| Basic Information | |
|---|---|
| Family ID | F082244 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MRPAMHHLSISAIRADALFVSALQRGDHPSAKEVRQAVAAAV |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.43 % |
| % of genes near scaffold ends (potentially truncated) | 90.27 % |
| % of genes from short scaffolds (< 2000 bps) | 80.53 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.292 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.549 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.434 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.903 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.43% β-sheet: 0.00% Coil/Unstructured: 58.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF05685 | Uma2 | 4.42 |
| PF02661 | Fic | 4.42 |
| PF04909 | Amidohydro_2 | 3.54 |
| PF00561 | Abhydrolase_1 | 3.54 |
| PF01833 | TIG | 1.77 |
| PF13460 | NAD_binding_10 | 1.77 |
| PF01381 | HTH_3 | 1.77 |
| PF00202 | Aminotran_3 | 1.77 |
| PF00378 | ECH_1 | 0.88 |
| PF03466 | LysR_substrate | 0.88 |
| PF00005 | ABC_tran | 0.88 |
| PF13006 | Nterm_IS4 | 0.88 |
| PF04978 | DUF664 | 0.88 |
| PF07746 | LigA | 0.88 |
| PF04672 | Methyltransf_19 | 0.88 |
| PF00480 | ROK | 0.88 |
| PF04715 | Anth_synt_I_N | 0.88 |
| PF11716 | MDMPI_N | 0.88 |
| PF08241 | Methyltransf_11 | 0.88 |
| PF08044 | DUF1707 | 0.88 |
| PF07905 | PucR | 0.88 |
| PF00872 | Transposase_mut | 0.88 |
| PF01494 | FAD_binding_3 | 0.88 |
| PF13302 | Acetyltransf_3 | 0.88 |
| PF00440 | TetR_N | 0.88 |
| PF00903 | Glyoxalase | 0.88 |
| PF12680 | SnoaL_2 | 0.88 |
| PF00078 | RVT_1 | 0.88 |
| PF12802 | MarR_2 | 0.88 |
| PF05016 | ParE_toxin | 0.88 |
| PF16912 | Glu_dehyd_C | 0.88 |
| PF00106 | adh_short | 0.88 |
| PF00072 | Response_reg | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 4.42 |
| COG0147 | Anthranilate/para-aminobenzoate synthases component I | Amino acid transport and metabolism [E] | 1.77 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.77 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.77 |
| COG2508 | DNA-binding transcriptional regulator, PucR/PutR family | Transcription [K] | 1.77 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.88 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.88 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.88 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.29 % |
| Unclassified | root | N/A | 40.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003505|JGIcombinedJ51221_10179370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 858 | Open in IMG/M |
| 3300004080|Ga0062385_10494855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 753 | Open in IMG/M |
| 3300005168|Ga0066809_10177291 | Not Available | 566 | Open in IMG/M |
| 3300005602|Ga0070762_10093106 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| 3300005764|Ga0066903_102677367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 967 | Open in IMG/M |
| 3300005944|Ga0066788_10087705 | Not Available | 762 | Open in IMG/M |
| 3300005995|Ga0066790_10322500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → unclassified Actinoplanes → Actinoplanes sp. SE50/110 | 659 | Open in IMG/M |
| 3300006893|Ga0073928_10717730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 696 | Open in IMG/M |
| 3300010046|Ga0126384_10725012 | Not Available | 883 | Open in IMG/M |
| 3300010366|Ga0126379_12948531 | Not Available | 569 | Open in IMG/M |
| 3300010376|Ga0126381_103843802 | Not Available | 586 | Open in IMG/M |
| 3300011107|Ga0151490_1384157 | Not Available | 506 | Open in IMG/M |
| 3300011270|Ga0137391_11335603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| 3300012198|Ga0137364_10495588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 918 | Open in IMG/M |
| 3300012201|Ga0137365_11309128 | Not Available | 514 | Open in IMG/M |
| 3300012207|Ga0137381_10936890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 748 | Open in IMG/M |
| 3300012208|Ga0137376_10261451 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300012357|Ga0137384_10188679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1726 | Open in IMG/M |
| 3300013105|Ga0157369_12453327 | Not Available | 528 | Open in IMG/M |
| 3300014657|Ga0181522_10036508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2733 | Open in IMG/M |
| 3300014838|Ga0182030_10570803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1102 | Open in IMG/M |
| 3300015373|Ga0132257_102518143 | Not Available | 669 | Open in IMG/M |
| 3300016294|Ga0182041_11060786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 734 | Open in IMG/M |
| 3300016319|Ga0182033_10306743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1312 | Open in IMG/M |
| 3300016319|Ga0182033_10719914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 875 | Open in IMG/M |
| 3300016422|Ga0182039_11222290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
| 3300016445|Ga0182038_10382974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1174 | Open in IMG/M |
| 3300017926|Ga0187807_1234245 | Not Available | 600 | Open in IMG/M |
| 3300017928|Ga0187806_1194610 | Not Available | 685 | Open in IMG/M |
| 3300017928|Ga0187806_1221035 | Not Available | 648 | Open in IMG/M |
| 3300017955|Ga0187817_10643485 | Not Available | 676 | Open in IMG/M |
| 3300017966|Ga0187776_10049172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2395 | Open in IMG/M |
| 3300017966|Ga0187776_10412299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 906 | Open in IMG/M |
| 3300017972|Ga0187781_11089670 | Not Available | 586 | Open in IMG/M |
| 3300018060|Ga0187765_10983027 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300018060|Ga0187765_10998744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
| 3300018086|Ga0187769_11419978 | Not Available | 525 | Open in IMG/M |
| 3300018089|Ga0187774_10895607 | Not Available | 609 | Open in IMG/M |
| 3300020583|Ga0210401_11010246 | Not Available | 690 | Open in IMG/M |
| 3300021180|Ga0210396_10036009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4568 | Open in IMG/M |
| 3300021181|Ga0210388_11635149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300021404|Ga0210389_10386280 | Not Available | 1100 | Open in IMG/M |
| 3300021433|Ga0210391_10371948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1121 | Open in IMG/M |
| 3300021433|Ga0210391_10791400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 741 | Open in IMG/M |
| 3300025473|Ga0208190_1071728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 700 | Open in IMG/M |
| 3300025885|Ga0207653_10212147 | Not Available | 733 | Open in IMG/M |
| 3300025915|Ga0207693_10124908 | Not Available | 2022 | Open in IMG/M |
| 3300025916|Ga0207663_10996944 | Not Available | 672 | Open in IMG/M |
| 3300025916|Ga0207663_11327801 | Not Available | 579 | Open in IMG/M |
| 3300025929|Ga0207664_10534310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1051 | Open in IMG/M |
| 3300026489|Ga0257160_1069288 | Not Available | 622 | Open in IMG/M |
| 3300027829|Ga0209773_10406464 | Not Available | 564 | Open in IMG/M |
| 3300027829|Ga0209773_10446924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 534 | Open in IMG/M |
| 3300027862|Ga0209701_10602839 | Not Available | 582 | Open in IMG/M |
| 3300027905|Ga0209415_10989757 | Not Available | 561 | Open in IMG/M |
| 3300028775|Ga0302231_10410807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300028776|Ga0302303_10113855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 981 | Open in IMG/M |
| 3300028789|Ga0302232_10003091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11279 | Open in IMG/M |
| 3300028789|Ga0302232_10415450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 661 | Open in IMG/M |
| 3300028808|Ga0302228_10020985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3359 | Open in IMG/M |
| 3300028877|Ga0302235_10488691 | Not Available | 523 | Open in IMG/M |
| 3300028879|Ga0302229_10041848 | All Organisms → cellular organisms → Bacteria | 2327 | Open in IMG/M |
| 3300028879|Ga0302229_10113924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → Nitriliruptoraceae → Nitriliruptor → Nitriliruptor alkaliphilus | 1271 | Open in IMG/M |
| 3300029882|Ga0311368_10262710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1327 | Open in IMG/M |
| 3300029910|Ga0311369_10300850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1432 | Open in IMG/M |
| 3300029910|Ga0311369_10642420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB23 | 879 | Open in IMG/M |
| 3300029951|Ga0311371_10831104 | Not Available | 1131 | Open in IMG/M |
| 3300030053|Ga0302177_10436351 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300030503|Ga0311370_10053197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5945 | Open in IMG/M |
| 3300030586|Ga0265393_1182562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300030617|Ga0311356_10008811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11264 | Open in IMG/M |
| 3300030617|Ga0311356_11107969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 733 | Open in IMG/M |
| 3300030618|Ga0311354_10586650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1085 | Open in IMG/M |
| 3300031028|Ga0302180_10062058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2221 | Open in IMG/M |
| 3300031233|Ga0302307_10026358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3221 | Open in IMG/M |
| 3300031233|Ga0302307_10383867 | Not Available | 715 | Open in IMG/M |
| 3300031234|Ga0302325_10676005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1495 | Open in IMG/M |
| 3300031234|Ga0302325_10724310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1425 | Open in IMG/M |
| 3300031525|Ga0302326_10828266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1328 | Open in IMG/M |
| 3300031525|Ga0302326_12521742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 644 | Open in IMG/M |
| 3300031640|Ga0318555_10346221 | Not Available | 805 | Open in IMG/M |
| 3300031682|Ga0318560_10078812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1676 | Open in IMG/M |
| 3300031715|Ga0307476_10997642 | Not Available | 617 | Open in IMG/M |
| 3300031748|Ga0318492_10584735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 595 | Open in IMG/M |
| 3300031768|Ga0318509_10146611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1300 | Open in IMG/M |
| 3300031768|Ga0318509_10702654 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300031770|Ga0318521_10402046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 816 | Open in IMG/M |
| 3300031771|Ga0318546_10869448 | Not Available | 635 | Open in IMG/M |
| 3300031771|Ga0318546_10991053 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031795|Ga0318557_10564128 | Not Available | 522 | Open in IMG/M |
| 3300031799|Ga0318565_10553145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300031805|Ga0318497_10164747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1218 | Open in IMG/M |
| 3300031805|Ga0318497_10866249 | Not Available | 507 | Open in IMG/M |
| 3300031845|Ga0318511_10092891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1275 | Open in IMG/M |
| 3300031845|Ga0318511_10483317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300031959|Ga0318530_10461953 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300032009|Ga0318563_10220161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1024 | Open in IMG/M |
| 3300032043|Ga0318556_10156375 | Not Available | 1178 | Open in IMG/M |
| 3300032063|Ga0318504_10651873 | Not Available | 506 | Open in IMG/M |
| 3300032174|Ga0307470_10160493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1388 | Open in IMG/M |
| 3300032770|Ga0335085_10174483 | All Organisms → cellular organisms → Bacteria | 2663 | Open in IMG/M |
| 3300032828|Ga0335080_10026894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6261 | Open in IMG/M |
| 3300033158|Ga0335077_10079827 | Not Available | 3886 | Open in IMG/M |
| 3300033290|Ga0318519_10757952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300034124|Ga0370483_0260992 | Not Available | 594 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 21.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.19% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.19% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.89% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.89% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.89% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.89% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030586 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ51221_101793702 | 3300003505 | Forest Soil | MRPAMHHLSIGAIRADALFVSALQRGDRPSAKEVRRAVAAAVEAFGQRGCVERV |
| Ga0062385_104948552 | 3300004080 | Bog Forest Soil | MRPAMDHLSISVIRADALFVSALQRGDHPGARQVRQAVAAAVGAFGP |
| Ga0066809_101772912 | 3300005168 | Soil | MRPAMHHLSISAARADALFVSALQRSEELSTGQVWQAVAAAVRAFGSRGCAER |
| Ga0070762_100931063 | 3300005602 | Soil | MRPAMDHLSVSAIRADALFASALQRGDHPGAKEVRQAVAAAVGAFG |
| Ga0066903_1026773673 | 3300005764 | Tropical Forest Soil | MRPAIHHLSISAVGADALFVSVLQRSEEPSAGQVRQ |
| Ga0066788_100877051 | 3300005944 | Soil | MRPAMHHLSIGAIRADALFVSALQRGDHPSAKEVRQAVAAAVEAFGQRG |
| Ga0066790_103225001 | 3300005995 | Soil | MRPAMHHPSLSAVRAEALFVSALQRCEQPSAEQVRQSVAAAVH |
| Ga0073928_107177302 | 3300006893 | Iron-Sulfur Acid Spring | MRSPMHHLSVGAARADALFVSTLQRSSEPSGGQVRLAVATAVRAFGSRGCAERVAQ |
| Ga0126384_107250121 | 3300010046 | Tropical Forest Soil | MHRFNISAARADALFVSALQRSEEVSTGQVRQAVATAVRSFGGPGVRRTGSAGVW* |
| Ga0126379_129485311 | 3300010366 | Tropical Forest Soil | MHHLSISAARADALFVSALQRSEELSTGQVRQAVAAAVRA |
| Ga0126381_1038438021 | 3300010376 | Tropical Forest Soil | MHHLSISAARADALFVSALQRSEELCTGQVRQAVVAAVRAFGSRGCAER |
| Ga0151490_13841571 | 3300011107 | Soil | MHHLSISAARADALFVSALQRSEELSTGQVRQAVAAAVRAFGSRGCAER |
| Ga0137391_113356031 | 3300011270 | Vadose Zone Soil | MQDLSISAVRADALFVSALQRSEEPSTRQVRQAVATAIRAFGGR |
| Ga0137364_104955882 | 3300012198 | Vadose Zone Soil | MYHLSISAARADALFVSALQRSEELSTGQVRQAVASAVRAFGSK |
| Ga0137365_113091282 | 3300012201 | Vadose Zone Soil | MHHLSISAARADALFVSALQRSDELSTGQVQQAVAAAVRAFGSQGCAERVTQE |
| Ga0137381_109368902 | 3300012207 | Vadose Zone Soil | MRPAINHFSISAVRADALFVSALQRSDEPSAAQVREAIAGAVRRFGGRGC |
| Ga0137376_102614513 | 3300012208 | Vadose Zone Soil | MHHLSISAARADALFVSALQRSEELSTGQVRQAVAA |
| Ga0137384_101886791 | 3300012357 | Vadose Zone Soil | MRPTRHHISINAVRTEALFVSALQRSDVPSAGQVQQAVAAAVRA |
| Ga0157369_124533272 | 3300013105 | Corn Rhizosphere | MHHLSISAARADALFVSALQRSEELSTGQVRQAVAAAV |
| Ga0181522_100365081 | 3300014657 | Bog | MMPPAMDYPSISAIRADALFVSALQRGDHPGAKEVRQAVAAAVGAF |
| Ga0182030_105708031 | 3300014838 | Bog | MRTVNNFLSISAARADALFVSSLQPSDEPGAGQIRQSVVAAVRQF |
| Ga0132257_1025181431 | 3300015373 | Arabidopsis Rhizosphere | VAARADALFASALQRSDEPSAGQVRRAIAVAVAAYG |
| Ga0182041_110607862 | 3300016294 | Soil | MRSAMHHPSISAVRADALFVSALQRCEHPSAGQVRQAVAAAIHTYGQC |
| Ga0182033_103067431 | 3300016319 | Soil | MRPEMHHLSISAARADALFVSALQRSEELSTGHVRQAVAAAVRAFGSKGCAER |
| Ga0182033_107199142 | 3300016319 | Soil | MWSAMHELSIRTFQADALFVSVLQRSDEPSAGQVR |
| Ga0182037_111620422 | 3300016404 | Soil | MWPATHHQTNHAFDADALFVSALQRSDEPSAAQIRQAIAA |
| Ga0182039_106724152 | 3300016422 | Soil | MWPAQHQSSITAFGADALFVSALQRSDTPTAGQIR |
| Ga0182039_112222902 | 3300016422 | Soil | MRPAMHHPSISAVRADALFVSALQRCEHPSTGQVRQAVAAAVRAFG |
| Ga0182038_103829742 | 3300016445 | Soil | MRPAMHHRGMSAIRADALFVSALQRGDHPGAGEVRRAVAAAVEAFGQRGCAA |
| Ga0187807_12342451 | 3300017926 | Freshwater Sediment | MRPAMHHLSISAIRADALFVSALQRGDHPSAKEVRQAVAAAV |
| Ga0187806_11946103 | 3300017928 | Freshwater Sediment | MRPAMHHLSISAIRADALFVSALQRGDHPGAQEVRQAVAAAV |
| Ga0187806_12210351 | 3300017928 | Freshwater Sediment | MRPAMHHLSISAIRSDALFVSALQRGDHPSAREVRQAVDGAVQAFGQRG |
| Ga0187817_106434851 | 3300017955 | Freshwater Sediment | MRPAMHHLSISVIRADALFVSALQRGDHPSAWEVRQAVAAAVEAFGQRGC |
| Ga0187776_100491724 | 3300017966 | Tropical Peatland | MQPAMYHLSISAARADALFVSALQRSEELSTGQVQQAVASAVRTFGSRGCAERVAQ |
| Ga0187776_104122992 | 3300017966 | Tropical Peatland | MRSATHHLSIGTARADALFVSVLQRSGEPSPAEVRDAIAAAVRAFGARGCAA |
| Ga0187781_110896701 | 3300017972 | Tropical Peatland | MQPAIHHLSISAIRANALFASTLQRGDHPSAKEVRQAVTAVVEAFGQCGC |
| Ga0187765_109830272 | 3300018060 | Tropical Peatland | MRPTMNHLSIRAVRADALFVSSLQRSDEPSAGQVRLAIAAAVRQF |
| Ga0187765_109987441 | 3300018060 | Tropical Peatland | MRPEMHHLSVSAARADALFVSALQRSDELNTGQVQQAVASAVRAFGSR |
| Ga0187769_114199782 | 3300018086 | Tropical Peatland | MRPAMHHLSVSATRADALFVSALQRGDHPGAREVRQAVAAAVGAFG |
| Ga0187774_108956072 | 3300018089 | Tropical Peatland | MRPAMYHLSISAARADALFVSALQRSEELSTGQVQQAVASAVRTFGSRGC |
| Ga0210401_110102462 | 3300020583 | Soil | MRPAMHHLSISVIRADALFVSALQRGDHPGAKEVRHAVAVAVGA |
| Ga0210396_100360095 | 3300021180 | Soil | MRPAIHHLSISAIRADALFVSALQRGDQPGARQVRQAV |
| Ga0210388_116351491 | 3300021181 | Soil | MRPAMPHLSIGVIQADALFVSALQRGDHPGARQVRQAVAAAVEAFGPRGCAGRV |
| Ga0210389_103862802 | 3300021404 | Soil | MRPAMHHLSISVIRADALFVSALQRGDHPGAKEVRHAVAVAVG |
| Ga0210391_103719481 | 3300021433 | Soil | MRPAIHHLSISAIRADALFVSALQSGDQPGARQVRQ |
| Ga0210391_107914002 | 3300021433 | Soil | MRPAIHHLSISAIRADALFVSALQRGDHPGARQVRQ |
| Ga0208190_10717281 | 3300025473 | Peatland | MRPVSNFLSTSAARTDALFVSSLQRSDEPSARQIRQSVAAAVRQFGSRGCAGRVAQE |
| Ga0208219_10287241 | 3300025625 | Arctic Peat Soil | VRTVMNHLSISAARTDALFVSTLRRSDEPSAGQIRQAVAVAVHQFGSRGC |
| Ga0207653_102121471 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPAMHQSSFSAVWADALFVSALQRYDQPSAGQVRQAVAAAEPASQATE |
| Ga0207693_101249085 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPAMHHLSISAVRADALFVSALQRSEELDTGQVREAVAMAVRALGGRGCAE |
| Ga0207663_109969441 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPAMHHLSISAVRADALFVSALQRSEELDTGQVREAVAMA |
| Ga0207663_113278011 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPAMHYLSISAARADALFVSALQRSEELSTGQVRQAVAAAVRAFGSRGCA |
| Ga0207664_105343104 | 3300025929 | Agricultural Soil | MRPAMHHLSISAVRADALFVSALQRSEELDTGQVR |
| Ga0257160_10692881 | 3300026489 | Soil | MRPAMDHLSISVIRADALFVSALQRGDHPGAREVRQAVAAAVGAFG |
| Ga0209773_104064642 | 3300027829 | Bog Forest Soil | MRPAMDHLSISAIRADALFVSALQRGDHPGAREVRQAV |
| Ga0209773_104469242 | 3300027829 | Bog Forest Soil | MRPAMHHLSISAIRADALFVSALQRGDHPSAQEVRQAVAAAVG |
| Ga0209701_106028391 | 3300027862 | Vadose Zone Soil | MRPAMHNRSISAVRADALFVSALQRSDEPSAGQVRQAVAAA |
| Ga0209415_109897571 | 3300027905 | Peatlands Soil | MRPATHHLSISAIRADALFVSALQRSDHLSAKEVRQAVA |
| Ga0302231_104108071 | 3300028775 | Palsa | MRPAMHRLSIGATRADALFVSALQRGDHPSAKEVRQAV |
| Ga0302303_101138551 | 3300028776 | Palsa | MSRRLMMRPAMHHLSIGAIRADALFVSALQRGDHPSAKEVRQAVAA |
| Ga0302232_1000309113 | 3300028789 | Palsa | MRPAMHHLSIGAIRADALFVSALQRGDHPSAKEVRQAVAATVE |
| Ga0302232_104154501 | 3300028789 | Palsa | MRPAMHHLSIGAIRADALFVSELQRGDHPSTREVRQAV |
| Ga0302228_100209851 | 3300028808 | Palsa | MRPAMHHLSIGAIRADALFVSALQRGDHPSAKEVRQAVAAAVEAFGQRGCAG |
| Ga0302235_104886911 | 3300028877 | Palsa | MRPAMHHLSIGAIRADALFVSALQRGDHPSAKEVRQAVAATVEAFGQRGCA |
| Ga0302229_100418481 | 3300028879 | Palsa | MRPAMHHLSIGATRADALFVSALQRGDHPSAKEVRQAVAAVVEAFGQ |
| Ga0302229_101139241 | 3300028879 | Palsa | MSRRLMMRPAMHHLSIGAIRADALFVSALQRGDHPSAKEVRQAVAAAVEAFGQRGCAGRV |
| Ga0311368_102627101 | 3300029882 | Palsa | MSRRLMMRPAMHHLSIGAIRADALFVSALQRGDHPSAKEVRQAVAAAV |
| Ga0311369_103008503 | 3300029910 | Palsa | MRPAMHHLSIGAIRADALFVSALQRGDHPSAKEVRQAVAAA |
| Ga0311369_106424202 | 3300029910 | Palsa | MRPAMHHLSIGAIRADALFVSALQRGDHPSAKEVRQ |
| Ga0311371_108311041 | 3300029951 | Palsa | MRPVNNFLSISAARTDALFVSALQRSDEPSAGQIRQSVAAAVRQFG |
| Ga0302177_104363512 | 3300030053 | Palsa | MRPAMHHLSISAIRADALFVSALQRGDHPSAKEVRQAVTAAVEAFGP |
| Ga0311370_100531971 | 3300030503 | Palsa | MRPAMHHLSIGAIRADALFVSALQRGDHPSAKEVRQAVAAAVEAFGQRGCAGRVAQ |
| Ga0265393_11825621 | 3300030586 | Soil | MRPAMHHLSISVIRADALFVSALQRGDHPNAKEVRQAVAARKKEEKKK |
| Ga0311356_1000881113 | 3300030617 | Palsa | MHHLSISAIRADALFVSALQRGDHPSAKEVRQAVAATVE |
| Ga0311356_111079691 | 3300030617 | Palsa | MRPAMHHLSIGAIRADALFVSELQRGDHPSTREVRQAVAAAVEAFGQRGCAGRVA |
| Ga0311354_105866501 | 3300030618 | Palsa | MMRPAMHHLSIGAIRADALFVSELQRGDHPSTREVR |
| Ga0302180_100620581 | 3300031028 | Palsa | MRPAMHHLSIGAIRADALFVSALQRGDHPSAKEVRQAVAAAVEAFGQRGCAGRV |
| Ga0302307_100263585 | 3300031233 | Palsa | MRPAMHHLSIGAIRADALFVSALQRGDHPSAEEVRQ |
| Ga0302307_103838671 | 3300031233 | Palsa | MRPAMHHLSIGAIRADALFVSALQRGDHPSAKEVRQAVAATVEAFGQRGC |
| Ga0302325_106760052 | 3300031234 | Palsa | MRPAMHHLIMGAIRADALFVSALQRGDHPSAREVRQAVAAAVGAFGQRGCAGRVAQE |
| Ga0302325_107243102 | 3300031234 | Palsa | MRPAMHHLSVGSIRADALFVSALQRGDHPSAKEVRQAVAAAVEAFGQRGCAGR |
| Ga0302326_108282661 | 3300031525 | Palsa | MRPAMHHLSIGAIRADALFVSALQRGDHPSAKEVRQAVAATVEAF |
| Ga0302326_125217421 | 3300031525 | Palsa | MRPAMHHLSIGAIQADALFVSALQRGDHPSAKEVRQAVAAA |
| Ga0318534_100436191 | 3300031544 | Soil | MSPAQHKSSITAFRADALFVSALQRSDTPTAGQIRQ |
| Ga0318555_103462212 | 3300031640 | Soil | MRPEMHYLSISAARADALFVSALQRSEELSTGHVRQAVA |
| Ga0318555_105038381 | 3300031640 | Soil | MGPAQHHFSSTAFGADALFVSALQRSDAPTAGQIR |
| Ga0318560_100788123 | 3300031682 | Soil | MRSAMHHLSISAVRADALFVSALQRCEHPSTQQVRQAVAE |
| Ga0307476_109976422 | 3300031715 | Hardwood Forest Soil | MRSAMHDPGISAVWADALFVSALQRCEHPSTGEVRQAVA |
| Ga0318492_105847351 | 3300031748 | Soil | MRSAMHHPSISAVRADALFVSALQRCEHPNAGQVRQAVEAAIHAYG |
| Ga0318509_101466113 | 3300031768 | Soil | MRPAMHHRGMSAIRADALFVSALQRGDNPRAGEVRQAVA |
| Ga0318509_107026543 | 3300031768 | Soil | MRPMMHHLTTSAIRADALFVSALQHGDHPSAKEVRQAVAAAVETFGQHG |
| Ga0318521_104020462 | 3300031770 | Soil | MRSAMHHPSISAVRADALFVSALQRCEHPSAGQVRQAVA |
| Ga0318546_108694481 | 3300031771 | Soil | MRPEMHHLSISAARADALFVSALQRSEELSTGHVRQA |
| Ga0318546_109910531 | 3300031771 | Soil | MRPMMHHLTTSAIRADALFVSALQHGDHPSAKEVRQAVAAAVETFGQHGCAGRVAQ |
| Ga0318557_105641281 | 3300031795 | Soil | MRPEMHHLSISAARADALFVSALQRSEELSTGHVRQAV |
| Ga0318565_105531451 | 3300031799 | Soil | MRSAMHHLSISAVRADALFVSALQRCEHPSTQQVRQAVA |
| Ga0318497_101647471 | 3300031805 | Soil | MRSAMHHPSISAVRADALFVSALQRCEHPSAGQVRQAVAAAIHTYGQCGCAERMAQ |
| Ga0318497_108662491 | 3300031805 | Soil | MRPMMHHLTTSAIRADALFVSALQHGDHPSAKEVR |
| Ga0318511_100928913 | 3300031845 | Soil | MMRPAMHHRGMSAIRADALFVSALQRGDNPRAGEVRQAVAA |
| Ga0318511_104833171 | 3300031845 | Soil | MRSAMHHPSISAVRADALFVSALQRCEHPSAGEVRQAVAAAIHAYGQCGCAERMAQEF |
| Ga0306925_106184741 | 3300031890 | Soil | MSPAQHKSSITAFRADALFVSALQRSDTPTAGQIR |
| Ga0318530_104619533 | 3300031959 | Soil | MRPMMHHLTISAIRADALFVSALQRGDHPSAKEVRQAVTAAVEAFGQRGC |
| Ga0318563_102201613 | 3300032009 | Soil | MRTTMGSLSISAARTAALFVSALQGSDEPSARQVRQVVAAAE |
| Ga0318556_101563751 | 3300032043 | Soil | MWPATHHQTNHAFDADALFVSALQRSDEPSAAQIR |
| Ga0318533_105940162 | 3300032059 | Soil | MWPAQHQSSITAFGADALFVSALQRSDTPTAGQIRQAIDTAVG |
| Ga0318504_106518731 | 3300032063 | Soil | MRSAMHHLSISAVRADALFVSALQRCEHPSTQQVRQAVAEAVRTFGQQGCADRMAQE |
| Ga0307470_101604933 | 3300032174 | Hardwood Forest Soil | MRPAAHHLSIRASGADALFVSALQRSDDPSAGQIRQAIAAAIG |
| Ga0306920_1035726391 | 3300032261 | Soil | MWPAQHQFSITAFGADALFASALQRSDAPTAGQIRHAI |
| Ga0335085_101744831 | 3300032770 | Soil | MKDPSISEIRADALFVSSLQRTDEPSTGQVRQAVA |
| Ga0335080_100268947 | 3300032828 | Soil | MRLAMHHLSLSTVRADALFVSALQRGDHPGAGEVRQAV |
| Ga0335077_100798271 | 3300033158 | Soil | MRPEMHHLSVSAARADALFVSALQRSDELNTGQVQQAVASAVRAFGSRGCAER |
| Ga0318519_107579522 | 3300033290 | Soil | MRPAMHHPSISAVRADALFVSALQRCEHPSTGQVRQAVAAAVRT |
| Ga0370483_0260992_447_593 | 3300034124 | Untreated Peat Soil | MRPVNNFLSISAARTDALFVSSLQRSDEPSAGQIRQSVAAAVRQFGRRG |
| ⦗Top⦘ |