| Basic Information | |
|---|---|
| Family ID | F082037 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVQTT |
| Number of Associated Samples | 64 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.12 % |
| % of genes from short scaffolds (< 2000 bps) | 97.35 % |
| Associated GOLD sequencing projects | 54 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.522 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland (46.903 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.150 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (93.805 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 63.41% β-sheet: 0.00% Coil/Unstructured: 36.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF10544 | T5orf172 | 1.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.52 % |
| All Organisms | root | All Organisms | 42.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 46.90% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 42.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 5.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.65% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.77% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300025419 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025423 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025446 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025469 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025472 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300032117 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003 | Environmental | Open in IMG/M |
| 3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
| 3300032753 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0116128_10564112 | 3300009518 | Peatland | MYDTLKKSQYKVVSVGALASAVRPRIERSIEQVLNADVQTTRE |
| Ga0116128_10663703 | 3300009518 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNADVQTTREARFP |
| Ga0116128_12032701 | 3300009518 | Peatland | MFDTLKRSEYKVVSVGALASAVRPRIERSIEQVLNADVQ |
| Ga0116108_10883042 | 3300009519 | Peatland | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQVLNADVQ |
| Ga0116108_11058732 | 3300009519 | Peatland | MFDTLRSEYKVVSIGALASAVRPRIERSIEQVLNADVQTTREARF |
| Ga0116108_11299421 | 3300009519 | Peatland | MYDTLKKSQYKVVSIGALASAVRPRIERSIEQVLNAD |
| Ga0116108_11636393 | 3300009519 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVQTTREARF |
| Ga0116136_10403321 | 3300009547 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNADVRTTNQKRF |
| Ga0116107_11332293 | 3300009548 | Peatland | MFDTLRKSQYKVVSTGALASAVRPRIERSIEQALNGDVRTTNQKRFG |
| Ga0116138_10337392 | 3300009552 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNGDVRTTNQKRFG |
| Ga0116111_10404466 | 3300009616 | Peatland | MFDTLKRSEYKVVSVGALASAVRPRIERSIEQVLNADVQSTR |
| Ga0116111_10480973 | 3300009616 | Peatland | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQVLNA |
| Ga0116123_10453333 | 3300009617 | Peatland | MFDTLRKSQYKVVSVGALASAVRPRIERSIEQALNADVQSTREA |
| Ga0116127_11250741 | 3300009618 | Peatland | MESKMFDTLKRSEYKVVSVGALASAVRPRIERSIEQVL |
| Ga0116119_10341771 | 3300009629 | Peatland | MFDTLKRSEYKVISIGALASAVRPRIERSIEQALNGDVRTTNQKRF |
| Ga0116102_10591391 | 3300009632 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNGD |
| Ga0116124_10394521 | 3300009634 | Peatland | MFDTLKRSEYKVVSVGALASAVRPRIERSIEQVLNADVQTTREAR |
| Ga0116118_10325092 | 3300009637 | Peatland | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQALNADVQ |
| Ga0116122_12087691 | 3300009639 | Peatland | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQVLNADVQTTREAR |
| Ga0116126_10569034 | 3300009640 | Peatland | MYDTLKKSQYKVVSIGALASAVRPRIERSIEQALNADV |
| Ga0116126_10980891 | 3300009640 | Peatland | MFDTLRKSQYKVVSVGALASAVRPRIERSIEQVLNADVQTT |
| Ga0116110_10540673 | 3300009643 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVRTTNQKRFG |
| Ga0116110_12515732 | 3300009643 | Peatland | MFDTLRKGYKVVSVGALASAVRPRIERSIEQVLNADV |
| Ga0181530_102306113 | 3300014159 | Bog | MFDTLKRSEYKVISIGALASAVRPRIERSIEQALNGDVRTTNQK |
| Ga0181538_102450223 | 3300014162 | Bog | MFDTLRKGYKVVSVGALASAVRPRIERSIEQVLNADVQSTREARFP |
| Ga0182015_100377166 | 3300014495 | Palsa | MFDTLKRSEYKVVRNGALPFVTRPRIERSIEQVLNADIQT |
| Ga0187856_10775831 | 3300017925 | Peatland | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQALNADVQTTREAR |
| Ga0187856_10912712 | 3300017925 | Peatland | MFDTLRKSQYKVVSVGALASAVRPRIERSIEQVLNADVQTTREARF |
| Ga0187856_11201944 | 3300017925 | Peatland | MFDTLRKSQYKVVSVGALASAVRPRIERSIEQVLNADVQTTREARFPR |
| Ga0187856_12419793 | 3300017925 | Peatland | MFDTLRKSQYKVVSVGALASAVRPRIERSIEQVLN |
| Ga0187849_13436813 | 3300017929 | Peatland | MFDTLKRSEYKVVSVGALASAVRPRIERSIEQVLNA |
| Ga0187854_102052422 | 3300017938 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIGQVLNADVQ |
| Ga0187853_101013983 | 3300017940 | Peatland | MFDTLKRSEYKVVSIGALASAVRHRIERSIEQVLNADVQTTREA |
| Ga0187853_101179365 | 3300017940 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVQTTREA |
| Ga0187853_101972071 | 3300017940 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVQSTRE |
| Ga0187853_103012243 | 3300017940 | Peatland | MFDTLRKSQYKVVSVGALASAVRPRIERSIEQVLNADVQ |
| Ga0187853_104095651 | 3300017940 | Peatland | MSNTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVQTTREAR |
| Ga0187891_10758914 | 3300017996 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNG |
| Ga0187891_11071411 | 3300017996 | Peatland | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQVLNADVQTT |
| Ga0187891_12292141 | 3300017996 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVQ |
| Ga0187868_10828551 | 3300018002 | Peatland | MFDTLKRSEYKVVSVGALASAVRPRIERSIEQVLNADVQTTREARFP |
| Ga0187868_11165164 | 3300018002 | Peatland | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQVLN |
| Ga0187868_12280114 | 3300018002 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVQTTREARFPR |
| Ga0187868_13093071 | 3300018002 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNADVQ |
| Ga0187876_10848301 | 3300018003 | Peatland | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQVLNAD |
| Ga0187876_11545862 | 3300018003 | Peatland | MFDTLRKGYKVVSIGALASAVRPRIERSIEQVLNA |
| Ga0187865_11951061 | 3300018004 | Peatland | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQVLNADVQT |
| Ga0187878_10818591 | 3300018005 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNADVQTTRE |
| Ga0187878_11574442 | 3300018005 | Peatland | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQVLNADV |
| Ga0187884_101204933 | 3300018009 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVQRTREAR |
| Ga0187873_11062873 | 3300018013 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVQTTREARFP |
| Ga0187873_11237183 | 3300018013 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNADV |
| Ga0187873_11390954 | 3300018013 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNAD |
| Ga0187860_10993994 | 3300018014 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNA |
| Ga0187860_11990461 | 3300018014 | Peatland | MFDTLRKGYKVVSVGALASAVRPRIERSIEQVLNAD |
| Ga0187866_10506842 | 3300018015 | Peatland | MFDTLKRSEYKVVSIGALVSAVRPRIERSIKQVLN |
| Ga0187880_10873412 | 3300018016 | Peatland | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQALNADVQT |
| Ga0187880_11200521 | 3300018016 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNADVQSTRE |
| Ga0187880_12260682 | 3300018016 | Peatland | MFDTLRKGYKVVSVGALASAVRPRIERSIEQVLNADVQSTREARF |
| Ga0187872_101282163 | 3300018017 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVQSTREA |
| Ga0187874_101153612 | 3300018019 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVQT |
| Ga0187874_101738724 | 3300018019 | Peatland | MFDTLKRSEYKVVSVGALSSAVRPRIELSIEQALNGDV |
| Ga0187874_102602802 | 3300018019 | Peatland | MFHTLKRSEYKVVSVGALASAVRPRIERSIEQVLNA |
| Ga0187861_101242474 | 3300018020 | Peatland | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQALNADVQTTREA |
| Ga0187882_10966624 | 3300018021 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADV |
| Ga0187889_102040513 | 3300018023 | Peatland | MFDTLRKSQYKVVSVGALASAVRPRIERSIEQVLNA |
| Ga0187881_100940751 | 3300018024 | Peatland | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQALN |
| Ga0187857_103693042 | 3300018026 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNGDVGTTNQK |
| Ga0187857_103994781 | 3300018026 | Peatland | MFDTLKRSEYKVVSVGALASAVRPRIERSIEQVLNADVQT |
| Ga0187869_101130092 | 3300018030 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNADVQTTREA |
| Ga0187869_101588123 | 3300018030 | Peatland | MFDTLKRSKYKVVSIGALASAVRPRIERSIEQVLNA |
| Ga0187883_104869632 | 3300018037 | Peatland | MYDTLKKSQYKVVSVGALASAVRPRIERSIEQVLNADV |
| Ga0187862_106616392 | 3300018040 | Peatland | MFDTLRKGYKVVSVGALASAVRPRIERSIEQVLNADVQSTREA |
| Ga0187852_13482432 | 3300019082 | Peatland | MFDTLRKGYKVVSVGALASAVRPRIERSIEQVLNADVQTTRE |
| Ga0208036_10193441 | 3300025419 | Peatland | MFDTLKRSEYKVVSVGALASAVRPRIERSIEQALNADV |
| Ga0208036_10393341 | 3300025419 | Peatland | MFDTLRKGYKVVSVGALASAVRPRIERSIEQVLNADVQSTREAR |
| Ga0208746_10245332 | 3300025423 | Freshwater | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALN |
| Ga0208323_10215723 | 3300025439 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNA |
| Ga0208034_10381621 | 3300025442 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVQTTR |
| Ga0208038_10237691 | 3300025446 | Peatland | MFDTLKRSEYKVISIGALASAVRPRIERSIEQALNGDVRTTN |
| Ga0208038_10242681 | 3300025446 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVQTTRE |
| Ga0208038_10313723 | 3300025446 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVQS |
| Ga0208038_10467413 | 3300025446 | Peatland | MFDTLRKGYKVVSIGALASAVRPRIERSIEQVLNADVQTTREAR |
| Ga0208038_10677902 | 3300025446 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVQTTREAR |
| Ga0208689_10239734 | 3300025459 | Peatland | MFDTLRKSQYKVVSVGALASAVRPRIERSIEQVLNADVQTTREA |
| Ga0208689_10299491 | 3300025459 | Peatland | MFDTLRKSQYKVVSVGALASAVRPRIERSIEQVLNADVQTTREARFP |
| Ga0208689_10916711 | 3300025459 | Peatland | MYDTLKKSQYKVVSVGALASAVRPRIERSIEQALNADVRTTNQK |
| Ga0208562_10222301 | 3300025460 | Peatland | MFDTLRKSQYKVVSVGALASAVRPRIERSIEQVLNADVRT |
| Ga0208562_10248653 | 3300025460 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNGDVRTT |
| Ga0208497_10344713 | 3300025466 | Freshwater | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNADVQS |
| Ga0208497_10362724 | 3300025466 | Freshwater | MFDTLKRSEYKVVSVGALASAVRPRIERSIEQVLNADVQS |
| Ga0208687_10833281 | 3300025469 | Peatland | MFDTLRKGYKVVSVGALASAVRPRIERSIEQVLNADVQTTREARF |
| Ga0208687_10995612 | 3300025469 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNAG |
| Ga0208692_10354871 | 3300025472 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVRT |
| Ga0208688_10173901 | 3300025480 | Peatland | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQVLNADVQTTR |
| Ga0208688_10279681 | 3300025480 | Peatland | MFDTLKRSEYKVVSVGALASAVRPRIERSIEQALNGDVRTTNQKRF |
| Ga0208688_10298321 | 3300025480 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNGDVQ |
| Ga0208688_10354912 | 3300025480 | Peatland | MFDTLRKSQYKVVSVGALASAVRPRIERSIEQVLNADVQTTR |
| Ga0208191_10483184 | 3300025496 | Peatland | MFDTLKRSEYKVVSTGALASAVRPRIERSIEQALNGDVRTTNQKR |
| Ga0208563_10238364 | 3300025501 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVQTT |
| Ga0208563_10312032 | 3300025501 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNADVQTTR |
| Ga0208937_10139921 | 3300025506 | Peatland | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNGDV |
| Ga0208937_10288262 | 3300025506 | Peatland | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQALNADVQTT |
| Ga0208188_10237222 | 3300025507 | Peatland | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQALNAD |
| Ga0208188_11397641 | 3300025507 | Peatland | MFDTLRKGYKVVSVGALASAVRPRIERSIEQVLNADVQ |
| Ga0208820_10133085 | 3300025576 | Peatland | MFDTLKRSEYKVISIGALASAVRPRIERSIEQALNGDVRT |
| Ga0208457_10269281 | 3300025812 | Peatland | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQALNADVQSTRE |
| Ga0316219_10415415 | 3300031759 | Freshwater | MFDTLKRSEYKVVSVGALASAVRPRIERSIEQVLN |
| Ga0316219_10806402 | 3300031759 | Freshwater | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNGDVRTTN |
| Ga0316218_10586072 | 3300032117 | Freshwater | MFDTLRKSQYKVVSIGALASAVRPRIERSIEQALNADVQSTREAR |
| Ga0316218_11182851 | 3300032117 | Freshwater | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQVLNADVQSTR |
| Ga0316221_10573282 | 3300032665 | Freshwater | MFDTLKRSEYKVVSIGALASAVRPRIERSIEQALNADVQSTREA |
| Ga0316224_11823911 | 3300032753 | Freshwater | MFDTLKRSEYKVVSVGALASAVRPRIERSIEQVLNADVQTT |
| ⦗Top⦘ |