| Basic Information | |
|---|---|
| Family ID | F082213 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 45 residues |
| Representative Sequence | GVLLRSLPGDVPVGRASVGGTLAGPVAGHRYAAAVGLGLAGRAS |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.78 % |
| % of genes near scaffold ends (potentially truncated) | 92.92 % |
| % of genes from short scaffolds (< 2000 bps) | 88.50 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.487 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (50.443 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.097 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (49.558 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.56% β-sheet: 0.00% Coil/Unstructured: 69.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF16483 | Glyco_hydro_64 | 9.73 |
| PF01408 | GFO_IDH_MocA | 9.73 |
| PF00400 | WD40 | 6.19 |
| PF00753 | Lactamase_B | 2.65 |
| PF01381 | HTH_3 | 1.77 |
| PF00701 | DHDPS | 1.77 |
| PF07702 | UTRA | 1.77 |
| PF12681 | Glyoxalase_2 | 1.77 |
| PF04978 | DUF664 | 1.77 |
| PF00106 | adh_short | 0.88 |
| PF13302 | Acetyltransf_3 | 0.88 |
| PF02894 | GFO_IDH_MocA_C | 0.88 |
| PF01740 | STAS | 0.88 |
| PF00082 | Peptidase_S8 | 0.88 |
| PF10518 | TAT_signal | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 3.54 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.49 % |
| Unclassified | root | N/A | 34.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005436|Ga0070713_100510191 | Not Available | 1135 | Open in IMG/M |
| 3300005439|Ga0070711_100916027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 749 | Open in IMG/M |
| 3300005563|Ga0068855_101466757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 701 | Open in IMG/M |
| 3300005602|Ga0070762_10234881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Dongia → unclassified Dongia → Dongia sp. | 1134 | Open in IMG/M |
| 3300005719|Ga0068861_101059708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 777 | Open in IMG/M |
| 3300005764|Ga0066903_103810114 | Not Available | 810 | Open in IMG/M |
| 3300007076|Ga0075435_100682221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 892 | Open in IMG/M |
| 3300007788|Ga0099795_10502462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → unclassified Streptacidiphilus → Streptacidiphilus sp. P02-A3a | 565 | Open in IMG/M |
| 3300009088|Ga0099830_10597543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → unclassified Streptacidiphilus → Streptacidiphilus sp. P02-A3a | 905 | Open in IMG/M |
| 3300009088|Ga0099830_11533700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 555 | Open in IMG/M |
| 3300009090|Ga0099827_10029147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3961 | Open in IMG/M |
| 3300009792|Ga0126374_11666475 | Not Available | 529 | Open in IMG/M |
| 3300010046|Ga0126384_12307011 | Not Available | 520 | Open in IMG/M |
| 3300010333|Ga0134080_10269588 | Not Available | 756 | Open in IMG/M |
| 3300010361|Ga0126378_11294139 | Not Available | 824 | Open in IMG/M |
| 3300010366|Ga0126379_11106275 | Not Available | 898 | Open in IMG/M |
| 3300010366|Ga0126379_11483127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 784 | Open in IMG/M |
| 3300010376|Ga0126381_102977017 | Not Available | 673 | Open in IMG/M |
| 3300010398|Ga0126383_11523570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella deserti | 758 | Open in IMG/M |
| 3300010403|Ga0134123_11572363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 704 | Open in IMG/M |
| 3300010876|Ga0126361_10551526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1233 | Open in IMG/M |
| 3300012198|Ga0137364_10233792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1355 | Open in IMG/M |
| 3300012207|Ga0137381_10154342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1976 | Open in IMG/M |
| 3300012208|Ga0137376_10543906 | Not Available | 1006 | Open in IMG/M |
| 3300012363|Ga0137390_11030303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → unclassified Streptacidiphilus → Streptacidiphilus sp. P02-A3a | 774 | Open in IMG/M |
| 3300012925|Ga0137419_11464744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → unclassified Streptacidiphilus → Streptacidiphilus sp. P02-A3a | 578 | Open in IMG/M |
| 3300012929|Ga0137404_11663815 | Not Available | 592 | Open in IMG/M |
| 3300012948|Ga0126375_11263008 | Not Available | 618 | Open in IMG/M |
| 3300015264|Ga0137403_11111582 | Not Available | 636 | Open in IMG/M |
| 3300016371|Ga0182034_11289592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
| 3300016371|Ga0182034_11455798 | Not Available | 599 | Open in IMG/M |
| 3300016445|Ga0182038_10750891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 853 | Open in IMG/M |
| 3300018433|Ga0066667_11908638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 542 | Open in IMG/M |
| 3300021086|Ga0179596_10344927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 747 | Open in IMG/M |
| 3300021402|Ga0210385_10162890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1603 | Open in IMG/M |
| 3300021403|Ga0210397_11436098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → unclassified Streptacidiphilus → Streptacidiphilus sp. P02-A3a | 536 | Open in IMG/M |
| 3300021404|Ga0210389_11205544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → unclassified Streptacidiphilus → Streptacidiphilus sp. P02-A3a | 582 | Open in IMG/M |
| 3300021405|Ga0210387_11438534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → unclassified Streptacidiphilus → Streptacidiphilus sp. P02-A3a | 592 | Open in IMG/M |
| 3300021559|Ga0210409_10181980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1919 | Open in IMG/M |
| 3300021560|Ga0126371_10468618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 1406 | Open in IMG/M |
| 3300027662|Ga0208565_1100707 | Not Available | 870 | Open in IMG/M |
| 3300027855|Ga0209693_10018528 | Not Available | 3334 | Open in IMG/M |
| 3300027895|Ga0209624_10267859 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300027895|Ga0209624_10443659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → unclassified Streptacidiphilus → Streptacidiphilus sp. P02-A3a | 865 | Open in IMG/M |
| 3300027905|Ga0209415_10320788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1316 | Open in IMG/M |
| 3300027905|Ga0209415_10322057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1312 | Open in IMG/M |
| 3300027908|Ga0209006_11454272 | Not Available | 521 | Open in IMG/M |
| 3300031543|Ga0318516_10369296 | Not Available | 827 | Open in IMG/M |
| 3300031543|Ga0318516_10831858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300031544|Ga0318534_10052429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2286 | Open in IMG/M |
| 3300031544|Ga0318534_10186517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1198 | Open in IMG/M |
| 3300031545|Ga0318541_10405098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 762 | Open in IMG/M |
| 3300031549|Ga0318571_10118360 | Not Available | 886 | Open in IMG/M |
| 3300031549|Ga0318571_10195336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 721 | Open in IMG/M |
| 3300031572|Ga0318515_10009427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4289 | Open in IMG/M |
| 3300031572|Ga0318515_10196232 | Not Available | 1081 | Open in IMG/M |
| 3300031572|Ga0318515_10544099 | Not Available | 619 | Open in IMG/M |
| 3300031573|Ga0310915_10516506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 848 | Open in IMG/M |
| 3300031573|Ga0310915_10747902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 689 | Open in IMG/M |
| 3300031640|Ga0318555_10030828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2609 | Open in IMG/M |
| 3300031670|Ga0307374_10166950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1661 | Open in IMG/M |
| 3300031679|Ga0318561_10835184 | Not Available | 506 | Open in IMG/M |
| 3300031713|Ga0318496_10743266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
| 3300031723|Ga0318493_10043809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2091 | Open in IMG/M |
| 3300031724|Ga0318500_10372932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
| 3300031751|Ga0318494_10311914 | Not Available | 908 | Open in IMG/M |
| 3300031778|Ga0318498_10086707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1414 | Open in IMG/M |
| 3300031778|Ga0318498_10197250 | Not Available | 913 | Open in IMG/M |
| 3300031782|Ga0318552_10101249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1421 | Open in IMG/M |
| 3300031782|Ga0318552_10253378 | Not Available | 893 | Open in IMG/M |
| 3300031782|Ga0318552_10342324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 761 | Open in IMG/M |
| 3300031792|Ga0318529_10353244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
| 3300031792|Ga0318529_10494170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300031793|Ga0318548_10351662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 723 | Open in IMG/M |
| 3300031798|Ga0318523_10082875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1555 | Open in IMG/M |
| 3300031798|Ga0318523_10446749 | Not Available | 641 | Open in IMG/M |
| 3300031799|Ga0318565_10293264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
| 3300031805|Ga0318497_10644217 | Not Available | 594 | Open in IMG/M |
| 3300031821|Ga0318567_10547652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 657 | Open in IMG/M |
| 3300031831|Ga0318564_10479009 | Not Available | 541 | Open in IMG/M |
| 3300031833|Ga0310917_10504702 | Not Available | 823 | Open in IMG/M |
| 3300031860|Ga0318495_10266614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 765 | Open in IMG/M |
| 3300031894|Ga0318522_10026955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1915 | Open in IMG/M |
| 3300031896|Ga0318551_10341597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 846 | Open in IMG/M |
| 3300031896|Ga0318551_10348129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 838 | Open in IMG/M |
| 3300031897|Ga0318520_10959642 | Not Available | 539 | Open in IMG/M |
| 3300031912|Ga0306921_11506327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
| 3300031941|Ga0310912_11119896 | Not Available | 601 | Open in IMG/M |
| 3300031942|Ga0310916_10405179 | Not Available | 1161 | Open in IMG/M |
| 3300031954|Ga0306926_10968489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1014 | Open in IMG/M |
| 3300032001|Ga0306922_11287696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 740 | Open in IMG/M |
| 3300032009|Ga0318563_10029020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2757 | Open in IMG/M |
| 3300032009|Ga0318563_10326050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 831 | Open in IMG/M |
| 3300032052|Ga0318506_10268839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 756 | Open in IMG/M |
| 3300032055|Ga0318575_10320547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Acidothermales → unclassified Acidothermales → Acidothermales bacterium | 784 | Open in IMG/M |
| 3300032055|Ga0318575_10350555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 748 | Open in IMG/M |
| 3300032055|Ga0318575_10427358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300032063|Ga0318504_10276431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 793 | Open in IMG/M |
| 3300032064|Ga0318510_10082045 | Not Available | 1200 | Open in IMG/M |
| 3300032067|Ga0318524_10221815 | Not Available | 969 | Open in IMG/M |
| 3300032067|Ga0318524_10551114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300032068|Ga0318553_10414357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 705 | Open in IMG/M |
| 3300032076|Ga0306924_11656311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300032076|Ga0306924_11686374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 665 | Open in IMG/M |
| 3300032090|Ga0318518_10197840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1029 | Open in IMG/M |
| 3300032180|Ga0307471_101202335 | Not Available | 922 | Open in IMG/M |
| 3300033004|Ga0335084_12460953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
| 3300034820|Ga0373959_0003155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2626 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 50.44% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.08% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025574 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070713_1005101911 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LRSLPGAVAVGRGNVGGTLAGTPAGHRYAAALGLALAGNE* |
| Ga0070711_1009160272 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LRALPGDVPVGRASVGGTLAGALAGHRYAAAVGLGLARPDR* |
| Ga0070665_1014013552 | 3300005548 | Switchgrass Rhizosphere | PDGVSAGRANVGATLAGPPAGHRHAAALGLALAGGPG* |
| Ga0068855_1014667571 | 3300005563 | Corn Rhizosphere | ELLGVLLRALPDGVSAGRANVGATLAGPPAGHRHAAALGLALAGGPG* |
| Ga0070762_102348813 | 3300005602 | Soil | DEELLGVLLRSLPDGVAAGRGNVGATLPGPSPGHRYAAALGLAMADDSG* |
| Ga0068861_1010597082 | 3300005719 | Switchgrass Rhizosphere | VLLRSLPGAVAVGRGNVGGTLAGTPAGHRYAAALGLALAGNG* |
| Ga0066903_1038101141 | 3300005764 | Tropical Forest Soil | LPGDVPVGRASVGGTLDGPPAGHRYAAAVGLGLSALAETEP* |
| Ga0075435_1006822212 | 3300007076 | Populus Rhizosphere | PGAVAVGRGNVGGTLAGTPAGHRYAAALGLALAGNG* |
| Ga0099795_105024622 | 3300007788 | Vadose Zone Soil | DELLGVLLRTLPEGVIAGRGNVGGTLAGPSAGHRHAAALGLALAPPDRAVP* |
| Ga0099830_105975431 | 3300009088 | Vadose Zone Soil | ELLGVLLRTLPEGVTAGRGNVGGTLAGPAAGHRHAAALGLALAPPERAVP* |
| Ga0099830_115337001 | 3300009088 | Vadose Zone Soil | LLGVLLRTLPAGVPVGRANVGGTLAGPAAGHRHAVALGLALARD* |
| Ga0099827_100291473 | 3300009090 | Vadose Zone Soil | DDELAGVLARSLPDTVMIGRASVGGTLDGGPLGHRYAAALGLALAPGRP* |
| Ga0126374_116664753 | 3300009792 | Tropical Forest Soil | AGDDELLGVLLRSLPGDVPVGRASVGGTLDGPPAGHRYAAAVGLGLSALPEIER* |
| Ga0126384_123070113 | 3300010046 | Tropical Forest Soil | VPVGRASVGGTLGGPPAGHRYAAAVGLGLSALPEIKR* |
| Ga0134080_102695881 | 3300010333 | Grasslands Soil | MLGVLLRSLPTAVAVGRGNVGGTLAGTPAGHRYAAALGLALAGNG* |
| Ga0126372_126295332 | 3300010360 | Tropical Forest Soil | LRSLPGDVPVGRASVGGTLRGAPAGHRYAAAVGLAMGYPPLIPVSASV* |
| Ga0126378_112941392 | 3300010361 | Tropical Forest Soil | VVLRSLPGDVPVGRASVGGTLTGAPVGHRYAAAVGLAMTRRAAG* |
| Ga0126379_111062751 | 3300010366 | Tropical Forest Soil | LLRSLPGDVPVGRASVGGTLDGPPAGHRYAAAVGLGLSALAEIEP* |
| Ga0126379_114831272 | 3300010366 | Tropical Forest Soil | LRALPGDSPVGRASVGGTLAGAAAGHRYAAAVGLGLADPAV* |
| Ga0126381_1029770172 | 3300010376 | Tropical Forest Soil | GDDELLGVLLRSLPGDVPVGRASVGGTLAGPVAGHRYAAAVGLGLAGRGS* |
| Ga0126381_1036205202 | 3300010376 | Tropical Forest Soil | DELLGVLLRSLPGDVPVGRASVGGTLRGAPAGHRYAAAVGLAMRYPPLIPVSASG* |
| Ga0126383_115235702 | 3300010398 | Tropical Forest Soil | VLLRSLPGDVPVGRASVGGTLDGPPAGHRYAAAVGLALSALPRN* |
| Ga0134123_115723632 | 3300010403 | Terrestrial Soil | DDEMLGVLLRSLPGAVAVGRGNVGGTLAGSPAGHRYAAALGLALAGNE* |
| Ga0126361_105515261 | 3300010876 | Boreal Forest Soil | DELLGVLLRALPGDVPVGRASVGGTLAGALAGHRYAAAVGLGLARPAQ* |
| Ga0137364_102337922 | 3300012198 | Vadose Zone Soil | MLGVLLRSLPGAVAVGRGNVGGTLTGTPAGHRYAAALGLALAGNG* |
| Ga0137381_101543421 | 3300012207 | Vadose Zone Soil | DDELLGVLLRALPAGVSVGRADVGGTLAGSPVGHRYAVALGLALGDVPRGS* |
| Ga0137376_105439062 | 3300012208 | Vadose Zone Soil | MLGVLLCSLPGAVAVGRGNVGGTLTGTPAGHRYAAALGLALAGNG* |
| Ga0137390_110303032 | 3300012363 | Vadose Zone Soil | ELLGVLLRTLPDGVTAGRGNVGGTLAGPSAGHRHAAALGLALAPPERAVP* |
| Ga0137419_114647441 | 3300012925 | Vadose Zone Soil | DELLGVLLRTLPEGVTAGRGNVGGTLAGPSAGHRHAAALGLALAPPDRAVP* |
| Ga0137404_116638151 | 3300012929 | Vadose Zone Soil | LRSLPAAVAVGRGNVGGTLTGTPAGHRYAAALGLALAGNG* |
| Ga0126375_112630082 | 3300012948 | Tropical Forest Soil | LGVLLRSLPGDIPVGRASVGGTLDGPPAGHRYAAAVGLGLSALAELGL* |
| Ga0137403_111115821 | 3300015264 | Vadose Zone Soil | AGDDEMLGVLLRSLPAAVAVGRGNVGGTLTGTPAGHRYAAALGLALAGNG* |
| Ga0182034_112895922 | 3300016371 | Soil | LLRALPGHVPVGRATVGGTLAGPPAGHRYAAAVGLGLTTPTS |
| Ga0182034_114557982 | 3300016371 | Soil | GVLLRSLPGDVPVGRASVGGTLAGPVAGHRYAAAVGLGLAGRAS |
| Ga0182038_107508912 | 3300016445 | Soil | LRSLPGEVPVGRASVGGTLAGPVAGHRYAAAVGLGLAGRGS |
| Ga0066667_119086382 | 3300018433 | Grasslands Soil | VLLRSLPGAVAAGRGNVGGTLTGAAAGHRYAAALGLALAGND |
| Ga0179596_103449271 | 3300021086 | Vadose Zone Soil | AGDDELLGVLLRTLPDGVPAGRASVGGTLPGQPVGHRYAVALGLALSQR |
| Ga0210385_101628902 | 3300021402 | Soil | PAGDDELLGVLLRALPGAVPVGRASVGATLTGPPAGHRYAAAVGLALAPGTP |
| Ga0210397_114360981 | 3300021403 | Soil | ELLGVLLRTLPDGVTAGRGNVGGTLAGPAAGHRHAAALGLALAPGGTAS |
| Ga0210389_112055442 | 3300021404 | Soil | VLLRTLPEGVTAGRGNVGGTLAGPAAGHRHAAALGLALAPGGTAS |
| Ga0210387_114385341 | 3300021405 | Soil | ELLGVLLRTLPDGVTAGRGNVGGTLAGPAAGHRHAAALGLALAPPT |
| Ga0210409_101819801 | 3300021559 | Soil | LPGDVPVGRASVGGTLAGPAAGHRYAAAVGLGLAARGS |
| Ga0126371_104686182 | 3300021560 | Tropical Forest Soil | VLLRALPGDIPVGRASVGGTLAGAPAGHRYAAAVGLGLAGPTA |
| Ga0208717_10391232 | 3300025574 | Arctic Peat Soil | LPEGVTAGRGNVGGTLAGPAAGHRHAAALGLALAPGDTAS |
| Ga0207700_103551462 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LRAWPDGVTAGRGNVGGTLAGPSAGHRHAAALGLALAPPT |
| Ga0208565_11007071 | 3300027662 | Peatlands Soil | GVLLRALPDGIAAGRGNVGGTLDGPPAGHRYAAALGLALAAAE |
| Ga0209693_100185284 | 3300027855 | Soil | AGDDELLGVLLRTLPEGVTAGRGNVGGTLAGPAAGHRHAAALGLALAPGGTAS |
| Ga0209624_102678591 | 3300027895 | Forest Soil | DELLGVLLRSLPEGITVGRGDVGGTLPGISAGHRHAAALGLALAATQRATRQG |
| Ga0209624_104436592 | 3300027895 | Forest Soil | VLLRTLPEGVTAGRGNVGGTLAGPAAGHRHAAALGLALAPGARPVNARS |
| Ga0209415_103207881 | 3300027905 | Peatlands Soil | LIGVLLRALPDGIAAGRGNVGGTLDGPPAGHRYAAALGLALAAAE |
| Ga0209415_103220571 | 3300027905 | Peatlands Soil | LIGVLLRALPDGIAAGRGNVGGTLDGPPAGHRYAAALGLALAAAAE |
| Ga0209006_114542721 | 3300027908 | Forest Soil | LLRALPGDVPVGRASVGGTLAGALAGHRYAAAVGLGLARPDR |
| Ga0318516_103692961 | 3300031543 | Soil | LLGVLLRSLPGDVPVGRASVGGTLDGPPAGHRYAAAVGLGLSALAEAEQ |
| Ga0318516_108318582 | 3300031543 | Soil | VVLRSLPADVPVGRANVGGTLAGPPVGHRYAAAVGLAMAAS |
| Ga0318534_100524291 | 3300031544 | Soil | LPGDVPVGRASVGGTLAGPPAGHRYAAAVGLAMTGSSVPPS |
| Ga0318534_101865172 | 3300031544 | Soil | VLLRSLPGEVPVGRASVGGTLAGPVAGHRYAAAVGLGLAGRGS |
| Ga0318541_104050982 | 3300031545 | Soil | DIPVGRASVGGTLAGTPAGHRYAAAVGLGLAGPTV |
| Ga0318571_101183602 | 3300031549 | Soil | LGVLLRSLPGDVPVGRASVGGTLDGPPAGHRYAAAVGLGLSALGEAEQ |
| Ga0318571_101953362 | 3300031549 | Soil | DDELLGVLLRSLPGDVPVGRASVGGTLDGPPAGHRYAAAVGLGLSALAETDL |
| Ga0318515_100094271 | 3300031572 | Soil | AGDDELLGVLLRALPGDIPVGRASVGGTLAGAPAGHRYAAAVGLGLAGPAV |
| Ga0318515_101962321 | 3300031572 | Soil | LLGVLLRALPGEVPVGRASVGGTLAGPPAGHRYAAAVGLGLADHAR |
| Ga0318515_105440991 | 3300031572 | Soil | DDELLGVLLRSLPGDVPVGRASVGGTLDGPPAGHRYAAAVGLGLSALAETEL |
| Ga0310915_105165061 | 3300031573 | Soil | SLPGDVPVGRASVGGTLAGPVAGHRYAAAVGLGLAGRAS |
| Ga0310915_107479022 | 3300031573 | Soil | GDVPVGRASVGGTLDGPPAGHRYAAAVGLGLSALAEAEQ |
| Ga0318555_100308284 | 3300031640 | Soil | LLRALPGEVPVGRASVGGTLAGPPAGHRYAAAVGLGLADHAR |
| Ga0307374_101669503 | 3300031670 | Soil | LRTLPAGVAAGRGNVGGTLGGPPAGHRYAAALGLALAGG |
| Ga0318561_108351841 | 3300031679 | Soil | DDELLGVLLRSLPGDVLVGRASVGGTLDGPPAGHRYVAAVGLGLSALAEIEP |
| Ga0318496_107432661 | 3300031713 | Soil | DDELLGVLLRSLSGDVPVGRASVGGTLDGPSAGHRYAAAMGLGLSALAD |
| Ga0318493_100438092 | 3300031723 | Soil | DELLGVLLRALPGDIPVGRASVGGTLAGAPAGHRYAAAVGLGLAGPAV |
| Ga0318500_103729321 | 3300031724 | Soil | LLRSLPGDVPVGRASVGGTLGGAPAGHRYAAAVGLAMTGSAVR |
| Ga0318494_103119142 | 3300031751 | Soil | LRSLPADVPVGRANVGGTLAGPPVGHRYAAAVGLAMAGS |
| Ga0318498_100867072 | 3300031778 | Soil | AYRCPAGDDELLGVLLRSLPGDVPVGRASVGGTLAGPVAGHRYAAAVGLGLAGRGS |
| Ga0318498_101972502 | 3300031778 | Soil | PGDVLVGRASVGGTLDGPPAGHRYVAAVGLGLSALAEIEP |
| Ga0318552_101012491 | 3300031782 | Soil | DDELLGVLLRSLPGDVPVGRASVGGTLAGPVAGHRYAAAVGLGLAGRGS |
| Ga0318552_102533782 | 3300031782 | Soil | PGDVPVGRANVGGTLDGPPAGHRYAAAVGLGLSALAETEL |
| Ga0318552_103423241 | 3300031782 | Soil | PAGDDELLGVVLRSLPGDVPVGRASVGGTLAGPPAGHRYAAAVGLAMTGSSVPPS |
| Ga0318529_103532441 | 3300031792 | Soil | SLPSDVPVGRASVGGTLDGPPAGHRYAAAVGLGLSALAEAEQ |
| Ga0318529_104941701 | 3300031792 | Soil | GVLLRSLPGDVPVGRASVGGTLASAPVGHRYAAAVGLAMTGSATPPS |
| Ga0318548_103516621 | 3300031793 | Soil | LLRSLPGDVPVGRASVGGTLAGPVAGHRYAAAVGLGLAGRGS |
| Ga0318523_100828751 | 3300031798 | Soil | VLLRSLPGDVPVGRARVGGTLAGPVAGHRYAAAVGLGLAGRGS |
| Ga0318523_104467491 | 3300031798 | Soil | ELLGVLLRALPGEIPVGRASVGGTLAGTPAGHRYAAAVGLGLAGPTV |
| Ga0318565_102932642 | 3300031799 | Soil | GDDELLGVLLRSLPSDVPVGRASVGGTLDGPPAGHRYAAAVGLGLSALAEAEQ |
| Ga0318497_106442172 | 3300031805 | Soil | DVPVGRASVGGTLAGPVAGHRYAAAVGLGLAGRAS |
| Ga0318567_105476521 | 3300031821 | Soil | VVLRSLPGDVPVGRASVGGTLAGPPAGHRYAAAVGLAMTGSSVPPS |
| Ga0318564_104790091 | 3300031831 | Soil | VLLRSLPGDVLVGRASVGGTLDGPPAGHRYVAAVGLGLSALAEIEP |
| Ga0310917_105047021 | 3300031833 | Soil | GVVQRSLPADVPVGRANVGGTLAGPPVGHRYAAAVGLAMAGS |
| Ga0318495_102666141 | 3300031860 | Soil | VVLRSLPVDVPVGRASVGGTLAGPPAGHRYAAAVGLAMTGSSVPPS |
| Ga0318522_100269552 | 3300031894 | Soil | RALPGDIPVGRASVGGTLAGAPAGHRYAAAVGLGLAGPAV |
| Ga0318551_103415973 | 3300031896 | Soil | LLGVLMRSLPGDVPVGRASVGGALHGPPAGHRYAAAVGLGLSAPPEAAQ |
| Ga0318551_103481291 | 3300031896 | Soil | VLRSLPGDVPVGRASVGGTLAGPPAGHRYAAAVGLAMTGSSVPPS |
| Ga0318520_109596422 | 3300031897 | Soil | DELLGVVLRSLPGDVPVGRASVGGTLAGPPAGHRYAAAVGLAMTGSSVPPS |
| Ga0306921_115063271 | 3300031912 | Soil | VGRASVGGTLEGPPAGHRYAAAVGLGLSAPPEAAQ |
| Ga0310912_111198962 | 3300031941 | Soil | DDELLGVLLRALPGDIPVGRASVGGTLAGAPAGHRYAAAVGLGLAGPAV |
| Ga0310916_104051791 | 3300031942 | Soil | PAGDDELLGVLLRALPGEVPVGRASVGGTLAGPPAGHRYAAAVGLGLADHAR |
| Ga0306926_109684892 | 3300031954 | Soil | LLGVLLRSLPGDVPVGRASVGGTLDGPPAGHRYAAAVGLGLSALAETEL |
| Ga0306922_112876962 | 3300032001 | Soil | LPADVPVGRANVGGTLAGPPVGHRYAAAVGLAMAAS |
| Ga0318563_100290201 | 3300032009 | Soil | LLRALPGEVPVGRASVGGTLAGPPAGHRYAAAVGLGLADHAQ |
| Ga0318563_103260502 | 3300032009 | Soil | LLRALPGDIPVGRASVGGTLAGTPAGHRYAAAVGLGLAGPTV |
| Ga0318506_102688391 | 3300032052 | Soil | VLLRSLPGDVLVGRASVGGTLDGPPAGHRYVAAVGLGLSALA |
| Ga0318575_103205472 | 3300032055 | Soil | PGDVPVGRASVGGTLAGPVAGHRYAAAVGLGLAGRAS |
| Ga0318575_103505552 | 3300032055 | Soil | LLGVLLRSLPGDVPVGRASVGGTLDGPPAGHRYAAAVGLGLSALAETDL |
| Ga0318575_104273582 | 3300032055 | Soil | SLPGDVPVGRASVGGTLDGPPAGHRYAAAVGLGLSALAEAEQ |
| Ga0318504_102764312 | 3300032063 | Soil | AGDDELLGVLLRALPGDVPVGRATVGGTLAGPPAGHRYAAAVGLGLTAPTS |
| Ga0318510_100820451 | 3300032064 | Soil | LLGVLLRSLPGDVPVGRASVGGTLDGPPAGHRYAAAVGLGLSALGEAEQ |
| Ga0318524_102218151 | 3300032067 | Soil | VLLRALPGEVPVGRASVGGTLAGPPAGHRYAAAVGLGLADHAQ |
| Ga0318524_105511141 | 3300032067 | Soil | LLGVLLRSLPGDVPVGRASVGGTLRGAPAGHRYAAAVGLAMTGSAVR |
| Ga0318553_104143571 | 3300032068 | Soil | VLLRSLPSDVPVGRASVGGTLDGPPAGHRYAAAVGLGLSALAEAEQ |
| Ga0306924_116563112 | 3300032076 | Soil | LLGVVLRSLPADVPVGRANVGGTLAGPPVGHRYAAAVGLAMAAS |
| Ga0306924_116863741 | 3300032076 | Soil | GVLLRALPGDIPVGRASVGGTLAGTPAGHRYAAAVGLGLAGPTV |
| Ga0318518_101978401 | 3300032090 | Soil | DELLGVLLRALPGDIPVGRASVGGTLAGTPAGHRYAAAVGLGLAGPTV |
| Ga0307471_1012023351 | 3300032180 | Hardwood Forest Soil | VVLRSLPGDVPVGRASVGATLAGSPVGHRYAAAVGLAMAVPGPAAGQRDR |
| Ga0335084_124609532 | 3300033004 | Soil | DDEMLGVLLRSLPGAVAVGRGNVGGTLAGTPAGHRYAAALGLALAGNG |
| Ga0373959_0003155_3_131 | 3300034820 | Rhizosphere Soil | VLLRSLPGAVAVGRGNVGGTLAGTPAGHRYAAALGLALAGNG |
| ⦗Top⦘ |