| Basic Information | |
|---|---|
| Family ID | F082115 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 42 residues |
| Representative Sequence | AQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNE |
| Number of Associated Samples | 71 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.77 % |
| % of genes near scaffold ends (potentially truncated) | 96.46 % |
| % of genes from short scaffolds (< 2000 bps) | 71.68 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (68.142 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (43.363 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.832 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (89.381 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.48% β-sheet: 0.00% Coil/Unstructured: 59.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF08299 | Bac_DnaA_C | 6.19 |
| PF01844 | HNH | 5.31 |
| PF13392 | HNH_3 | 4.42 |
| PF02195 | ParBc | 4.42 |
| PF07460 | NUMOD3 | 3.54 |
| PF00303 | Thymidylat_synt | 3.54 |
| PF06378 | DUF1071 | 2.65 |
| PF03796 | DnaB_C | 2.65 |
| PF01832 | Glucosaminidase | 2.65 |
| PF00583 | Acetyltransf_1 | 2.65 |
| PF00772 | DnaB | 1.77 |
| PF12684 | DUF3799 | 1.77 |
| PF13453 | zf-TFIIB | 0.88 |
| PF08774 | VRR_NUC | 0.88 |
| PF13479 | AAA_24 | 0.88 |
| PF01507 | PAPS_reduct | 0.88 |
| PF13649 | Methyltransf_25 | 0.88 |
| PF13673 | Acetyltransf_10 | 0.88 |
| PF05050 | Methyltransf_21 | 0.88 |
| PF00535 | Glycos_transf_2 | 0.88 |
| PF05866 | RusA | 0.88 |
| PF06941 | NT5C | 0.88 |
| PF13730 | HTH_36 | 0.88 |
| PF10544 | T5orf172 | 0.88 |
| PF01541 | GIY-YIG | 0.88 |
| PF13481 | AAA_25 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 6.19 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 4.42 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 3.54 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 2.65 |
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.88 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 68.14 % |
| All Organisms | root | All Organisms | 31.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 43.36% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 15.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.62% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 10.62% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 8.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.31% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.42% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300008106 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-53-LTR | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300027145 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027147 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027285 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300027295 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027299 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300027301 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300027375 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300027534 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027589 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300027594 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_100507895 | 3300000756 | Freshwater And Sediment | IHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNE* |
| JGI25908J49247_100340025 | 3300003277 | Freshwater Lake | MFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNNGQ* |
| JGI25908J49247_100398464 | 3300003277 | Freshwater Lake | QMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNQTFGDESNT* |
| JGI25909J50240_10364131 | 3300003393 | Freshwater Lake | DMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNNGQ* |
| JGI25907J50239_10494494 | 3300003394 | Freshwater Lake | KALEQAEAMRKDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNQTFGDESNT* |
| JGI25912J50252_100535295 | 3300003412 | Freshwater Lake | MDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNE* |
| JGI25912J50252_100972433 | 3300003412 | Freshwater Lake | DMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNNG* |
| JGI25912J50252_101147003 | 3300003412 | Freshwater Lake | MDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGEQ* |
| JGI25926J51410_10326981 | 3300003490 | Freshwater Lake | DMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGEQ* |
| JGI25926J51410_10710971 | 3300003490 | Freshwater Lake | DMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNQTFGDESNT* |
| Ga0007759_100523433 | 3300004836 | Freshwater Lake | AQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNQTFGDESNT* |
| Ga0049081_100291991 | 3300005581 | Freshwater Lentic | NAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGEQ* |
| Ga0049081_101024921 | 3300005581 | Freshwater Lentic | MFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNND* |
| Ga0049081_103475491 | 3300005581 | Freshwater Lentic | KDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNQTFGDESNT* |
| Ga0049084_101384481 | 3300005585 | Freshwater Lentic | AQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNK* |
| Ga0114339_12086801 | 3300008106 | Freshwater, Plankton | EAMRKDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNK* |
| Ga0114340_10159641 | 3300008107 | Freshwater, Plankton | DMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNK* |
| Ga0114340_11238391 | 3300008107 | Freshwater, Plankton | MFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNEQH* |
| Ga0114340_12177381 | 3300008107 | Freshwater, Plankton | NAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNNGQ* |
| Ga0114343_100028451 | 3300008110 | Freshwater, Plankton | IHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNND* |
| Ga0114344_10301861 | 3300008111 | Freshwater, Plankton | KNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETF* |
| Ga0114344_12520101 | 3300008111 | Freshwater, Plankton | KNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNEQH* |
| Ga0114346_10418491 | 3300008113 | Freshwater, Plankton | NAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNND* |
| Ga0114346_11471074 | 3300008113 | Freshwater, Plankton | KNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGGEQ* |
| Ga0114347_100077938 | 3300008114 | Freshwater, Plankton | LKTENKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNK* |
| Ga0114347_10516911 | 3300008114 | Freshwater, Plankton | MFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNE* |
| Ga0114350_11469071 | 3300008116 | Freshwater, Plankton | FIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNE* |
| Ga0114351_100121149 | 3300008117 | Freshwater, Plankton | MFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNK* |
| Ga0114840_100009038 | 3300008258 | Freshwater, Plankton | MLXXXXXXXKDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNK* |
| Ga0114841_100048938 | 3300008259 | Freshwater, Plankton | MDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNK* |
| Ga0114353_11248364 | 3300008264 | Freshwater, Plankton | HLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNND* |
| Ga0114363_11175425 | 3300008266 | Freshwater, Plankton | QMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGKQ* |
| Ga0114364_10314171 | 3300008267 | Freshwater, Plankton | KDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGE* |
| Ga0114878_100055338 | 3300008339 | Freshwater Lake | QMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNK* |
| Ga0114876_11178211 | 3300008448 | Freshwater Lake | FIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNEQH* |
| Ga0114876_12659731 | 3300008448 | Freshwater Lake | KNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYK* |
| Ga0114880_11010124 | 3300008450 | Freshwater Lake | EIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNQTFGDESNT* |
| Ga0114880_12123521 | 3300008450 | Freshwater Lake | QMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGGKQ* |
| Ga0177922_100459285 | 3300013372 | Freshwater | AQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNND* |
| Ga0177922_101284011 | 3300013372 | Freshwater | EIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGEQ* |
| Ga0177922_103215731 | 3300013372 | Freshwater | MRKDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYEQTYGGGEQ* |
| Ga0177922_105613641 | 3300013372 | Freshwater | AMRKDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGE* |
| Ga0177922_109338311 | 3300013372 | Freshwater | QMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETHGGNK* |
| Ga0177922_113033961 | 3300013372 | Freshwater | EIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNNGQ* |
| Ga0181338_10323441 | 3300015050 | Freshwater Lake | KALEQAEAMRKDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETF* |
| Ga0181339_10178011 | 3300017700 | Freshwater Lake | NAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNE |
| Ga0181364_10238681 | 3300017701 | Freshwater Lake | QMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNQTFGDESNP |
| Ga0181364_10498681 | 3300017701 | Freshwater Lake | QMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNQTFGDESNT |
| Ga0181350_10000651 | 3300017716 | Freshwater Lake | MDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGEQ |
| Ga0181350_10768164 | 3300017716 | Freshwater Lake | RKDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNQTFGDESNT |
| Ga0181352_10408591 | 3300017747 | Freshwater Lake | RKDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNKTFDQ |
| Ga0181356_10681581 | 3300017761 | Freshwater Lake | MFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNK |
| Ga0181356_10718013 | 3300017761 | Freshwater Lake | KNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGE |
| Ga0181357_10456067 | 3300017777 | Freshwater Lake | DEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNK |
| Ga0181357_10681694 | 3300017777 | Freshwater Lake | AQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGE |
| Ga0181346_101510810 | 3300017780 | Freshwater Lake | RKDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNNG |
| Ga0181346_10212186 | 3300017780 | Freshwater Lake | IHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGEQ |
| Ga0181346_10625106 | 3300017780 | Freshwater Lake | KNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGEGEQ |
| Ga0181346_10665621 | 3300017780 | Freshwater Lake | DEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGE |
| Ga0181348_10179251 | 3300017784 | Freshwater Lake | AMRKDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGE |
| Ga0181361_1150613 | 3300019783 | Freshwater Lake | FIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNNGQ |
| Ga0181359_100106321 | 3300019784 | Freshwater Lake | AQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETF |
| Ga0181359_10274697 | 3300019784 | Freshwater Lake | LNNLPYGLEYLEKRQSAEDFSQQYYNQTFGDESNP |
| Ga0181359_10683196 | 3300019784 | Freshwater Lake | HLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGEQ |
| Ga0181359_11597744 | 3300019784 | Freshwater Lake | KDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGEQ |
| Ga0181354_10406924 | 3300022190 | Freshwater Lake | IHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGE |
| Ga0181354_10471311 | 3300022190 | Freshwater Lake | HLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGSEQ |
| Ga0181351_11064771 | 3300022407 | Freshwater Lake | KDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNQTFGDESNT |
| Ga0255114_10299016 | 3300027145 | Freshwater | MDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNK |
| Ga0255113_10342273 | 3300027147 | Freshwater | DMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNND |
| Ga0255131_10163271 | 3300027285 | Freshwater | MFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNND |
| Ga0255131_10295511 | 3300027285 | Freshwater | DEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETF |
| Ga0255126_10328621 | 3300027295 | Freshwater | KNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNK |
| Ga0255124_10042771 | 3300027299 | Freshwater | AQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNE |
| Ga0255127_10488723 | 3300027301 | Freshwater | KDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNE |
| Ga0255137_10484921 | 3300027375 | Freshwater | DEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYE |
| Ga0255125_10147584 | 3300027534 | Freshwater | AQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNND |
| Ga0255125_10586511 | 3300027534 | Freshwater | EKQQIINAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETF |
| Ga0209552_10217986 | 3300027563 | Freshwater Lake | NAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNNGQ |
| Ga0209651_10244377 | 3300027581 | Freshwater Lake | DMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGEQ |
| Ga0209651_10583824 | 3300027581 | Freshwater Lake | AQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNQTFGDESNT |
| Ga0255123_10629103 | 3300027589 | Freshwater | EKEKQQIINAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETF |
| Ga0255120_10216801 | 3300027594 | Freshwater | KDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNK |
| Ga0208974_10427821 | 3300027608 | Freshwater Lentic | HLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNND |
| Ga0208974_10734785 | 3300027608 | Freshwater Lentic | KDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYK |
| Ga0208974_11859872 | 3300027608 | Freshwater Lentic | NAQMDMFIHLNNLPYGLEYIEKRQSAEDFSQQYYNETFGGNND |
| Ga0209356_10738794 | 3300027644 | Freshwater Lake | MDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNQTFGDESNT |
| Ga0209357_10777684 | 3300027656 | Freshwater Lake | MFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNNGQ |
| Ga0208975_100230818 | 3300027659 | Freshwater Lentic | KDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNND |
| Ga0208975_10057191 | 3300027659 | Freshwater Lentic | KDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNNEQH |
| Ga0208975_10206336 | 3300027659 | Freshwater Lentic | MDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNND |
| Ga0209769_10235561 | 3300027679 | Freshwater Lake | FIHLNNLPYGLEYLEKRQSAEDFSQQYYNQTFGDESNT |
| Ga0209769_11588951 | 3300027679 | Freshwater Lake | QMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNE |
| Ga0209768_102860843 | 3300027772 | Freshwater Lake | MDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNNGQ |
| Ga0209246_100259421 | 3300027785 | Freshwater Lake | HLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNNG |
| Ga0209353_100006751 | 3300027798 | Freshwater Lake | AQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGGEQ |
| Ga0209354_100015751 | 3300027808 | Freshwater Lake | MFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGGEQ |
| Ga0209990_100511171 | 3300027816 | Freshwater Lake | QAETMRKDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNK |
| Ga0209990_101469003 | 3300027816 | Freshwater Lake | DEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNND |
| Ga0209990_104887591 | 3300027816 | Freshwater Lake | MFIQVNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNE |
| Ga0209550_1002665211 | 3300027892 | Freshwater Lake | DMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGEGEQ |
| Ga0315907_100634651 | 3300031758 | Freshwater | KDEIKNAQMDMFIHVNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNK |
| Ga0315899_100278351 | 3300031784 | Freshwater | EIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETF |
| Ga0315900_100483831 | 3300031787 | Freshwater | NAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETF |
| Ga0315900_104251981 | 3300031787 | Freshwater | MFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNEQH |
| Ga0315909_106871451 | 3300031857 | Freshwater | AQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNEQH |
| Ga0315901_112426801 | 3300031963 | Freshwater | KDEIKNAQMDMFIHVNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNE |
| Ga0315906_112079751 | 3300032050 | Freshwater | IKNAQMDMFIHVNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNE |
| Ga0315905_101314251 | 3300032092 | Freshwater | KDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETFGGGKQ |
| Ga0315905_113162501 | 3300032092 | Freshwater | AMRKDEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGEQ |
| Ga0315902_102452051 | 3300032093 | Freshwater | LNNLPYGLEYLEKRQSAEDFSQQYYNETFGGNNEQH |
| Ga0315902_102588546 | 3300032093 | Freshwater | AQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGNNGQ |
| Ga0315903_100964437 | 3300032116 | Freshwater | DEIKNAQMDMFIHLNNLPYGLEYLEKRQSAEDFSQQYYNETYGGGEQ |
| ⦗Top⦘ |