Basic Information | |
---|---|
Family ID | F082275 |
Family Type | Metagenome |
Number of Sequences | 113 |
Average Sequence Length | 44 residues |
Representative Sequence | MHAAVLASNFYSVLAISVLFLHALFILWVVFGALLTRSRPILR |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 30.97 % |
% of genes near scaffold ends (potentially truncated) | 97.35 % |
% of genes from short scaffolds (< 2000 bps) | 90.27 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (80.531 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment (12.389 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.009 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.673 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF00817 | IMS | 29.20 |
PF11798 | IMS_HHH | 6.19 |
PF11799 | IMS_C | 6.19 |
PF10861 | DUF2784 | 3.54 |
PF00583 | Acetyltransf_1 | 3.54 |
PF13532 | 2OG-FeII_Oxy_2 | 2.65 |
PF00903 | Glyoxalase | 1.77 |
PF00588 | SpoU_methylase | 1.77 |
PF11154 | DUF2934 | 1.77 |
PF03916 | NrfD | 0.88 |
PF04945 | YHS | 0.88 |
PF06762 | LMF1 | 0.88 |
PF00916 | Sulfate_transp | 0.88 |
PF02518 | HATPase_c | 0.88 |
PF03682 | UPF0158 | 0.88 |
PF03928 | HbpS-like | 0.88 |
PF00950 | ABC-3 | 0.88 |
PF12833 | HTH_18 | 0.88 |
PF13495 | Phage_int_SAM_4 | 0.88 |
PF02195 | ParBc | 0.88 |
PF09335 | SNARE_assoc | 0.88 |
PF04986 | Y2_Tnp | 0.88 |
PF13466 | STAS_2 | 0.88 |
PF10677 | DUF2490 | 0.88 |
PF06439 | 3keto-disac_hyd | 0.88 |
PF00962 | A_deaminase | 0.88 |
PF03795 | YCII | 0.88 |
PF00196 | GerE | 0.88 |
PF08843 | AbiEii | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 29.20 |
COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 1.77 |
COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 1.77 |
COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 1.77 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.88 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 0.88 |
COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.88 |
COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.88 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.88 |
COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 0.88 |
COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.88 |
COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.88 |
COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.88 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 80.53 % |
Unclassified | root | N/A | 19.47 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_100820619 | All Organisms → cellular organisms → Bacteria | 8574 | Open in IMG/M |
3300000955|JGI1027J12803_106114922 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300001154|JGI12636J13339_1012342 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
3300003218|JGI26339J46600_10017385 | All Organisms → cellular organisms → Bacteria | 2088 | Open in IMG/M |
3300005172|Ga0066683_10207941 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300005179|Ga0066684_10940605 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
3300005332|Ga0066388_104388058 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300005450|Ga0066682_10022534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3588 | Open in IMG/M |
3300005537|Ga0070730_10899936 | Not Available | 554 | Open in IMG/M |
3300005542|Ga0070732_10308497 | Not Available | 950 | Open in IMG/M |
3300005557|Ga0066704_10815397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
3300005598|Ga0066706_10623343 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300005602|Ga0070762_11014710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300005764|Ga0066903_106055983 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300005764|Ga0066903_107192293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
3300005834|Ga0068851_10059781 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
3300006854|Ga0075425_103013131 | Not Available | 515 | Open in IMG/M |
3300007076|Ga0075435_101699324 | Not Available | 554 | Open in IMG/M |
3300009012|Ga0066710_101331380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1114 | Open in IMG/M |
3300009012|Ga0066710_101510098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1036 | Open in IMG/M |
3300009029|Ga0066793_10665602 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300009088|Ga0099830_10900236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
3300009143|Ga0099792_11146244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300009632|Ga0116102_1133993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
3300009641|Ga0116120_1096968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
3300010048|Ga0126373_10071055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3145 | Open in IMG/M |
3300010048|Ga0126373_10627095 | Not Available | 1129 | Open in IMG/M |
3300010048|Ga0126373_11373278 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300010335|Ga0134063_10267753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
3300010335|Ga0134063_10658579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
3300010339|Ga0074046_10684155 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300010376|Ga0126381_101203677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1095 | Open in IMG/M |
3300010376|Ga0126381_103918992 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300012096|Ga0137389_10204670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1645 | Open in IMG/M |
3300012096|Ga0137389_10627200 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300012201|Ga0137365_10501942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
3300012202|Ga0137363_11562832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300012211|Ga0137377_10504431 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300012971|Ga0126369_12949309 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300014150|Ga0134081_10206293 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300014494|Ga0182017_10060960 | All Organisms → cellular organisms → Bacteria | 2502 | Open in IMG/M |
3300016270|Ga0182036_10089442 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
3300016294|Ga0182041_11869789 | Not Available | 557 | Open in IMG/M |
3300016294|Ga0182041_12021335 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300016341|Ga0182035_11592956 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300016422|Ga0182039_10712011 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300016422|Ga0182039_11309169 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300017823|Ga0187818_10063174 | Not Available | 1594 | Open in IMG/M |
3300017823|Ga0187818_10200690 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300017928|Ga0187806_1254126 | Not Available | 609 | Open in IMG/M |
3300017932|Ga0187814_10254552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
3300017934|Ga0187803_10425600 | Not Available | 540 | Open in IMG/M |
3300017942|Ga0187808_10485664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
3300017946|Ga0187879_10573116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
3300017955|Ga0187817_11111981 | Not Available | 507 | Open in IMG/M |
3300017995|Ga0187816_10130589 | Not Available | 1083 | Open in IMG/M |
3300017995|Ga0187816_10236614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 796 | Open in IMG/M |
3300017995|Ga0187816_10376155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 629 | Open in IMG/M |
3300017995|Ga0187816_10458044 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300018001|Ga0187815_10106364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 1184 | Open in IMG/M |
3300018003|Ga0187876_1242627 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300018006|Ga0187804_10322193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
3300018007|Ga0187805_10433193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
3300018088|Ga0187771_10892513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 754 | Open in IMG/M |
3300018433|Ga0066667_10731608 | Not Available | 833 | Open in IMG/M |
3300018482|Ga0066669_10774829 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300020170|Ga0179594_10045304 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
3300020583|Ga0210401_10829730 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300021168|Ga0210406_10400478 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300021479|Ga0210410_10269745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1527 | Open in IMG/M |
3300021560|Ga0126371_10799427 | Not Available | 1089 | Open in IMG/M |
3300024330|Ga0137417_1219288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 611 | Open in IMG/M |
3300025501|Ga0208563_1087698 | Not Available | 611 | Open in IMG/M |
3300025509|Ga0208848_1041980 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300025910|Ga0207684_10460163 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
3300025916|Ga0207663_10395683 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
3300026528|Ga0209378_1073437 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
3300026542|Ga0209805_1150919 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300026548|Ga0209161_10041830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3066 | Open in IMG/M |
3300027050|Ga0209325_1022514 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300027376|Ga0209004_1044329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
3300027846|Ga0209180_10715680 | Not Available | 543 | Open in IMG/M |
3300027862|Ga0209701_10652191 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300027875|Ga0209283_10856836 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300028017|Ga0265356_1035674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
3300029913|Ga0311362_10265552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1843 | Open in IMG/M |
3300030494|Ga0310037_10145596 | Not Available | 1077 | Open in IMG/M |
3300031231|Ga0170824_107457439 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300031545|Ga0318541_10346456 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300031681|Ga0318572_10477787 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300031708|Ga0310686_107204656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4042 | Open in IMG/M |
3300031708|Ga0310686_110334038 | All Organisms → cellular organisms → Bacteria | 2553 | Open in IMG/M |
3300031708|Ga0310686_115143391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
3300031781|Ga0318547_10823296 | Not Available | 579 | Open in IMG/M |
3300031820|Ga0307473_10481627 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300031823|Ga0307478_10613291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 910 | Open in IMG/M |
3300031823|Ga0307478_11600211 | Not Available | 538 | Open in IMG/M |
3300031845|Ga0318511_10630733 | Not Available | 501 | Open in IMG/M |
3300031910|Ga0306923_11175254 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300031945|Ga0310913_10618930 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300031962|Ga0307479_10103822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2764 | Open in IMG/M |
3300031962|Ga0307479_11530608 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300031962|Ga0307479_12167935 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300031962|Ga0307479_12168126 | Not Available | 503 | Open in IMG/M |
3300032025|Ga0318507_10522899 | Not Available | 516 | Open in IMG/M |
3300032039|Ga0318559_10554043 | Not Available | 536 | Open in IMG/M |
3300032174|Ga0307470_10472751 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300032180|Ga0307471_102402408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
3300032893|Ga0335069_10006932 | All Organisms → cellular organisms → Bacteria | 16414 | Open in IMG/M |
3300032895|Ga0335074_11171572 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 162 | 652 | Open in IMG/M |
3300033158|Ga0335077_10546627 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
3300033402|Ga0326728_10744537 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300033755|Ga0371489_0427489 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 12.39% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.85% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.19% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.54% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.65% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.65% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.65% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.77% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.77% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.77% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.89% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.89% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.89% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1008206191 | 3300000364 | Soil | MQAASSLYSSFATLVLFLHALFIVWVVFGAWATRSRPVLRWLHIVSLVWGILTEL |
JGI1027J12803_1061149222 | 3300000955 | Soil | LMMHAAVLAQNFYSALAICVLLLHALYILWVVFGALLTRSR |
JGI12636J13339_10123421 | 3300001154 | Forest Soil | MHAAVLVSSLYSALAAAVLFLHALFILWVVFGALLTR |
JGI26339J46600_100173853 | 3300003218 | Bog Forest Soil | MQAAVLAPNFYSALAIVVLFLHALFILWVVFGALLPRSRPILRWLHVGSLIWES* |
Ga0066683_102079413 | 3300005172 | Soil | MVAVVLTTDTYSALATSVLVVHGLFILWVIFGAFLARSRPILRWLHIA |
Ga0066684_109406051 | 3300005179 | Soil | MDAVLLASNFYSALATAVLFLHGLFILWVIFGALLVRSRPILR |
Ga0066388_1043880581 | 3300005332 | Tropical Forest Soil | MRPVVAGGFYSVLATFVLVTHALFIFWVVFGAVVARSRPSLRRLHIASL |
Ga0066682_100225346 | 3300005450 | Soil | MGVNHFFSALAISVLFLHALFILWVIFGTLLTRSRPILRWLHIVSLVW |
Ga0070730_108999362 | 3300005537 | Surface Soil | MHTSPNLYSALATAVLFVHALFIVWVVFGAVVTRSRP |
Ga0070732_103084971 | 3300005542 | Surface Soil | MFAALVVSNFYSGLATAVLFLHGLFIFWVIFGALL |
Ga0066704_108153971 | 3300005557 | Soil | MRAAVMANFYSGLAVCILFLHALFILFFGALLTRSRPVLRWLHI |
Ga0066706_106233431 | 3300005598 | Soil | MFTAAIAPNVYSGLAACVLFLHMLFILWVVFGALLTVSRPILRWLHIV |
Ga0070762_110147102 | 3300005602 | Soil | MSAAVLVVNVYSGLAVCVLLLHALFIVWVVFGALFTRSR |
Ga0066903_1060559832 | 3300005764 | Tropical Forest Soil | MHAAPLYYALATAVLFLHALFIVWVVSGALVTRSRPVL |
Ga0066903_1071922931 | 3300005764 | Tropical Forest Soil | MHLAIRIPGVYSALAVAVLVVHALFIVWVVFGAFIARSRPWLQWLHIASL |
Ga0068851_100597814 | 3300005834 | Corn Rhizosphere | MQADPSLYSALAMFVLLVHALFILWIVFGVVLTRSRPVLRSLHIASLVWGVL |
Ga0075425_1030131312 | 3300006854 | Populus Rhizosphere | MHTAPNLYSALATAVLFLHALFIVWVVFGAVVTRSRPILR |
Ga0075435_1016993241 | 3300007076 | Populus Rhizosphere | VHTAPNLSSALATAVLFLHALFIVWVAFGAVVTRSRR |
Ga0066710_1013313801 | 3300009012 | Grasslands Soil | MVAVVLTTDTYSALATSVLVVHGLFILWVIFGAYLARSRPILRWLHI |
Ga0066710_1015100981 | 3300009012 | Grasslands Soil | MHARSFYSLLAVTVLIVHALFILWVVFGAFVTRSRPILR |
Ga0066793_106656021 | 3300009029 | Prmafrost Soil | VHTAVLASNFYFALAISVLFLHALFILWVVFGALLTRSRPILRWLHVCS |
Ga0099830_109002362 | 3300009088 | Vadose Zone Soil | MHAASALVASDFYSALATVILLLHALFILWVIFGTLLT |
Ga0099792_111462441 | 3300009143 | Vadose Zone Soil | MHAAVLASNFYSVLAISVLFLHVLFILWVVFGALLTRSRPILRWLHIA |
Ga0116102_11339931 | 3300009632 | Peatland | MRAVVSTHGVYAVLAVFVLFVHALFILWVVFGALLARSRPILRWLHIG |
Ga0116120_10969681 | 3300009641 | Peatland | MHAASAFVASDFYSALATAVLFLHAMFILWVVFGALLT |
Ga0126373_100710554 | 3300010048 | Tropical Forest Soil | MYAVVPTSNFYSVLATAVLFLHALFIVWVIFGALLTRSRPILRWLHI |
Ga0126373_106270951 | 3300010048 | Tropical Forest Soil | MYAVLLASNFYSVLATAVLFLHALFIVWVIFGALLTRSRPILRWLHI |
Ga0126373_113732781 | 3300010048 | Tropical Forest Soil | MHVAPNLYSALATVVLFLHALFIMWVVFGAVLTRS |
Ga0134063_102677531 | 3300010335 | Grasslands Soil | MHARSFYSLLAVTVLIVHALFILWVVFGAFVTRSRPILRWLHVGSLI |
Ga0134063_106585791 | 3300010335 | Grasslands Soil | MYAVLLASNFYSALATAVLFLHGLFILWVIFGALLVRGRPMLRWLHIAS |
Ga0074046_106841551 | 3300010339 | Bog Forest Soil | MHAVVLAPNFYSALAVSVLLLHALYILWVVFGALLTRSRPILRW |
Ga0126381_1012036771 | 3300010376 | Tropical Forest Soil | MYAVLLASNFYSVLATAVLFLHALFIVWVIFGALLTRSRPILRWLHIASL |
Ga0126381_1039189922 | 3300010376 | Tropical Forest Soil | VPANIYSALATAVLFVHALFIAWVVLGVLFARSRPVLRWLHIISLIWG |
Ga0137389_102046701 | 3300012096 | Vadose Zone Soil | MYAVLLASNFYSALATAVLFLHGLFILWVIFGALLVRSRPILRWLHIA |
Ga0137389_106272001 | 3300012096 | Vadose Zone Soil | MHAAVLASSLYSALAISILFLHALFILWVVFGALLTRS |
Ga0137365_105019421 | 3300012201 | Vadose Zone Soil | MFAVVLTRDTYSALATSVLAVHGLFIVWVIFGAFLARSRPILRRL |
Ga0137363_115628321 | 3300012202 | Vadose Zone Soil | MFTAAIAPNVYSGLAACVLFLHMLFILWVVFGALLTLSRPVLRWLHI |
Ga0137377_105044311 | 3300012211 | Vadose Zone Soil | MANFYSGLAVCMLFLHALFILWVVFGALLIRSRPVLRWL |
Ga0126369_129493092 | 3300012971 | Tropical Forest Soil | MAVIVSGEFYKALATLVLFVHILFIVWVVLGALLTRSRP |
Ga0134081_102062931 | 3300014150 | Grasslands Soil | MDAVLLASNFYSALATAVLFLHGLFILWVIFGALLVRSRPILRWLHIAS |
Ga0182017_100609601 | 3300014494 | Fen | MMHAAVLAFNFYSALATSVLFLHALFILWVVFGALLTRSRPI |
Ga0182036_100894424 | 3300016270 | Soil | MHAAILVSNIYSALAIFVLFLHTLFIVWVIFGALLTRS |
Ga0182041_118697892 | 3300016294 | Soil | MHAAILVSNIYSALAIFVLFLHTLFIVLVIFGALLTRSHPILRWLH |
Ga0182041_120213352 | 3300016294 | Soil | MHAVVIASNAYATLAISVLFLHAPFILWVVFGAFLTRSRPILRWLHI |
Ga0182035_115929561 | 3300016341 | Soil | MHAVILASSIYSALAISVLVLHALFILLVIFGALPTRQRLMLRWLHI |
Ga0182039_107120111 | 3300016422 | Soil | MHAAVLVSNIYSALAIFVLFLHTRFVLWVIFGALLTRSQPILRW |
Ga0182039_113091691 | 3300016422 | Soil | VFAIILGSNIYAGLAAGVLFLHALFVLWVVAGALLTRSRPVLRWVHI |
Ga0187818_100631741 | 3300017823 | Freshwater Sediment | MHAASSFYSALAVSVLFVHALFILWVIFGALLTRSRPILRWLHIAS |
Ga0187818_102006901 | 3300017823 | Freshwater Sediment | MQAASSLYSALAILVLLLHALFILWVVLGALVTRSRPVLRWLHIASL |
Ga0187806_12541261 | 3300017928 | Freshwater Sediment | MHAASGFVASDFYSALATAILFLHALFILWVIFGALLTRSRPLLRW |
Ga0187814_102545521 | 3300017932 | Freshwater Sediment | MHAASAFVASDFYSALATAVLFLHALFILWVVFGAL |
Ga0187803_104256001 | 3300017934 | Freshwater Sediment | MQAASSLYSALAILVLLLHALFILWVVFGALVTRS |
Ga0187808_104856641 | 3300017942 | Freshwater Sediment | MHAASAFVASGFYSALAIAVLFLHALFILWLIFGALLTRSRPLLRGLHIASLVWGILI |
Ga0187879_105731161 | 3300017946 | Peatland | MQATLVAANFCSGLAVCVLFLHALFIVWVVFGAVLTRSRPILRWLHMVS |
Ga0187817_111119811 | 3300017955 | Freshwater Sediment | MHAAVLASSFYSELAIFVLFLHALFILWVVFGALLTRSRPILR |
Ga0187816_101305891 | 3300017995 | Freshwater Sediment | MHAAVVASNFYSALATCVLLLHALFILWVIFGALL |
Ga0187816_102366141 | 3300017995 | Freshwater Sediment | MHAAVLASSFYSALAISVLFLHALFILWVVLGSLLTRSRPILRWLHVGSLVWG |
Ga0187816_103761552 | 3300017995 | Freshwater Sediment | MHADSTFGASGFYSALATAILFLHALFILWVIFGALLTRSRPLLRWLHIAS |
Ga0187816_104580441 | 3300017995 | Freshwater Sediment | MQAAVLAPNFYSALAIVVLFLHALFILWVVFGALLTRLRPVL |
Ga0187815_101063643 | 3300018001 | Freshwater Sediment | MHAAVLASSFYSALATSVLFLHALFTLWVVSGALLTRSRPILRWLHIASLVWGILTE |
Ga0187876_12426272 | 3300018003 | Peatland | VATLALNFYSVLAISVLFLHALFILWVVFGALLTRSRPI |
Ga0187804_103221931 | 3300018006 | Freshwater Sediment | MHAASVFVASDFYSALATAILLLHALFILWVIFGAL |
Ga0187805_104331932 | 3300018007 | Freshwater Sediment | MHAAVVASNFYSALATCVLFLHALFILWVIFGALLTRSGHIL |
Ga0187771_108925132 | 3300018088 | Tropical Peatland | MHVAPSIYAALATFVLFLHALFIVWVAFGAFLTRSR |
Ga0066667_107316082 | 3300018433 | Grasslands Soil | MTANSSGIYIELADVVLFLHAVFIAWMSFGALLTRSHPLLRRLHIASLIWG |
Ga0066669_107748292 | 3300018482 | Grasslands Soil | VHAAFAVIGVYSHLAIVVLILHALFILWVVFGALLTGHRPILRRLHIAS |
Ga0179594_100453041 | 3300020170 | Vadose Zone Soil | PGTGPFAAVARFVLSLHALFILWVVFGALLTRFRPILRWLHIASLI |
Ga0210401_108297302 | 3300020583 | Soil | MHTAPNLYSALATAVLFLHALFIVWVVFGAVFTCSR |
Ga0210406_104004782 | 3300021168 | Soil | MHVTSNLYSALTILVLLLHALFILWVVFGALVTRS |
Ga0210410_102697451 | 3300021479 | Soil | MHAATAFGASDFCSALATAILLLHALFILWVIFGACGRHTET |
Ga0126371_107994271 | 3300021560 | Tropical Forest Soil | MHAVLLASHFYSVLATAVLFLHALFIVWVIFGALLTR |
Ga0137417_12192882 | 3300024330 | Vadose Zone Soil | PFAAVARFVLLLHALFILWVVFGALLTRFRPILRWLHIASLI |
Ga0208563_10876981 | 3300025501 | Peatland | MRAAVFASDFYSALATAVLFLHALFILWVVFGAWLTRSRPVLR |
Ga0208848_10419801 | 3300025509 | Arctic Peat Soil | MQAVVLAPTFYSALAVSVLLLHALYILWVVFGALLTRS |
Ga0207684_104601631 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MHAAFLASDFYSALATAVLFLHALFILWVVFGAFLAHSRLILRWLLGSF |
Ga0207663_103956832 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MHAGPNLYSALATAVLFLHALFIVWVVFGAVLTRFRPIFRGLHII |
Ga0209378_10734371 | 3300026528 | Soil | MHAASSFHSALAIFVLFLHALFILWVVFGALLTRSRTVLRWLHIASLVWGILT |
Ga0209805_11509192 | 3300026542 | Soil | MCTVLLASNFYAALAIAVLFLHGLFILWVIFGAFLVRARPMFRW |
Ga0209161_100418306 | 3300026548 | Soil | MHARSFYSLLAVTVLIVHALFILWVVFGAFVTRSRPILRW |
Ga0209325_10225141 | 3300027050 | Forest Soil | MGVVLASNLYSALASVVLILHALFIVWVVFGALLTRGRLTLRWLHVV |
Ga0209004_10443292 | 3300027376 | Forest Soil | MQAASSLDSALAILVLFLHALFILWVIFGAFLARSRP |
Ga0209180_107156802 | 3300027846 | Vadose Zone Soil | MYAVLLASNFYSALATAVLFLHGLFIFWVIFGTLLVR |
Ga0209701_106521912 | 3300027862 | Vadose Zone Soil | MHAAVLGPTFYSALAVCVLFLHALFILWVVFGALLTRSRPILRWMH |
Ga0209283_108568362 | 3300027875 | Vadose Zone Soil | MHAAFVASNFYSALATAVLFLHALFILWVVFGAFLAHSRLILRWLLGS |
Ga0265356_10356742 | 3300028017 | Rhizosphere | MQAASGLYSSVAILVLFLHALFILWVVFGALVTPSQPVLRWLHIASLVWGG |
Ga0311362_102655523 | 3300029913 | Bog | MRACVLASNIYSALAISVLFLHALFILWVVFGALLTHSRPILRWLHVGSLV |
Ga0310037_101455961 | 3300030494 | Peatlands Soil | MHAAVVASNFYSALATCVLFLHALFILWVIFGALLTRSGQILRWLHI |
Ga0170824_1074574391 | 3300031231 | Forest Soil | MHAAVLASNFYSALAISVLLLHALYILWVVFGALLTRSRPMLR |
Ga0318541_103464561 | 3300031545 | Soil | MHAAILVSNIYSALAIFVLFLHTLFIVWVIFGALLTRSHPILRGLHISSV |
Ga0318572_104777872 | 3300031681 | Soil | MHAAVLVSNIYSALAIFVLFLHTLFIVWVIFGALLTRSRPVLRWLH |
Ga0310686_1072046566 | 3300031708 | Soil | MLGMQAASTFYSALAIFVLFLHALFILWVVFGALLTRSRPVLRWLHI |
Ga0310686_1103340385 | 3300031708 | Soil | MPAASTFYSALAIFVLFLHALFILWVVFGALLTRSRPVLRWLHI |
Ga0310686_1151433911 | 3300031708 | Soil | MHAASAFVASDFYSALATAVLFLHALFILWVVFGALLTRSRPVL |
Ga0318547_108232962 | 3300031781 | Soil | MHAAVLVSNIYSALAIFVLFLHTLFIVWVIFGALLTRSRPVLRWLHISSLVWGVLT |
Ga0307473_104816272 | 3300031820 | Hardwood Forest Soil | MHAAVLASSLYSALAISVLLLHALFILWVVFGALVTR |
Ga0307478_106132911 | 3300031823 | Hardwood Forest Soil | MHVAPNVYSALASAVLFLHALFIVWVVFGALLTRSRPILRWL |
Ga0307478_116002111 | 3300031823 | Hardwood Forest Soil | MDTTPNLYSALATAVLFLHALFIVWVVFGAVFTRSRPILRWLH |
Ga0318511_106307331 | 3300031845 | Soil | MHAAVLVSNIYSALAIFVLFLHTLFIVWVIFGALLTRSRPVLRWLHI |
Ga0306923_111752541 | 3300031910 | Soil | MHAVILASSIYSALAISVLVLHALFILLVIFGALPTRQRLMLRWLHISCLVWRILRDLLR |
Ga0310913_106189302 | 3300031945 | Soil | MHAAILVSNIYSALAIFVLFLHTLFIVWVIFGALLTRSHP |
Ga0307479_101038221 | 3300031962 | Hardwood Forest Soil | MYAVLLAPNFYSALATTVLFLHGLFIFWVIFGALLVRSR |
Ga0307479_115306082 | 3300031962 | Hardwood Forest Soil | MQAASTLYSGLATFVLFLHALFILWVVFGALVTHS |
Ga0307479_121679351 | 3300031962 | Hardwood Forest Soil | MQAASSLYSSFATLVLFPHALFIVWVVFGSWVTGLRPVLRWQHVVSLVW |
Ga0307479_121681262 | 3300031962 | Hardwood Forest Soil | MQAALSLYSALAIFVLCLHALFILWVVFGAFLTRWRSVLRWLHIASLV |
Ga0318507_105228991 | 3300032025 | Soil | MHAAVLVSNIYSALAIFVLFLHTLFIVWVIFGALLTRSRPVLR |
Ga0318559_105540431 | 3300032039 | Soil | MHAAVLVSNIYSALAIFVLFLHTLFIVWVIFGALLTRSHPILRWLHI |
Ga0307470_104727512 | 3300032174 | Hardwood Forest Soil | MHTAPNLYSDLATAVLFLHALFIVWVVFGAVFTTSRPIQRWLHIVSL |
Ga0307471_1024024082 | 3300032180 | Hardwood Forest Soil | MHAASAFVVSGFYSALAIAVLLHALFILWVIFGALLTRSRPVLRWLHIG |
Ga0335069_1000693212 | 3300032893 | Soil | MHAAVLASNFYSVLAISVLFLHALFILWVVFGALLTRSRPILR |
Ga0335074_111715722 | 3300032895 | Soil | MHVAVIASNFYSGLAASVLCLHALFILWVIFGALLTRSRPLLRWLHIA |
Ga0335077_105466272 | 3300033158 | Soil | MYAGLLASNFYSALATAVLFLHGLFILWVIFGALLVRSRPLL |
Ga0326728_107445373 | 3300033402 | Peat Soil | MHVATLALNFYSVLAISVLFLHALFILWVVFGALLTRSRPILRWLHVGSL |
Ga0371489_0427489_477_602 | 3300033755 | Peat Soil | MHAVVIASNIYSALAISVLFLHALFIPWVVFGALLTRSRPIL |
⦗Top⦘ |