Metagenome Family F082225

Overview

Basic Information

• Family ID: F082225
• Family Type: Metagenome
• Number of Sequences: 113
• Average Sequence Length: 37 residues
• Representative Sequence: MLDGDKKIFMTITLNFYIVVNKSYLYNYSEKITV
• Number of Associated Samples: 8
• Number of Associated Scaffolds: 113

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 2.80 %
• % of genes near scaffold ends (potentially truncated): 23.01 %
• % of genes from short scaffolds (< 2000 bps): 46.02 %
• Associated GOLD sequencing projects: 6
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (53.097 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules (83.186 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (100.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 51.61%
  β-sheet: 0.00%
  Coil/Unstructured: 48.39%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 113 Family Scaffolds
PF07727	RVT_2	2.65
PF00078	RVT_1	1.77
PF00400	WD40	1.77
PF13963	Transpos_assoc	1.77
PF00150	Cellulase	0.88
PF01490	Aa_trans	0.88
PF00348	polyprenyl_synt	0.88
PF06426	SATase_N	0.88
PF13456	RVT_3	0.88
PF01504	PIP5K	0.88
PF03514	GRAS	0.88
PF00665	rve	0.88
PF02892	zf-BED	0.88
PF16561	AMPK1_CBM	0.88
PF00514	Arm	0.88
PF03108	DBD_Tnp_Mut	0.88
PF08284	RVP_2	0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 113 Family Scaffolds
COG0142	Geranylgeranyl pyrophosphate synthase	Coenzyme transport and metabolism [H]	0.88
COG0531	Serine transporter YbeC, amino acid:H+ symporter family	Amino acid transport and metabolism [E]	0.88
COG0814	Amino acid permease	Amino acid transport and metabolism [E]	0.88
COG1045	Serine acetyltransferase	Amino acid transport and metabolism [E]	0.88
COG2730	Aryl-phospho-beta-D-glucosidase BglC, GH1 family	Carbohydrate transport and metabolism [G]	0.88
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.88
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.88
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.88
COG3934	Endo-1,4-beta-mannosidase	Carbohydrate transport and metabolism [G]	0.88
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.88

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
All Organisms	root	All Organisms	46.90 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
cellular organisms	root	All Organisms → cellular organisms	44.25 %
Viruses	superkingdom	All Organisms → Viruses	2.65 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	44.25 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	44.25 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	44.25 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	43.36 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	42.48 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	29.20 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	29.20 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	29.20 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	29.20 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	28.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	28.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	28.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	28.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	28.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	28.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	28.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	28.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	27.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	27.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	27.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	27.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	27.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Vigna	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	23.01 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %
Mucuna	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Mucuna	0.88 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Vigna unguiculata	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	22.12 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %
Mucuna pruriens	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Mucuna → Mucuna pruriens	0.88 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300006943|Ga0099822_1000165	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	47464
3300006943|Ga0099822_1000321	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	41131
3300006943|Ga0099822_1000375	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	39327
3300006943|Ga0099822_1002270	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	23798
3300006943|Ga0099822_1003091	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	21184
3300006943|Ga0099822_1004041	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	19001
3300006943|Ga0099822_1005534	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	16499
3300006943|Ga0099822_1007856	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	13716
3300006943|Ga0099822_1011192	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10984
3300006943|Ga0099822_1011506	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	10768
3300006943|Ga0099822_1011561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	10740
3300006943|Ga0099822_1014186	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	9207
3300006943|Ga0099822_1015036	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8767
3300006943|Ga0099822_1016227	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8213
3300006943|Ga0099822_1017198	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	7777
3300006943|Ga0099822_1017475	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Mucuna → Mucuna pruriens	7655
3300006943|Ga0099822_1017896	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7479
3300006943|Ga0099822_1019080	Not Available	7040
3300006943|Ga0099822_1024103	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	5500
3300006943|Ga0099822_1025716	Not Available	5075
3300006943|Ga0099822_1032590	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	3688
3300006943|Ga0099822_1032614	All Organisms → Viruses → Predicted Viral	3684
3300006943|Ga0099822_1032686	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	3673
3300006943|Ga0099822_1033364	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3555
3300006943|Ga0099822_1034090	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	3436
3300006943|Ga0099822_1035310	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	3248
3300006943|Ga0099822_1036250	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	3111
3300006943|Ga0099822_1039028	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	2754
3300006943|Ga0099822_1040636	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2570
3300006943|Ga0099822_1041079	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	2518
3300006943|Ga0099822_1043883	Not Available	2246
3300006943|Ga0099822_1045711	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	2087
3300006943|Ga0099822_1047826	Not Available	1926
3300006943|Ga0099822_1050739	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1727
3300006943|Ga0099822_1054412	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1521
3300006943|Ga0099822_1055481	Not Available	1471
3300006943|Ga0099822_1058325	Not Available	1349
3300006943|Ga0099822_1059487	Not Available	1301
3300006943|Ga0099822_1060433	Not Available	1267
3300006943|Ga0099822_1061190	Not Available	1240
3300006943|Ga0099822_1065539	Not Available	1105
3300006943|Ga0099822_1066081	Not Available	1090
3300006943|Ga0099822_1067705	Not Available	1047
3300006943|Ga0099822_1068259	All Organisms → Viruses → Predicted Viral	1034
3300006943|Ga0099822_1068591	All Organisms → Viruses → Predicted Viral	1026
3300006943|Ga0099822_1068994	Not Available	1017
3300006943|Ga0099822_1072315	Not Available	944
3300006943|Ga0099822_1077079	Not Available	857
3300006943|Ga0099822_1079564	Not Available	817
3300006943|Ga0099822_1081822	Not Available	785
3300006943|Ga0099822_1083485	Not Available	763
3300006943|Ga0099822_1086014	Not Available	732
3300006943|Ga0099822_1086176	Not Available	730
3300006943|Ga0099822_1086567	Not Available	725
3300006943|Ga0099822_1088226	Not Available	707
3300006943|Ga0099822_1089062	Not Available	698
3300006943|Ga0099822_1089987	Not Available	688
3300006943|Ga0099822_1090072	Not Available	687
3300006943|Ga0099822_1090905	Not Available	678
3300006943|Ga0099822_1091911	Not Available	669
3300006943|Ga0099822_1094163	Not Available	648
3300006943|Ga0099822_1095480	Not Available	637
3300006943|Ga0099822_1109419	Not Available	542
3300006943|Ga0099822_1113031	Not Available	523
3300006943|Ga0099822_1114568	Not Available	515
3300006944|Ga0099823_1049133	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	2652
3300006944|Ga0099823_1051268	Not Available	2507
3300006944|Ga0099823_1065561	Not Available	1752
3300006944|Ga0099823_1075534	Not Available	1401
3300006944|Ga0099823_1090599	Not Available	1047
3300006944|Ga0099823_1097077	Not Available	936
3300006944|Ga0099823_1113804	Not Available	734
3300006944|Ga0099823_1130904	Not Available	604
3300006944|Ga0099823_1131932	Not Available	598
3300006944|Ga0099823_1136049	Not Available	575
3300006944|Ga0099823_1137646	Not Available	566
3300006944|Ga0099823_1137943	Not Available	565
3300006944|Ga0099823_1144992	Not Available	531
3300021320|Ga0214544_1000091	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	117959
3300021320|Ga0214544_1001758	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	45425
3300021320|Ga0214544_1002127	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	41760
3300021320|Ga0214544_1012350	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	11169
3300021320|Ga0214544_1012803	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10648
3300021320|Ga0214544_1013597	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	9749
3300021320|Ga0214544_1018182	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	5948
3300021320|Ga0214544_1036608	Not Available	1253
3300021321|Ga0214542_1000966	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	56840
3300021321|Ga0214542_1001775	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	44656
3300021321|Ga0214542_1004087	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	29179
3300021321|Ga0214542_1006602	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	20978
3300021321|Ga0214542_1025039	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	3205
3300021324|Ga0214545_1010905	Not Available	12870
3300021324|Ga0214545_1020568	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	5230
3300021324|Ga0214545_1061633	Not Available	589
3300021327|Ga0214543_1017104	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	7247
3300021327|Ga0214543_1067520	Not Available	517
3300027296|Ga0209389_1017465	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	6478
3300027296|Ga0209389_1026046	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	5078
3300027296|Ga0209389_1026430	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	5030
3300027296|Ga0209389_1058466	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2448
3300027296|Ga0209389_1075178	Not Available	1752
3300027296|Ga0209389_1119376	Not Available	746
3300027296|Ga0209389_1121383	Not Available	720
3300027296|Ga0209389_1122275	Not Available	709
3300027296|Ga0209389_1125435	Not Available	669
3300027357|Ga0209589_1001281	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	40890
3300027357|Ga0209589_1034444	Not Available	2262

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Rhizosphere	Host-Associated → Plants → Rhizosphere	100.00%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	100.00%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	100.00%

Habitat

Habitat	Taxonomy	Distribution
Root Nodules	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules	83.19%
Root Nodules	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules	16.81%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Host-Associated
3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Host-Associated
3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Host-Associated
3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Host-Associated
3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Host-Associated
3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Host-Associated
3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes)	Host-Associated
3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0099822_100016517	3300006943	Root Nodules	MLDSDKKIFMAITLNFYIVVNKSYLYNYSEKITV*
Ga0099822_100032136	3300006943	Root Nodules	MLDGDTKILMTITLNFYIIMYKRYLYNYSEKLRYD*
Ga0099822_100037542	3300006943	Root Nodules	MLDGDKKIFMAITLNFDIVVNKNYLYNYSEKITV*
Ga0099822_10022709	3300006943	Root Nodules	MLDSDKKIFITITLNFYIVINKNYLYNYSEKIKV*
Ga0099822_100309136	3300006943	Root Nodules	MLDGDKQIFMTITLNFDIVVNKSYLYNYSEKFIV*
Ga0099822_100404124	3300006943	Root Nodules	MLDGDKKKFNAIILNFYIIVKKIYLYNYSKKITV*
Ga0099822_10055344	3300006943	Root Nodules	VSFELVYMLDGDKKLFMAITLNKSYLYNYSEKITV*
Ga0099822_10078561	3300006943	Root Nodules	MLDGDKIIFMTITLNFYIVVNKSYLYNYSEKITV*
Ga0099822_101119212	3300006943	Root Nodules	MLNGDKKKFMAITFNFYIIVNKSYLYNYSEKVTV*
Ga0099822_10115062	3300006943	Root Nodules	MLDDDKKNIHDNYIKFYIVVNKCHLYNYSEKITV**
Ga0099822_101156121	3300006943	Root Nodules	MLDGDRKIFMTITLNFDIVVNKSYLYNYSEKLQYD*
Ga0099822_10141869	3300006943	Root Nodules	MFDGDKKIMNITLNFYIIVKKIYLYNYSKKLHYDW*
Ga0099822_101503610	3300006943	Root Nodules	MLDGDKKIFMTMTLNLYIVVNKSYLYNYREKITS*
Ga0099822_10162273	3300006943	Root Nodules	MLDGDKKIFIAITLNFYIIVNKSYLYNYSEKIIV*
Ga0099822_101719812	3300006943	Root Nodules	MMLDSDKKIFMTITLKFYIVVNKGYLYNYSEKITV*
Ga0099822_101747512	3300006943	Root Nodules	MLDGDKKKFMAITLNFFIIVNKSYLYNYSKKITL*LIMS*
Ga0099822_101789610	3300006943	Root Nodules	MLNGDKKIFTKITLNFYILVNKSYLYNYSEKITV*
Ga0099822_10190803	3300006943	Root Nodules	MLGGDKKKIITITFNYYIIVNKFYLYNYSDKITHMIMG*
Ga0099822_10218462	3300006943	Root Nodules	MLDGDKKIMAITLNFYTIVNKIDLDNYSDKITVD*
Ga0099822_10237382	3300006943	Root Nodules	MLDGDKKIFMAITLKFYIVVIKIYLYSYSEKITV*
Ga0099822_10241032	3300006943	Root Nodules	MLDGDKKIFMTITLNFYIVVNKICLYNCSEKITV*
Ga0099822_10257163	3300006943	Root Nodules	MLDDDKRIFMAITLNFYIIVNKSYLFNYSEKITV*LIMS*
Ga0099822_10325905	3300006943	Root Nodules	MLHILDGDKKIFIGITFHFYMVVNRSYLYNYSEKIIV*
Ga0099822_10326142	3300006943	Root Nodules	MLDGDKKKFMTITINFYIVVNKSYLYNYSKKITV*
Ga0099822_10326862	3300006943	Root Nodules	MLDGDKKIFIIITLNFYIVVNKSYLYNYSEKIIV*
Ga0099822_10333647	3300006943	Root Nodules	MLDGDKKIFMAITLNFDIVVNESYSYNYSEKITI*
Ga0099822_10340902	3300006943	Root Nodules	MLDGDKKIFMTITLNFDIVVNKSYLYNYSEKITV*LI*
Ga0099822_10353101	3300006943	Root Nodules	MLDGDKKIFMKITLNFDIVVNKSYLYNYSEKITV*LI*
Ga0099822_10362503	3300006943	Root Nodules	MLDGDKKIFMTITLNLYIVVNKSYLYNYSEKVTV*
Ga0099822_10365014	3300006943	Root Nodules	VLDVDKKRIFMTITLNFYIVVNKNYLYNYSEKITVWLIMS*
Ga0099822_10390285	3300006943	Root Nodules	MLDGDKKIFMTITLNFYIVVNKSCYLYNYSEKIMV*
Ga0099822_10406362	3300006943	Root Nodules	MLDGDKKIFMTITLNFYIVVNKSYLYKYSEKIIV*
Ga0099822_10410797	3300006943	Root Nodules	MLDGDKKIFMTITLNFYIVVNKIYLYNYSKKITV*
Ga0099822_10438833	3300006943	Root Nodules	MLDGDKKIFIAITLNFYIVVNKSYLYNYSEKITV*LIIS*
Ga0099822_10457116	3300006943	Root Nodules	MLDSDKKKIHAITLNFYIIVNKSYLYNYSEKIIV*
Ga0099822_10478264	3300006943	Root Nodules	MLDGGKMKFMAITLNFYIIVNKFYLYNYSDKIIV*
Ga0099822_10507394	3300006943	Root Nodules	MLDGDKTKLIAITLNFYIIVNKIYLYSYSDKITV*
Ga0099822_10544121	3300006943	Root Nodules	F*TSIMLDGDKKIVMTITLKFYIVVNKSYLYNYSEKIIV*LIMS*
Ga0099822_10554811	3300006943	Root Nodules	MLDGDKQIFMTITLNFDIVVNKSYLYNYSEKITV*
Ga0099822_10583251	3300006943	Root Nodules	MLDGDKKILMTITLNFYIVVNKSYLYNYSDKITV*LIMS*
Ga0099822_10594871	3300006943	Root Nodules	MLDGDKKILITITLNFYIEVNKSYLYNCIGKITV*
Ga0099822_10604331	3300006943	Root Nodules	MLDGDKKILMTTTLNFYIVVNKSYLYNYSEKIIV*
Ga0099822_10611901	3300006943	Root Nodules	MLDGDKKILMTITLNLYIVVNKSYLYNYSDKITV*
Ga0099822_10655391	3300006943	Root Nodules	MLDGDKKIFMTITLNFYIVVNKSYLYNYSENITV*
Ga0099822_10660811	3300006943	Root Nodules	MLDGDKKILMTITLNFYIVVNKSYLYNYSEKLTV*
Ga0099822_10677051	3300006943	Root Nodules	KKILMTITLNFYIVVNKSYLYNYSEKITV*LIMS*
Ga0099822_10682591	3300006943	Root Nodules	MLDGDEKIFMTITLKFYIVVNKSYLYNYSSKITV*
Ga0099822_10685911	3300006943	Root Nodules	MLDGDKKILLTITLNFYIVVNKSYLYNYSDKITV*
Ga0099822_10686191	3300006943	Root Nodules	MLDGDKKLFMTITLNFYIAVNKSYLYNYSEKIII*
Ga0099822_10689941	3300006943	Root Nodules	SCIF*TSIMLDGDKKILMTITLNFYIVVNKSYLYNYSEKVTV*LIMS*
Ga0099822_10723151	3300006943	Root Nodules	MLDGDKTIFMTITLNFYIVVNKSYLYNYSKKITV*
Ga0099822_10770791	3300006943	Root Nodules	MLDGDKKIFMKITLNFYIVVNKSYLYNYSEKITI*
Ga0099822_10795641	3300006943	Root Nodules	MLDGDKKIFMTITLNFYIVVNKSYLYNYSEKITV*
Ga0099822_10818221	3300006943	Root Nodules	QYMLDGDKKIFMAITLNFYIVVNKSYLYNYSEKITI*LIMS*
Ga0099822_10834852	3300006943	Root Nodules	DLVSFEPIMLDGDKKIFMTITLNFYIVVNKSYLYNYSEKITI*
Ga0099822_10860141	3300006943	Root Nodules	MLDGDKKILMTITLNYYIVVNKSYLYNYSEKITV*
Ga0099822_10861761	3300006943	Root Nodules	MLDGNKKILMTITLNFYIIVNKSYLYNYSDKIAV*
Ga0099822_10865672	3300006943	Root Nodules	MLDGDKKILMTITLNFYIVVNKSYLYNYSEKITV*
Ga0099822_10882262	3300006943	Root Nodules	MLDGDKKIFMTIILDFYIVVNKSYLYNYSEKITV*
Ga0099822_10890621	3300006943	Root Nodules	MLDGDKKILMTIILNFYIVVNKSYLYNYSEKVTV*
Ga0099822_10899871	3300006943	Root Nodules	MLDGDKKILMTITLNFYIIVNKSYLYNYSEKITV*
Ga0099822_10900721	3300006943	Root Nodules	MLDGDKKILMTITLNLYIVVSKSYLYNYSDKITV*
Ga0099822_10909051	3300006943	Root Nodules	SYIF*TSIMLDGDKKIFMTITLDFYIVVNKSYLYNYSEKITI*
Ga0099822_10919111	3300006943	Root Nodules	MLDDDKKILITITLNFYIVVNKSYLYNYSEKIIV*
Ga0099822_10941631	3300006943	Root Nodules	F*TSIMLDGDKKIFMTITLDFYIVVNKSYLYNYSEKITV*
Ga0099822_10954801	3300006943	Root Nodules	MLDGDKKILMTITLNFYIVVNKSFLYNYSEKIIV*
Ga0099822_11094191	3300006943	Root Nodules	MLDSDKKILMTITLNFYIVVNKSYLYNYSEKMTV*
Ga0099822_11130311	3300006943	Root Nodules	MLDDDKKIFMTITLNFYIVVNKSYLYNYSEKITV*
Ga0099822_11145681	3300006943	Root Nodules	MLDGDKKLLMTIILNFYIVVNKSYLYNYSEKITV*
Ga0099823_10491335	3300006944	Root Nodules	SIMLDGDKKIFMTITLNFYIVVNKNYLYNYSEKITV*LIMS*
Ga0099823_10512684	3300006944	Root Nodules	MLDGDKNNSWKITLNFYIIVNKIYLYNYSEKIIV*
Ga0099823_10655613	3300006944	Root Nodules	YMLDGDKKIFLTITLNFYIVVNKSYLFNYNKKVTV*LIMS*
Ga0099823_10755342	3300006944	Root Nodules	MLDGDKKILMTITLNFYIVVNKSYLYNYSEKVTV*
Ga0099823_10905992	3300006944	Root Nodules	MLDGDKKIFMTITLNFDIVVNKSYLYNYSEKITV*
Ga0099823_10970772	3300006944	Root Nodules	MLDGDKKIFMAIILNFDIVLNKSYLYNYSEKITL*LI*
Ga0099823_11138041	3300006944	Root Nodules	NFNIDLVSFEPIMLDDDTKIFMTIILNFYIVLSKSCLYNYSEKLQYD*
Ga0099823_11309042	3300006944	Root Nodules	SYIF*TSIMLDGDKKIFMTITLDFYIVVNKSYLYNYSEKITV*
Ga0099823_11319321	3300006944	Root Nodules	NIDLVSFEPIMLDGDKKILMTITLNFYIVVNKSYLYNYSEKITV*
Ga0099823_11349801	3300006944	Root Nodules	MLDGDKKILMTITLNFYIVVNKNDLYNYSEKIKV*
Ga0099823_11360491	3300006944	Root Nodules	IF*TSIMLDGDKKILLTITLNFYIVVNKSYLYNYSDKITV**
Ga0099823_11376462	3300006944	Root Nodules	MLDGDKKIFMTITLDFYIVVNKSYLYNYSEKITI*
Ga0099823_11379431	3300006944	Root Nodules	KKILMTITLNFYIVVNKSYLYNYSEKVTV*LIMN*
Ga0099823_11449921	3300006944	Root Nodules	MLDGDKKIFMIITLNFYIVVNKSYLYNYSEKITV*
Ga0214544_100009166	3300021320	Root Nodules	MLDGDTKILMTITLNFYIIMYKRYLYNYSEKLRYD
Ga0214544_100175816	3300021320	Root Nodules	MLDGDKKIFMSITLNLYIVVNKSYLYNYSEKIIYD
Ga0214544_100212711	3300021320	Root Nodules	MLDGDRKIFMTITLNFDIVVNKSYLYNYSEKLQYD
Ga0214544_10052666	3300021320	Root Nodules	MLDVDKKKLMAVTLKFYIIVNQIYLYNYSDKITVX
Ga0214544_10123507	3300021320	Root Nodules	MFDGDKKIMNITLNFYIIVKKIYLYNYSKKLHYDW
Ga0214544_10128031	3300021320	Root Nodules	MLDGDKQIFMTITLNFDIVVNKSYLYNYSEKITVXLI
Ga0214544_10135978	3300021320	Root Nodules	MMLDSDKKIFMTITLKFYIVVNKGYLYNYSEKITV
Ga0214544_10181825	3300021320	Root Nodules	MLDGDKKILMTITLNFYIVVNKSYLYNYSEKITVXLIMS
Ga0214544_10366081	3300021320	Root Nodules	MLDGDKKILMTITLNFYIVVNKSYLYNYSDKITVXLIMS
Ga0214542_10009661	3300021321	Root Nodules	SIMLDGDKKILMTITLNFYIVVNKSYLYNYSDKITV
Ga0214542_100177527	3300021321	Root Nodules	MLDGDKKIFMSITLNLYIVVNKSYLYNYSEKIIYDX
Ga0214542_10040872	3300021321	Root Nodules	MLDGDKKIFMTITLNFDIVVNKSYLYNYSEKITVXLI
Ga0214542_10066021	3300021321	Root Nodules	MLDGNKKILMTITLNFYIIVNKSYLYNYSDKIAVXLIIS
Ga0214542_10250391	3300021321	Root Nodules	MLDGDKKIFMKITLNFDIVVNKSYLYNYSEKITVXLI
Ga0214545_10109051	3300021324	Root Nodules	MLDDDKRIFMAITLNFYIIVNKSYLFNYSEKITVXLIMS
Ga0214545_10205682	3300021324	Root Nodules	MLHILDGDKKIFIGITFHFYMVVNRSYLYNYSEKIIVXLIMS
Ga0214545_10616331	3300021324	Root Nodules	XTSIMLDGDKKILMTITLNFYIVVNKSYLYNYSEKITVXLIIS
Ga0214543_10171044	3300021327	Root Nodules	TSIMLDGDKKIVMTITLKFYIVVNKSYLYNYSEKIIVXLIMS
Ga0214543_10675201	3300021327	Root Nodules	RSYIFXTSIMLDGDKKIFMTITLDFYIVVNKSYLYNYSEKITV
Ga0209389_10174654	3300027296	Root Nodules	MLDVDKKIFMVIILNFSIIANKSYLYNYSEKITVXLIMS
Ga0209389_10260466	3300027296	Root Nodules	MLDGDNKNFMAITLNFYIVVNKSYLYNYSKKITIXLTMS
Ga0209389_10264303	3300027296	Root Nodules	MLDGDKNIFIAITSNFYIVVNKSCLYNYSEKIIVXLIMS
Ga0209389_10584662	3300027296	Root Nodules	MLDGDKKIFIAITLNFYIIVNKSYLYNYSEKIIVXLIMS
Ga0209389_10751782	3300027296	Root Nodules	YMLDGDKKIFLTITLNFYIVVNKSYLFNYNKKVTVXLIMS
Ga0209389_11193761	3300027296	Root Nodules	TSIMLDGDKKIFMTITLNFYIVVNKFYLYNYSKKITL
Ga0209389_11213831	3300027296	Root Nodules	GDKKIVMTITLKFYIVVNKSYLYNYSEKIIVXLIMS
Ga0209389_11222751	3300027296	Root Nodules	TSIMLDGDKKILMTITLNFYIVVNKSYLYNYSEKITVXLIMS
Ga0209389_11254351	3300027296	Root Nodules	TSIMLNGDKKILMTITLNFYIVVNKSYLYNYSEKNKK
Ga0209589_10012811	3300027357	Root Nodules	MLDGDKKIFMAIILNFDIVLNKSYLYNYSEKITLXLI
Ga0209589_10344441	3300027357	Root Nodules	IFXTSIMLDGDKKIFMTITLDFYIVVNKSYLYNYSEKITV