Metagenome Family F082236

Overview

Basic Information

• Family ID: F082236
• Family Type: Metagenome
• Number of Sequences: 113
• Average Sequence Length: 41 residues
• Representative Sequence: ILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ
• Number of Associated Samples: 27
• Number of Associated Scaffolds: 113

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 6.00 %
• % of genes near scaffold ends (potentially truncated): 66.37 %
• % of genes from short scaffolds (< 2000 bps): 64.60 %
• Associated GOLD sequencing projects: 24
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (55.752 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont (43.363 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 56.52%
  β-sheet: 0.00%
  Coil/Unstructured: 43.48%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 113 Family Scaffolds
PF03281	Mab-21	0.88
PF12333	Ipi1_N	0.88
PF01833	TIG	0.88
PF00076	RRM_1	0.88
PF01391	Collagen	0.88
PF13336	AcetylCoA_hyd_C	0.88
PF00055	Laminin_N	0.88
PF00620	RhoGAP	0.88

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
All Organisms	root	All Organisms	44.25 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
cellular organisms	root	All Organisms → cellular organisms	44.25 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	43.36 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.88 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	43.36 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.88 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	30.09 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.88 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	30.09 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.88 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	30.09 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	0.88 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	23.89 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	6.19 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.88 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	23.01 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	6.19 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	0.88 %
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	0.88 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	23.01 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	6.19 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	0.88 %
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	0.88 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	23.01 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	6.19 %
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	0.88 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.88 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	23.01 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	6.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %
Clitellata	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata	0.88 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	23.01 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	6.19 %
Hirudinea	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	23.01 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	6.19 %
Rhynchobdellida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	23.01 %
Actinopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii	6.19 %
Glossiphoniidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	23.01 %
Cladistia	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia	6.19 %
Helobdella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	23.01 %
Polypteriformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes	6.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	23.01 %
Polypteridae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae	6.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Polyneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	22.12 %
Polypterus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus	6.19 %
Paraneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Dictyoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera	22.12 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	6.19 %
Hemiptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Blattodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	22.12 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	6.19 %
Sternorrhyncha	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	22.12 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	6.19 %
Aphidomorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Termitoidae	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae	22.12 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	6.19 %
Aphidoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Rhinotermitidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae	22.12 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	6.19 %
Aphididae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Coptotermitinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae	22.12 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	6.19 %
Aphididae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Coptotermes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes	22.12 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	6.19 %
Aphididae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Level 27

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	22.12 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	6.19 %
Aphididae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300001741|JGI24671J20093_10092741	Not Available	712
3300001742|JGI24673J20094_10123397	Not Available	706
3300003748|Ga0049102_10041475	Not Available	774
3300003776|Ga0049101_10038628	Not Available	1384
3300003776|Ga0049101_10158896	Not Available	746
3300003776|Ga0049101_10192453	Not Available	670
3300003776|Ga0049101_10245352	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	578
3300004626|Ga0066188_1015762	Not Available	1928
3300004626|Ga0066188_1024921	Not Available	1690
3300004626|Ga0066188_1082128	Not Available	1110
3300004626|Ga0066188_1192749	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	725
3300004626|Ga0066188_1251379	Not Available	612
3300005968|Ga0056130_1004747	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4247
3300005968|Ga0056130_1040464	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	2159
3300005968|Ga0056130_1050782	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1956
3300005968|Ga0056130_1061268	Not Available	1797
3300005968|Ga0056130_1069426	Not Available	1691
3300005968|Ga0056130_1127231	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1196
3300005968|Ga0056130_1297409	All Organisms → cellular organisms → Eukaryota → Opisthokonta	585
3300005978|Ga0056129_1002602	Not Available	7071
3300005978|Ga0056129_1003716	Not Available	6420
3300005978|Ga0056129_1005586	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5726
3300005978|Ga0056129_1012141	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4523
3300005978|Ga0056129_1014858	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	4223
3300005978|Ga0056129_1016223	Not Available	4094
3300005978|Ga0056129_1028139	Not Available	3288
3300005978|Ga0056129_1029258	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3236
3300005978|Ga0056129_1038728	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2853
3300005978|Ga0056129_1050990	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2490
3300005978|Ga0056129_1105555	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1591
3300005978|Ga0056129_1121699	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1428
3300005978|Ga0056129_1122520	Not Available	1420
3300005978|Ga0056129_1158216	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1143
3300005978|Ga0056129_1182405	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae	996
3300005978|Ga0056129_1184401	Not Available	985
3300005978|Ga0056129_1251353	Not Available	700
3300005978|Ga0056129_1307726	Not Available	546
3300006912|Ga0056114_1008190	Not Available	6685
3300006912|Ga0056114_1010027	All Organisms → cellular organisms → Eukaryota → Opisthokonta	6243
3300006912|Ga0056114_1012172	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5836
3300006912|Ga0056114_1017251	Not Available	5112
3300006912|Ga0056114_1033250	Not Available	3783
3300006912|Ga0056114_1035566	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3649
3300006912|Ga0056114_1082028	Not Available	2131
3300006912|Ga0056114_1094271	Not Available	1898
3300006912|Ga0056114_1094638	Not Available	1891
3300006912|Ga0056114_1099805	Not Available	1805
3300006912|Ga0056114_1115242	Not Available	1577
3300006912|Ga0056114_1116288	Not Available	1563
3300006912|Ga0056114_1133799	Not Available	1352
3300006912|Ga0056114_1156691	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1130
3300010290|Ga0126333_1115425	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	1342
3300010290|Ga0126333_1138178	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1193
3300010290|Ga0126333_1311328	Not Available	605
3300010292|Ga0126326_1045776	Not Available	2108
3300010292|Ga0126326_1192739	Not Available	949
3300010294|Ga0126332_10069186	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	2039
3300010294|Ga0126332_10220735	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	924
3300010294|Ga0126332_10275856	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	755
3300010295|Ga0126334_10171024	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1123
3300010295|Ga0126334_10209878	Not Available	959
3300010295|Ga0126334_10217618	Not Available	931
3300010295|Ga0126334_10227399	Not Available	897
3300010295|Ga0126334_10280846	Not Available	747
3300010298|Ga0126325_10130701	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1340
3300010298|Ga0126325_10192156	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1041
3300010298|Ga0126325_10470210	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	512
3300010314|Ga0126331_1038210	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2481
3300010314|Ga0126331_1045560	Not Available	2295
3300010314|Ga0126331_1080626	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	1718
3300010315|Ga0136654_1004551	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5173
3300010315|Ga0136654_1205654	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	921
3300010377|Ga0126328_10004729	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	5069
3300010377|Ga0126328_10269039	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	763
3300010378|Ga0126330_10133023	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1314
3300010378|Ga0126330_10167701	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1122
3300010378|Ga0126330_10310689	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	672
3300010378|Ga0126330_10338230	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	621
3300010378|Ga0126330_10341333	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	616
3300011190|Ga0126327_10082239	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1660
3300011190|Ga0126327_10211449	Not Available	916
3300011190|Ga0126327_10247061	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	809
3300011190|Ga0126327_10355025	Not Available	590
3300012273|Ga0126329_10213299	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	947
3300012273|Ga0126329_10229912	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	894
3300012273|Ga0126329_10269158	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	788
3300012273|Ga0126329_10420235	Not Available	537
3300012887|Ga0126335_1216325	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	577
3300027347|Ga0209366_1073813	Not Available	1649
3300027347|Ga0209366_1119675	Not Available	1169
3300027347|Ga0209366_1128016	Not Available	1107
3300027347|Ga0209366_1134243	Not Available	1065
3300027347|Ga0209366_1136396	Not Available	1050
3300027347|Ga0209366_1263482	Not Available	505
3300027392|Ga0209680_1002607	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	6788
3300027392|Ga0209680_1065400	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	2037
3300027392|Ga0209680_1072600	Not Available	1916
3300027392|Ga0209680_1112085	Not Available	1422
3300027398|Ga0209782_1152757	Not Available	973
3300027398|Ga0209782_1180675	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	766

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Category

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	56.64%
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	43.36%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	56.64%
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	43.36%

Habitat

Habitat	Taxonomy	Distribution
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont	43.36%
Marine Gutless Worms	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms	38.94%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont	17.70%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300001741	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1	Host-Associated
3300001742	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3	Host-Associated
3300003748	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.2	Host-Associated
3300003776	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.1	Host-Associated
3300003817	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 2 HERON ISLAND	Host-Associated
3300004626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.2	Host-Associated
3300005652	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1a BELIZE.1	Host-Associated
3300005653	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 2 BELIZE.1	Host-Associated
3300005968	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2	Host-Associated
3300005978	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1	Host-Associated
3300006912	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.1	Host-Associated
3300008212	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 1 HERON ISLAND	Host-Associated
3300010290	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-54 metaG	Host-Associated
3300010292	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-67 metaG	Host-Associated
3300010294	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-42 metaG	Host-Associated
3300010295	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-49 metaG	Host-Associated
3300010298	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-14 metaG	Host-Associated
3300010314	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-98 metaG	Host-Associated
3300010315	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-70 metaG	Host-Associated
3300010377	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-13 metaG	Host-Associated
3300010378	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-91 metaG	Host-Associated
3300011190	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-30 metaG	Host-Associated
3300012273	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-85 metaG	Host-Associated
3300012887	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Olavius sp. 1 OAHU.JWI-45 metaG	Host-Associated
3300027347	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.2 (SPAdes)	Host-Associated
3300027392	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1 (SPAdes)	Host-Associated
3300027398	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.1 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24671J20093_100927411	3300001741	Marine Gutless Worms Symbiont	LGPMSAWDALDQRVIDVRQWRTRLRACIKAKGGYFEHSLS*
JGI24673J20094_101233971	3300001742	Marine Gutless Worms Symbiont	TLTSCMSALGPMSAWDALDQRVIDVRQWRTRLRACIKAKGGYFEHSLS*
Ga0049102_100414751	3300003748	Marine Gutless Worms Symbiont	IDELRARILTAWDKMDQRIIDKAVRQWRTRLRARIKAKGGHFKHTLCQ*
Ga0049101_100386283	3300003776	Marine Gutless Worms Symbiont	DELRACILKAWDKMDQRIIDKAVRQWRTRLRACIKAKGGQFKHTLHQ*
Ga0049101_101588961	3300003776	Marine Gutless Worms Symbiont	RILTAWDKMDQRIIDKAVRQWRTRLHACIKAKGRHFEHTLRQ*
Ga0049101_101924531	3300003776	Marine Gutless Worms Symbiont	ILTAWDKMDQRIIDKAVRQWHTRLRACIKAKGGHFKHTFRQ*
Ga0049101_102453521	3300003776	Marine Gutless Worms Symbiont	TAWDKMDQRIIDKAVRQWRTRLRACIKAKGGHFEHTLRQ*
Ga0056122_102126792	3300003817	Marine Gutless Worms Symbiont	MNCGSRILTAWDELDQRVVDTAVRLWRTRLRACVKAKGGHFEHKLN*
Ga0066188_10157623	3300004626	Marine Gutless Worms Symbiont	RILTAWDEMDQRIIDAAIRQWRTRLRTCIKSKGGHFEHTLSQ*
Ga0066188_10249211	3300004626	Marine Gutless Worms Symbiont	RARILTAWDEMDQRIINAEIRQWRTRLRTCIKTKGGHFEHASSQ*
Ga0066188_10821281	3300004626	Marine Gutless Worms Symbiont	LTNILSHTDQRIIDAAIRQWRTCLRACIKAKGGHFEHTLSQ*
Ga0066188_11927492	3300004626	Marine Gutless Worms Symbiont	TAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0066188_12513791	3300004626	Marine Gutless Worms Symbiont	ARILTAWDEMDQRIIDAAIRQWRTRLRTCIKVKGGHFEHTLSQ*
Ga0056135_105672572	3300005652	Marine Gutless Worms Symbiont	LRILTAWDELDQRVIDTTVGQWRTRLRACVKAKGAHFEHKLS*
Ga0056133_104875354	3300005653	Marine Gutless Worms Symbiont	DELDQRVIDTAVKQWRTSLHACIKAKGGYFEHSLP*
Ga0056133_105637522	3300005653	Marine Gutless Worms Symbiont	LRILTAWDELDQRVIDTTVGQWRTRLRACVKAKGAHFEHKLSYYH*
Ga0056130_10047478	3300005968	Marine Gutless Worms Symbiont	LRARILTAWDEMDQRIIDAAIRQWRTRLFTCIKVKGGHFRRTMSQ*
Ga0056130_10404641	3300005968	Marine Gutless Worms Symbiont	ILTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0056130_10507823	3300005968	Marine Gutless Worms Symbiont	AWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0056130_10612684	3300005968	Marine Gutless Worms Symbiont	RILTAWDEMDQRIIDAAIRQWHTRLRAFIKAKGGHFEHTLSQ*
Ga0056130_10694262	3300005968	Marine Gutless Worms Symbiont	MDQRIIDAAIRQWRSRLRACIKAKGGHFEHTLSQ*
Ga0056130_11272311	3300005968	Marine Gutless Worms Symbiont	ILTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLTQ*
Ga0056130_12974091	3300005968	Marine Gutless Worms Symbiont	MHVSWDVTDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTL
Ga0056129_100260212	3300005978	Marine Gutless Worms Symbiont	MDQRIIDAAIGQRHTRLRACIKAKGGHFEHTLSQ*
Ga0056129_10037168	3300005978	Marine Gutless Worms Symbiont	MDQRIIDAAIRQWRTRLLACIKAKGGHFERTLSQ*
Ga0056129_100558611	3300005978	Marine Gutless Worms Symbiont	MDQRIIDAATDRGACTRFRACIKAKDGHFEHALSQ*
Ga0056129_10121414	3300005978	Marine Gutless Worms Symbiont	MDQRIIDAAIRRWRTRTRLRTCIKDKGGHFEHTLSQ*
Ga0056129_10148581	3300005978	Marine Gutless Worms Symbiont	ARILTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0056129_10162233	3300005978	Marine Gutless Worms Symbiont	MDQRIIDAAIRQWRTRLRACLKAKGGHLEHTLSQ*
Ga0056129_10281391	3300005978	Marine Gutless Worms Symbiont	LLTYLLTNILSHTDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0056129_10292584	3300005978	Marine Gutless Worms Symbiont	MDQHIIDAVIRQWCTRLRACIKAKGGHFEHTLIQ*
Ga0056129_10387282	3300005978	Marine Gutless Worms Symbiont	MDQRIIDATIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0056129_10509902	3300005978	Marine Gutless Worms Symbiont	MDQHIIDAAIRQWCTRLRACIKAKGGHFEHTLSQ*
Ga0056129_11055554	3300005978	Marine Gutless Worms Symbiont	RILTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0056129_11216992	3300005978	Marine Gutless Worms Symbiont	MDQRIIDAAIRPSVNQTEAHSLRACIKAKGGHFEHTLSQ*
Ga0056129_11225201	3300005978	Marine Gutless Worms Symbiont	EMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0056129_11582161	3300005978	Marine Gutless Worms Symbiont	VTARDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0056129_11824051	3300005978	Marine Gutless Worms Symbiont	LLTYLLTNILSHTDQRIIDAAIRQWRTRLRACIKAKGGHYEHTLSQ*
Ga0056129_11844011	3300005978	Marine Gutless Worms Symbiont	ELRARILTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHCEHTLSQ*
Ga0056129_12513531	3300005978	Marine Gutless Worms Symbiont	RERILTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHIEHTLSQ*
Ga0056129_13077261	3300005978	Marine Gutless Worms Symbiont	YLLTNSLSHTDQRIIGAVIRQWRTRLRACIEAKGGHYEHALSQ*
Ga0056114_10081907	3300006912	Marine Gutless Worms Symbiont	AWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHIEHTLSQ*
Ga0056114_10100276	3300006912	Marine Gutless Worms Symbiont	MDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0056114_10121722	3300006912	Marine Gutless Worms Symbiont	MNQRIIDAAIRQWRTRLRTCIKAKGGHFEPTLSQ*
Ga0056114_10172516	3300006912	Marine Gutless Worms Symbiont	MDQRIIDAATDSGSGARLRTCFKAKGGHFEHTLSQ*
Ga0056114_10332505	3300006912	Marine Gutless Worms Symbiont	MNQRIIDAAIRQWCTRLRTCIKAKGGHFEHTLSQ*
Ga0056114_10355665	3300006912	Marine Gutless Worms Symbiont	VTAWDEIDQRIIDAAIRQRRKRLRTCIKAKGGHFEHTLSQ*
Ga0056114_10820283	3300006912	Marine Gutless Worms Symbiont	MDQRIIDVAIRHWRTRLRVCIKAKGGHFEHTLSQ*
Ga0056114_10942713	3300006912	Marine Gutless Worms Symbiont	MDQRIIDAAIRHWHTRLRACIKAKGGHFEHTLSQ*
Ga0056114_10944551	3300006912	Marine Gutless Worms Symbiont	DEMDQRIIDAAIRQWRTRLCTCIKAKGGHFEHTLSQ*
Ga0056114_10946386	3300006912	Marine Gutless Worms Symbiont	LTALDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0056114_10998051	3300006912	Marine Gutless Worms Symbiont	MDQRIIDAAIRQWRTRLRACIKAKGGHVEHTLSQYNVFWRT*
Ga0056114_11152421	3300006912	Marine Gutless Worms Symbiont	MDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0056114_11162881	3300006912	Marine Gutless Worms Symbiont	LRARILTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFERTLS*
Ga0056114_11337995	3300006912	Marine Gutless Worms Symbiont	DELRALILTAWDEMDQRIIDAAITCLHACIKAKGGQCDHTLSQ*
Ga0056114_11566911	3300006912	Marine Gutless Worms Symbiont	LTSWDEMDQRIIDAAIRQWCTRLRTCIKAKGGHFEHTLSQYVFWRT*
Ga0056121_10100841	3300008212	Marine Gutless Worms Symbiont	QGRQRTAFAYPKFLTAWDELDQRVIDTAVRQWRTSLRACVKAKGGHFEHKLSQ*
Ga0126333_11154251	3300010290	Marine Gutless Worms	ARILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGRHFEHTLTQ*
Ga0126333_11381781	3300010290	Marine Gutless Worms	RARILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126333_12384271	3300010290	Marine Gutless Worms	LNTLTYLRILTAWDEMDQRIIDAAIRQWRRRLRACMIKAKGGHFEHTLTQ*
Ga0126333_13113281	3300010290	Marine Gutless Worms	EMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126326_10457762	3300010292	Marine Gutless Worms	MDQRIIDAAMRQWRTGLRACIKAKGGHFEHTLSQ*
Ga0126326_11077722	3300010292	Marine Gutless Worms	YVLRARILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHLNTH*
Ga0126326_11927391	3300010292	Marine Gutless Worms	ILTAWDEMDQRIIDAAIRQWRTRLRACTKAKGGHFEHTLSQ*
Ga0126332_100691861	3300010294	Marine Gutless Worms	RAHILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEYTLSQ*
Ga0126332_101188591	3300010294	Marine Gutless Worms	DQARILTAWDEMDQRIIDAAIRQWRTRLHACIKAKGGHFEQ*
Ga0126332_102207351	3300010294	Marine Gutless Worms	MLLLTYVLTNIWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126332_102758561	3300010294	Marine Gutless Worms	TAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126332_103505811	3300010294	Marine Gutless Worms	DQARILTAWDEMDQRIIDAAIRQWRTRLHACIKAKGGHFEHTLSQ*
Ga0126334_101710241	3300010295	Marine Gutless Worms	LRARILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEQTLSQ*
Ga0126334_102023932	3300010295	Marine Gutless Worms	NTLTYLRILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLTQ*
Ga0126334_102098781	3300010295	Marine Gutless Worms	YLDVTRDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126334_102176182	3300010295	Marine Gutless Worms	MDQRIIDAAIRQWRTRLRACIKAEGGHFEHTLSQ*
Ga0126334_102273991	3300010295	Marine Gutless Worms	LTAWDEMDQRVIGAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126334_102808461	3300010295	Marine Gutless Worms	DEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126325_100142315	3300010298	Marine Gutless Worms	ARILTAWDEMDQRIIDAAIRQWRTRLRACVKAKGGHFEHTSSQ*
Ga0126325_101307011	3300010298	Marine Gutless Worms	WDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126325_101921561	3300010298	Marine Gutless Worms	ARILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLRQ*
Ga0126325_104702101	3300010298	Marine Gutless Worms	MLTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEQTLSQ*
Ga0126331_10382104	3300010314	Marine Gutless Worms	MDQRIIDAAIRQWRTRLPACIKAKGGHFEHTLSQ*
Ga0126331_10455601	3300010314	Marine Gutless Worms	MDQRIIDTAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126331_10806261	3300010314	Marine Gutless Worms	YSYLLTYLLISWDEMDQRIIDAAIRQWRTRLRACIKAKGRHFEHKLSQ*
Ga0126331_12214451	3300010314	Marine Gutless Worms	LNTLTYLRILTASDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLTQ*
Ga0136654_10045515	3300010315	Marine Gutless Worms	AAWDEMDQRIIDAAIRQWRTRLRACIKAKGGQFEHTLSYNVFWLT*
Ga0136654_12056541	3300010315	Marine Gutless Worms	SYLLTYLLISWDEMDQRIIDAAIRQWRTRLRACIKAKGRHFEHKLSQ*
Ga0126328_100047292	3300010377	Marine Gutless Worms	MDQCIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126328_102690391	3300010377	Marine Gutless Worms	WDEMDQRIIDTAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126330_101330231	3300010378	Marine Gutless Worms	ILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126330_101677011	3300010378	Marine Gutless Worms	WDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHALSQ*
Ga0126330_103106892	3300010378	Marine Gutless Worms	LTAWDEMDQHIIDAAIREWRTRLRACIKAKGRHFEHTLSQ*
Ga0126330_103382301	3300010378	Marine Gutless Worms	EFIHVKYSYLLTYLLISWDEMDQRIIDAEIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126330_103413331	3300010378	Marine Gutless Worms	AWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126327_100822391	3300011190	Marine Gutless Worms	LLLTYVLRARILTAWDEMDQRIIDAAIRQWRTRLRAYIKAKGGHFEHTLSQ*
Ga0126327_102114491	3300011190	Marine Gutless Worms	EMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTSSQ*
Ga0126327_102470612	3300011190	Marine Gutless Worms	ELRARILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEYNLSQ*
Ga0126327_103550251	3300011190	Marine Gutless Worms	DEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTSSQ*
Ga0126329_102132992	3300012273	Marine Gutless Worms	LSYVLTNIWDGMDQRIIDAAIRQWRTRLRACIKARGGHFEHALSQ*
Ga0126329_102299123	3300012273	Marine Gutless Worms	LLTYVLTNIWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126329_102691582	3300012273	Marine Gutless Worms	YLLISWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126329_104202351	3300012273	Marine Gutless Worms	VTRDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126335_12163251	3300012887	Marine Gutless Worms	RARILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTSSQ*
Ga0209366_10738131	3300027347	Marine Gutless Worms Symbiont	DKMDQRIIDKAVRQWCTRLRACIKAKDGHFKHTLRQ
Ga0209366_11196751	3300027347	Marine Gutless Worms Symbiont	RILTAWDKMDQRIIDKAVRQWRTRLRACIKAKGGHFKHTLRQ
Ga0209366_11280161	3300027347	Marine Gutless Worms Symbiont	DQLSACILTVWDKMDQRIIDIVRQWRTRLRACTKAKGGHFKHTLRQ
Ga0209366_11342432	3300027347	Marine Gutless Worms Symbiont	LRARILTAWDKMDQRIIDKAVRQWCTRLHACIKAKGGHFKHTFCQ
Ga0209366_11363961	3300027347	Marine Gutless Worms Symbiont	ILTAWDKMDQRIIDKAVRQWRTRLRACSKAKGGHFKHTLRQ
Ga0209366_12634821	3300027347	Marine Gutless Worms Symbiont	EELRARILTAWDKMDQRIIDKAVRQWRRRLRACIKAKGGQFEHTLRQ
Ga0209680_10026071	3300027392	Marine Gutless Worms Symbiont	NYELRARILTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ
Ga0209680_10654002	3300027392	Marine Gutless Worms Symbiont	LTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ
Ga0209680_10726001	3300027392	Marine Gutless Worms Symbiont	RARILTAWDEMDQRIIDAAIRQGHTRLRACIKAKGGHFKHTLSQ
Ga0209680_11120851	3300027392	Marine Gutless Worms Symbiont	EMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ
Ga0209782_11527571	3300027398	Marine Gutless Worms Symbiont	EQHARILTTWDKMDQRIIDKAVRQWRTRLRACIKAKDKHFQHTLRQ
Ga0209782_11806752	3300027398	Marine Gutless Worms Symbiont	FLTAWDKMDQHIIDKAVRQWHTRLHACIKAKVGYFKHTLRQ