
| Ga0307277_104451382 | 3300028881 | Soil | MKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPALVLYLF |
| Ga0308309_102873513 | 3300028906 | Soil | MKAAELVVACFLLFGACLVWPLLAIANRPVFILGVPALVMYLF |
| (restricted) Ga0255310_101959232 | 3300031197 | Sandy Soil | MKAAELLVACFLLFGACLVWPLLAIANHPVLVLGVPALVLYL |
| (restricted) Ga0255312_10168221 | 3300031248 | Sandy Soil | MKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPAL |
| Ga0307469_112094351 | 3300031720 | Hardwood Forest Soil | MKARELLVACFALFGACLLWPLLAIANHPVLILGMPALVLYLLAVWIAI |
| Ga0318546_100528591 | 3300031771 | Soil | MKAPELLVACFALFGACLLWPLLAIANRPVLVLGVPALALYLFAVWAGIVVVLI |
| Ga0307473_115725471 | 3300031820 | Hardwood Forest Soil | MKAAELVVACFLLFGACLVWPLLAIANRPVLILGVPALVM |
| Ga0318562_103716262 | 3300032008 | Soil | MKAPELLVACFALFGACLLWPLLAIANRPVLVLGVPALALYLFA |
| Ga0318575_106004401 | 3300032055 | Soil | MKAPELLVACFALFGACLLWPLLAIANRPVLVLVVPK |
| Ga0307415_1021879031 | 3300032126 | Rhizosphere | MNRGREGPGRAKDLLAACFVLLAALLVWPLLTIANRPVLIAGVPALVLYLFGVWAVI |
| Ga0315281_110068423 | 3300032163 | Sediment | MKARELLAACFLLFGALLVWPLLTIANRPVLIWGVPALVLYLFAVWAAIVAV |
| Ga0307472_1008999163 | 3300032205 | Hardwood Forest Soil | MKAAELVVACFLLFATCLVWPLLAIANRPVLVAGVPALVLY |
| Ga0315287_111486611 | 3300032397 | Sediment | MKARELLAACFLLFGALLVWPLLTIANRPVLIWGVPALVLYLFAV |
| Ga0315287_129381072 | 3300032397 | Sediment | MKARELLAACFLFFGALLLWPLLTIANRPVLIGGVPALVLYLFA |
| Ga0315273_114807641 | 3300032516 | Sediment | MKARELLVACFLLFGALLVWPLLTIANRPVLIWGVPALVLYLFAVWAAI |
| Ga0310914_105910742 | 3300033289 | Soil | VKAKGFLGACFVLFGGLLVWPLLTAANKPVLIAGIPALVLYLFAVWAA |
| Ga0326726_119386402 | 3300033433 | Peat Soil | MKARELLAACFVLFGALLLWPLLTIANRPVLIAGVPALVL |
| Ga0310811_107044553 | 3300033475 | Soil | MKAAELVVACFLLFGACLVWPLLAIANRPVLVAGVPAL |
| Ga0316624_103835583 | 3300033486 | Soil | MKAAELVVACFLLFGACLVWPLLAIANRPALVAGVPALVLYLFAVWTAM |
| Ga0364924_006489_1622_1777 | 3300033811 | Sediment | VTAKELLATCFVLFGALLVWPLLSIPNRLMLIAGVPALVLYLFAVRSGNGE |
| Ga0364926_009282_937_1092 | 3300033812 | Sediment | VTAKELLATRFVLFGALLVWPLLSIPSRLMLIAGVPALVLYLFAVRSGNGE |
| ⦗Top⦘ |