NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082283

Metagenome / Metatranscriptome Family F082283

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082283
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 45 residues
Representative Sequence MKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPALVLYLF
Number of Associated Samples 103
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 33.63 %
% of genes near scaffold ends (potentially truncated) 97.35 %
% of genes from short scaffolds (< 2000 bps) 94.69 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.115 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(11.504 % of family members)
Environment Ontology (ENVO) Unclassified
(25.664 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.823 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 52.11%    β-sheet: 0.00%    Coil/Unstructured: 47.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF13769Virulence_fact 46.90
PF02596DUF169 18.58
PF03949Malic_M 10.62
PF00486Trans_reg_C 2.65
PF00076RRM_1 1.77
PF07690MFS_1 1.77
PF16177ACAS_N 0.88
PF02954HTH_8 0.88
PF01208URO-D 0.88
PF02254TrkA_N 0.88
PF00082Peptidase_S8 0.88
PF03446NAD_binding_2 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG2043Uncharacterized conserved protein, DUF169 familyFunction unknown [S] 18.58
COG0281Malic enzymeEnergy production and conversion [C] 10.62
COG0686Alanine dehydrogenase (includes sporulation protein SpoVN)Amino acid transport and metabolism [E] 10.62
COG0407Uroporphyrinogen-III decarboxylase HemECoenzyme transport and metabolism [H] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.12 %
UnclassifiedrootN/A0.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035918004|FACENC_F56XM5W01D7ZUVAll Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria527Open in IMG/M
3300000550|F24TB_10412395All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300002560|JGI25383J37093_10190178All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300002911|JGI25390J43892_10099620All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300004157|Ga0062590_100412970All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300005180|Ga0066685_10325174All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300005186|Ga0066676_10616206All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300005295|Ga0065707_10262165All Organisms → cellular organisms → Bacteria1094Open in IMG/M
3300005345|Ga0070692_10195766All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300005536|Ga0070697_101262737All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300005546|Ga0070696_101219446All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria636Open in IMG/M
3300005558|Ga0066698_10797848All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300005713|Ga0066905_100388802All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300005718|Ga0068866_10755574All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300005764|Ga0066903_102571712All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300005764|Ga0066903_102934705All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300005764|Ga0066903_104761357All Organisms → cellular organisms → Bacteria → Proteobacteria722Open in IMG/M
3300005829|Ga0074479_10267412All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300005844|Ga0068862_100978132All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300006853|Ga0075420_101596943All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300006871|Ga0075434_100414815All Organisms → cellular organisms → Bacteria1367Open in IMG/M
3300006881|Ga0068865_100908755All Organisms → cellular organisms → Bacteria → Proteobacteria766Open in IMG/M
3300006914|Ga0075436_100775789All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria713Open in IMG/M
3300009078|Ga0105106_11340398All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria507Open in IMG/M
3300009094|Ga0111539_13475559All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium506Open in IMG/M
3300009100|Ga0075418_10272700All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1802Open in IMG/M
3300009792|Ga0126374_10669742All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria776Open in IMG/M
3300009810|Ga0105088_1029238Not Available886Open in IMG/M
3300009810|Ga0105088_1112136All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium513Open in IMG/M
3300010043|Ga0126380_10738350All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium797Open in IMG/M
3300010043|Ga0126380_11637217All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria576Open in IMG/M
3300010358|Ga0126370_11804837All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria592Open in IMG/M
3300010359|Ga0126376_11132248All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria793Open in IMG/M
3300010361|Ga0126378_11662803All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300010361|Ga0126378_12411042All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria601Open in IMG/M
3300010362|Ga0126377_10893697All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300010376|Ga0126381_104874346All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria515Open in IMG/M
3300010391|Ga0136847_11664992All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria671Open in IMG/M
3300010398|Ga0126383_12855406All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium564Open in IMG/M
3300010398|Ga0126383_13033860All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300010400|Ga0134122_12473771All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria568Open in IMG/M
3300012202|Ga0137363_11559208All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria552Open in IMG/M
3300012285|Ga0137370_10860290All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria561Open in IMG/M
3300012354|Ga0137366_10065790All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2765Open in IMG/M
3300012511|Ga0157332_1062365All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria562Open in IMG/M
3300012917|Ga0137395_10358000All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300012923|Ga0137359_10890586All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300012931|Ga0153915_12024278All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria674Open in IMG/M
3300012948|Ga0126375_10406720All Organisms → cellular organisms → Bacteria → Proteobacteria986Open in IMG/M
3300012971|Ga0126369_11143189All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300012976|Ga0134076_10126443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1032Open in IMG/M
3300012984|Ga0164309_10724379All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria792Open in IMG/M
3300013307|Ga0157372_11411137All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium803Open in IMG/M
3300014269|Ga0075302_1176746All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria533Open in IMG/M
3300014745|Ga0157377_11436569All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria546Open in IMG/M
3300014884|Ga0180104_1235482All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria546Open in IMG/M
3300015258|Ga0180093_1182791All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria533Open in IMG/M
3300015371|Ga0132258_10719802All Organisms → cellular organisms → Bacteria2514Open in IMG/M
3300015372|Ga0132256_101338270All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300017936|Ga0187821_10044787All Organisms → cellular organisms → Bacteria1580Open in IMG/M
3300017974|Ga0187777_11136366All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria569Open in IMG/M
3300018052|Ga0184638_1268265All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria583Open in IMG/M
3300018053|Ga0184626_10357743All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium593Open in IMG/M
3300018078|Ga0184612_10378396All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300018078|Ga0184612_10458217All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium632Open in IMG/M
3300019229|Ga0180116_1256476All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium519Open in IMG/M
3300019458|Ga0187892_10246532All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300019789|Ga0137408_1025516All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1316Open in IMG/M
3300020150|Ga0187768_1154074All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium530Open in IMG/M
3300021344|Ga0193719_10423160All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria545Open in IMG/M
3300024224|Ga0247673_1029846All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300025796|Ga0210113_1011839All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1839Open in IMG/M
3300025904|Ga0207647_10434361All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300025910|Ga0207684_10542745All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium995Open in IMG/M
3300025917|Ga0207660_10256541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1381Open in IMG/M
3300025930|Ga0207701_10651224All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300025949|Ga0207667_11496034All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria646Open in IMG/M
3300025961|Ga0207712_10604541All Organisms → cellular organisms → Bacteria → Proteobacteria949Open in IMG/M
3300025961|Ga0207712_11730321All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria560Open in IMG/M
3300026285|Ga0209438_1088089All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria977Open in IMG/M
3300026309|Ga0209055_1182073All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium649Open in IMG/M
3300026360|Ga0257173_1036309All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium668Open in IMG/M
3300026376|Ga0257167_1034290All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300026376|Ga0257167_1036851All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria737Open in IMG/M
3300026469|Ga0257169_1004849All Organisms → cellular organisms → Bacteria1485Open in IMG/M
3300026494|Ga0257159_1095296All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria520Open in IMG/M
3300026498|Ga0257156_1121708All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria543Open in IMG/M
3300026537|Ga0209157_1010054All Organisms → cellular organisms → Bacteria6412Open in IMG/M
3300027605|Ga0209329_1106307All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria615Open in IMG/M
3300027748|Ga0209689_1411100All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium518Open in IMG/M
3300028381|Ga0268264_10122861All Organisms → cellular organisms → Bacteria2291Open in IMG/M
3300028716|Ga0307311_10124336All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria732Open in IMG/M
3300028881|Ga0307277_10445138All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria580Open in IMG/M
3300028906|Ga0308309_10287351All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla1387Open in IMG/M
(restricted) 3300031197|Ga0255310_10195923All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria564Open in IMG/M
(restricted) 3300031248|Ga0255312_1016822All Organisms → cellular organisms → Bacteria1745Open in IMG/M
3300031720|Ga0307469_11209435All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria714Open in IMG/M
3300031771|Ga0318546_10052859All Organisms → cellular organisms → Bacteria → Proteobacteria2536Open in IMG/M
3300031820|Ga0307473_11572547All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria501Open in IMG/M
3300032008|Ga0318562_10371626All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria831Open in IMG/M
3300032055|Ga0318575_10600440All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria558Open in IMG/M
3300032126|Ga0307415_102187903All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium541Open in IMG/M
3300032163|Ga0315281_11006842All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300032205|Ga0307472_100899916All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300032397|Ga0315287_11148661All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300032397|Ga0315287_12938107All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria501Open in IMG/M
3300032516|Ga0315273_11480764All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300033289|Ga0310914_10591074All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1001Open in IMG/M
3300033433|Ga0326726_11938640All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria573Open in IMG/M
3300033475|Ga0310811_10704455All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300033486|Ga0316624_10383558All Organisms → cellular organisms → Bacteria1170Open in IMG/M
3300033811|Ga0364924_006489All Organisms → cellular organisms → Bacteria2086Open in IMG/M
3300033812|Ga0364926_009282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1620Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.31%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.31%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.42%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.54%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.54%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.54%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.65%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.77%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.77%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.77%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil1.77%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.77%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.77%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.89%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.89%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.89%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.89%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.89%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.89%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.89%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.89%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2035918004Soil microbial communities from sample at FACE Site 2 North Carolina CO2-EnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012511Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014269Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300015258Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1DaEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300019229Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020150Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MGEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300024224Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14EnvironmentalOpen in IMG/M
3300025796Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026360Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-BEnvironmentalOpen in IMG/M
3300026376Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-BEnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M
3300033812Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
FACENCA_65173002035918004SoilMKAVELLVACFLLFGACLVWPLLAIANHPVLILGVPAL
F24TB_1041239513300000550SoilMKAAELVVACFLLFGACLVWPLLSIANRPTLILGVPALVVYLFAVWAAMV
JGI25383J37093_1019017813300002560Grasslands SoilMKARELLAACFFLFGALLIWPLLTIANRPVLVGGVPALVVYLFAVWAIIVS
JGI25390J43892_1009962013300002911Grasslands SoilVKAKELLAACFVLFGALLVWPLLSXPNRAVLVAGVPALVLYLFGV
Ga0062590_10041297033300004157SoilMKATERIVAWFLLFGACLVWPLLSIANRPRLIAGVPALVLYLFAVWSAIVVVL
Ga0066685_1032517433300005180SoilMKAAELVVACFLLFGACLVWPLLAIANRSVLVLGIPGLVLYLFVLWGAMVV
Ga0066676_1061620633300005186SoilMKAAELVMACFLLFGACLVWPLLAIANRPVFVLGIPLLVLYLFAVWVAIV
Ga0065707_1026216533300005295Switchgrass RhizosphereMKARELLVACFALFGACLLWPLLAIANRPVLILGVPALVLYLLAVWVAIVTVLV
Ga0070692_1019576633300005345Corn, Switchgrass And Miscanthus RhizosphereMKAAELVVACFLLFGACLVWPLLAIANRPTLVFGVPPLVLYLFGLWAA
Ga0070697_10126273723300005536Corn, Switchgrass And Miscanthus RhizosphereVKAKDLLSACFFLFGALLVWPLVTIANRTTLVAGVPALVLYLFVVWAA
Ga0070696_10121944623300005546Corn, Switchgrass And Miscanthus RhizosphereMKARELLVACFALFGACLLWPLLAIANRSVLILGVPALVLYLLAVWVAI
Ga0066698_1079784813300005558SoilMRAAELAVACFLLFGACLMWPLLAIANRPVLILGVPALVLYLFG
Ga0066905_10038880213300005713Tropical Forest SoilMKATELLVACFALFGACLLWPLLAIANRPLLVLGVPALALYLFAVWAAIVVVLIV
Ga0068866_1075557423300005718Miscanthus RhizosphereMKAAELVVACFLLFGACLVWPLLAIANRPTLVVGVPPLVLYLFGLW
Ga0066903_10257171213300005764Tropical Forest SoilMKATELLVACCALFGACLLWPLLAIANRPVLVLGVPALALYLFAVWAAIV
Ga0066903_10293470523300005764Tropical Forest SoilMKATELLVACFALFAACLLWPLLAIANRPVLVLGVPALALYLFAVWAAIVV
Ga0066903_10476135723300005764Tropical Forest SoilVKAKGFLAACFVFFGGLLVWPLLTAANKPVLIAGIPALVLYLFAVWAAIV
Ga0074479_1026741213300005829Sediment (Intertidal)MKARELLAACFLLFGALLLWPLVTIANRPVLIWGVPALVLYLFVV
Ga0068862_10097813223300005844Switchgrass RhizosphereVRGKELLAVLFPLFAALLVWPLLTVANRPVLVAGIPALVLYLFAVWAVIVA
Ga0075420_10159694323300006853Populus RhizosphereVKPRELLAACVVLFGALLGWPLLTIPNRPVLIWGVPALVLYLF
Ga0075434_10041481513300006871Populus RhizosphereMKATERIVAWFLLFGACLVWPLLSIANRPRLIAGVPALVLYLFAVW
Ga0068865_10090875513300006881Miscanthus RhizosphereMKAVELVLACFVLFAACLVWPLLAIANRLVLVAGVPALVLYLFGVWTAMVVVLI
Ga0075436_10077578913300006914Populus RhizosphereVKAKEFLAACFVFFGGLLVWPLLTAANRPVLVAGIPALVLYLF
Ga0105106_1134039813300009078Freshwater SedimentMKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPALVLYLFAVWAAMVA
Ga0111539_1347555913300009094Populus RhizosphereMRELLAACFGLFAALLVWSLLGILNRPVLIGGIPMLVLYLFVVWVAIVIVL
Ga0075418_1027270013300009100Populus RhizosphereMKAAELVVACFVLFGACLVWPLLAIANRPVLVFGVPALVLYLFLVW
Ga0126374_1066974213300009792Tropical Forest SoilMKATELLVACCALFGACLLWPLLAIANRPVLVLGVPALALYLFAVWAAIVV
Ga0105088_102923813300009810Groundwater SandVTPRRGLLAVCFALFAALLVWPLLSIPNRLTLIAGVPALVLYLFAVWA
Ga0105088_111213623300009810Groundwater SandVTAKELLGTCFVLFGALLVWPLLSIPNRLVLIAGVPALVVYLFAVWATIVGV
Ga0126380_1073835023300010043Tropical Forest SoilMREFLAACFGLFAALLVWPLLGIPNRPVLVAGVPMLVLYLFSVWAAI
Ga0126380_1163721723300010043Tropical Forest SoilMKATELLVACFALFGACLLWPLLAIANRPVLVLGVPALALYLFAVWAAIV
Ga0126370_1180483713300010358Tropical Forest SoilMKATELLVACFALFGACLLWPLLAIANRPVLVLGVPALALYLFAVWAA
Ga0126376_1113224813300010359Tropical Forest SoilMKATELLVACFALFGACLLWPLLAIANRPVLILGVPALALYLFAVWA
Ga0126378_1166280313300010361Tropical Forest SoilMRAAELVVACFLLFGACLVWPLLTIANRPGLILGVPVL
Ga0126378_1241104213300010361Tropical Forest SoilMKATELLVACFALFGACLLWPLLAIANRPVLVLGVPALA
Ga0126377_1089369733300010362Tropical Forest SoilMKATELLVACFALFGACLLWPLLAIANRPVLVLGVPALALYLFA
Ga0126381_10487434623300010376Tropical Forest SoilMKAPELLVACFALFGACLLWPLLAIANRPVLVLGVPALALYLF
Ga0136847_1166499213300010391Freshwater SedimentMKARELLAACFLLFGALLVWPLLTIANRPVLIWGVPALVLYLFAVWVAIVA
Ga0126383_1285540623300010398Tropical Forest SoilMKAAELVVACFLLFGACLVWPLLAIANRPILLLGVPALVLYIFAVWGAMV
Ga0126383_1303386013300010398Tropical Forest SoilVKGKGFLAACFVFFGGLLVWPLLTAANKQVLIAGIPALVL
Ga0134122_1247377123300010400Terrestrial SoilMKAAELLVACFLLFGACLVWPLLAIANHPVLVLGVPSLVLYLFAVWAA
Ga0137363_1155920813300012202Vadose Zone SoilMKARELLVACFALFGACLLWPLLAIANRPVVILGVPALVLYL
Ga0137370_1086029013300012285Vadose Zone SoilMKARELLAACFLFFGTLLLWPLLTIANRPVLIAGVPALALYLFTVWA
Ga0137366_1006579013300012354Vadose Zone SoilMKARELLAACFVLFGALLLWPLLTIANRPVLIWGVPALVLYLFAVW
Ga0157332_106236513300012511SoilMKARELLVACFALFGACLLWPLLAIANHPVLILGMPALVLYLLAVWVAI
Ga0137395_1035800013300012917Vadose Zone SoilMKARELLAACFFLFGALLIWPLLTIANRPVLVGGVPA
Ga0137359_1089058613300012923Vadose Zone SoilMKAAELVVACFLLFGTCLVWPLLAIANRPVLVAGVPALVLY
Ga0153915_1202427813300012931Freshwater WetlandsMKAREILAACFIFFGALLLWPLLTIANHLVLIGGVPA
Ga0126375_1040672013300012948Tropical Forest SoilMKATELLVACFALFGACLLWPLLAIANRPVLVLGVPALALYLFAVWAAIVVVLV
Ga0126369_1114318913300012971Tropical Forest SoilMKATELLVACFALFGACLLWPLLAIANRPVLVLGVPALALYLFTVWA
Ga0134076_1012644313300012976Grasslands SoilVRAKELLATCFVLFGALLVWPLLSIPNRLVLIAGVPA
Ga0164309_1072437933300012984SoilMKARELLVACFALFGACLLWPLLAIANRSVLILGVPALVLYLLAGERAA
Ga0157372_1141113723300013307Corn RhizosphereMKPLLAVCFGLFAALLVWPLLGIPNRPVLLAGIPALVLYLFAVWG
Ga0075302_117674623300014269Natural And Restored WetlandsMRARELLAACFLLFAALLLWPLLTIANRPVLIWGVPALVLYLF
Ga0157377_1143656913300014745Miscanthus RhizosphereMKAAELVVACFLLFGACLVWPLLAIANCPTLVFGVPP
Ga0180104_123548223300014884SoilMKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPALVL*
Ga0180093_118279113300015258SoilMERMVAGFLLFGACLVWPLLSIANRPVLFLGIPVMVLYLFG
Ga0132258_1071980213300015371Arabidopsis RhizosphereMKARELLVACFALFGACLLWPLLAIANHPVLILGMPALVLYL
Ga0132256_10133827013300015372Arabidopsis RhizosphereMKAAELVVACFVLFGACLVWPLLAIANRPVLVFGVPALVLYLFLV
Ga0187821_1004478713300017936Freshwater SedimentMKAAELVVACFLLFGACLVWPLLAIANRPALVAGVPALVLYLFVVWTGMVV
Ga0187777_1113636613300017974Tropical PeatlandMKAKELLAACFLLFGALLLPPLLTIANRPVLVAGVPALVLYLFGIWIA
Ga0184638_126826513300018052Groundwater SedimentMKAKELLAACFLLFGALLIWPLLTIANRPVLVGGVPALAVYLFTLWGIMVVVLV
Ga0184626_1035774313300018053Groundwater SedimentMKALLAVCFGLFAALLVWPLLGIPNRPVLLAGVPALVLYLFSVW
Ga0184612_1037839613300018078Groundwater SedimentVKALLAVCFGLFAALLVWPLLGIPNRPVLLGGIPALVLYLFAVWAAIVVVL
Ga0184612_1045821713300018078Groundwater SedimentMKALLAVCFGLFAALLVWPLLGIPNRPVLLGGIPALVLYLFAVWAAIVVVL
Ga0180116_125647613300019229Groundwater SedimentVRAKELLGACFVVFAALLVWPLLSIPNRPVLVAGLPALVLYLFV
Ga0187892_1024653233300019458Bio-OozeMKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPALVL
Ga0137408_102551613300019789Vadose Zone SoilVTAKELLATCFVLFGALLVWPLLSIPNRLVLIAGDWC
Ga0187768_115407423300020150Tropical PeatlandMRATELVVACFLLFGACLVWPLLAIANRPVLLLGVPAL
Ga0193719_1042316013300021344SoilMKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPALVLYLFS
Ga0247673_102984633300024224SoilMKAAELVVACFLLFGTCLVWPLLAIANRPVLVAGVPALVL
Ga0210113_101183923300025796Natural And Restored WetlandsMRSKSLLSVCFALFGALLVWPLLSIANRPVLVAGLPALVVYLF
Ga0207647_1043436133300025904Corn RhizosphereMKAAELLVACFLLFGACLVWPLLAIANHPVLVLGVPSLVLYLFAVW
Ga0207684_1054274513300025910Corn, Switchgrass And Miscanthus RhizosphereMKAAELVVACFLLFGACLVWPLLAIANRPVLVLGVPALVLYLFGLW
Ga0207660_1025654113300025917Corn RhizosphereMVASFLLFGACLVWPLLSIANRPVLFLGIPVMVLYLFGV
Ga0207701_1065122433300025930Corn, Switchgrass And Miscanthus RhizosphereMKATERIVAWFLLFGACLVWPLLSIANRPRLIAGVPALVLYLFAVWSAIVVV
Ga0207667_1149603413300025949Corn RhizosphereMKAAELVLACFLLFGACLVWPLLSIANRPVLILGV
Ga0207712_1060454113300025961Switchgrass RhizosphereMKAAELVVACFLLFGACLVWPLLAIANRPTLVFGVPPLVLYLFGL
Ga0207712_1173032123300025961Switchgrass RhizosphereMRAMERMVASFLLFGACLVWPLLSIANRPVLFLGIPVMVL
Ga0209438_108808933300026285Grasslands SoilMKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPALVLYLFSVWAAMVA
Ga0209055_118207313300026309SoilVKAKELLAACFVLLGALLVWPLLSIPNRAVLVAGVPAMVLYLFGVW
Ga0257173_103630923300026360SoilVTAKELLATCFVLFGALLVWPLLSIPNRLVLIAGVPALVVYL
Ga0257167_103429013300026376SoilMKARELLAACFFLFGALLIWPLLTIANRPVLVGGVPALV
Ga0257167_103685133300026376SoilMKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPALVLYLFAVWAAM
Ga0257169_100484933300026469SoilMKAAELVVACFLLFGTCLVWPLLAIANRPVLVAGVPALVLYLFA
Ga0257159_109529613300026494SoilMKARELLAACFLFFGTLLLWPLLTIANRPVLIAGV
Ga0257156_112170813300026498SoilMKARELLVACFLFFGTMLLWPLLTIANRPVLIAGVPALA
Ga0209157_101005463300026537SoilVRAKELLATCFVLFGALLVWPLLSIPNRLVLIAGVP
Ga0209329_110630713300027605Forest SoilMKAAELVVACFLLFGTCLVWPLLAIANRPVLVAGVPALVLYLFVV
Ga0209689_141110023300027748SoilMKAAELVVACFLLFGTCLVWPLLAIANRPVLVAGVPALVLYLFAVWTGMVVVLIA
Ga0268264_1012286113300028381Switchgrass RhizosphereMKAAELVVACFLLFGACLVWPLLAIANRPTLVFGVPPLVL
Ga0307311_1012433613300028716SoilMKAAELLVACFLLFGACLVWPLLAIANHPVLILGVP
Ga0307277_1044513823300028881SoilMKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPALVLYLF
Ga0308309_1028735133300028906SoilMKAAELVVACFLLFGACLVWPLLAIANRPVFILGVPALVMYLF
(restricted) Ga0255310_1019592323300031197Sandy SoilMKAAELLVACFLLFGACLVWPLLAIANHPVLVLGVPALVLYL
(restricted) Ga0255312_101682213300031248Sandy SoilMKAAELLVACFLLFGACLVWPLLAIANHPVLILGVPAL
Ga0307469_1120943513300031720Hardwood Forest SoilMKARELLVACFALFGACLLWPLLAIANHPVLILGMPALVLYLLAVWIAI
Ga0318546_1005285913300031771SoilMKAPELLVACFALFGACLLWPLLAIANRPVLVLGVPALALYLFAVWAGIVVVLI
Ga0307473_1157254713300031820Hardwood Forest SoilMKAAELVVACFLLFGACLVWPLLAIANRPVLILGVPALVM
Ga0318562_1037162623300032008SoilMKAPELLVACFALFGACLLWPLLAIANRPVLVLGVPALALYLFA
Ga0318575_1060044013300032055SoilMKAPELLVACFALFGACLLWPLLAIANRPVLVLVVPK
Ga0307415_10218790313300032126RhizosphereMNRGREGPGRAKDLLAACFVLLAALLVWPLLTIANRPVLIAGVPALVLYLFGVWAVI
Ga0315281_1100684233300032163SedimentMKARELLAACFLLFGALLVWPLLTIANRPVLIWGVPALVLYLFAVWAAIVAV
Ga0307472_10089991633300032205Hardwood Forest SoilMKAAELVVACFLLFATCLVWPLLAIANRPVLVAGVPALVLY
Ga0315287_1114866113300032397SedimentMKARELLAACFLLFGALLVWPLLTIANRPVLIWGVPALVLYLFAV
Ga0315287_1293810723300032397SedimentMKARELLAACFLFFGALLLWPLLTIANRPVLIGGVPALVLYLFA
Ga0315273_1148076413300032516SedimentMKARELLVACFLLFGALLVWPLLTIANRPVLIWGVPALVLYLFAVWAAI
Ga0310914_1059107423300033289SoilVKAKGFLGACFVLFGGLLVWPLLTAANKPVLIAGIPALVLYLFAVWAA
Ga0326726_1193864023300033433Peat SoilMKARELLAACFVLFGALLLWPLLTIANRPVLIAGVPALVL
Ga0310811_1070445533300033475SoilMKAAELVVACFLLFGACLVWPLLAIANRPVLVAGVPAL
Ga0316624_1038355833300033486SoilMKAAELVVACFLLFGACLVWPLLAIANRPALVAGVPALVLYLFAVWTAM
Ga0364924_006489_1622_17773300033811SedimentVTAKELLATCFVLFGALLVWPLLSIPNRLMLIAGVPALVLYLFAVRSGNGE
Ga0364926_009282_937_10923300033812SedimentVTAKELLATRFVLFGALLVWPLLSIPSRLMLIAGVPALVLYLFAVRSGNGE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.