Metagenome Family F081957

Overview

Basic Information

• Family ID: F081957
• Family Type: Metagenome
• Number of Sequences: 113
• Average Sequence Length: 47 residues
• Representative Sequence: MLSLVAHAVGYKMIVGAHNTVNVRCMWEVASSSSGMADVGACHTVDA
• Number of Associated Samples: 58
• Number of Associated Scaffolds: 113

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 57.80 %
• % of genes near scaffold ends (potentially truncated): 46.02 %
• % of genes from short scaffolds (< 2000 bps): 96.46 %
• Associated GOLD sequencing projects: 58
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (99.115 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (96.460 % of family members)
• Environment Ontology (ENVO): Unclassified (96.460 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (96.460 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 53.33%
  β-sheet: 0.00%
  Coil/Unstructured: 46.67%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
All Organisms	root	All Organisms	0.88 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
cellular organisms	root	All Organisms → cellular organisms	0.88 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.88 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.88 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.88 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.88 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.88 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.88 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.88 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.88 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.88 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.88 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	0.88 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	0.88 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	0.88 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	0.88 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.88 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.88 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	0.88 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300013297|Ga0157378_11666451	Not Available	684
3300013297|Ga0157378_12240116	Not Available	598
3300015267|Ga0182122_1020259	Not Available	713
3300015268|Ga0182154_1001588	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1439
3300015269|Ga0182113_1044843	Not Available	636
3300015269|Ga0182113_1068014	Not Available	562
3300015274|Ga0182188_1016502	Not Available	710
3300015274|Ga0182188_1020745	Not Available	670
3300015274|Ga0182188_1034576	Not Available	588
3300015276|Ga0182170_1010622	Not Available	871
3300015276|Ga0182170_1044571	Not Available	591
3300015276|Ga0182170_1046179	Not Available	585
3300015276|Ga0182170_1065853	Not Available	528
3300015277|Ga0182128_1022745	Not Available	716
3300015277|Ga0182128_1057397	Not Available	554
3300015277|Ga0182128_1058981	Not Available	550
3300015283|Ga0182156_1053286	Not Available	585
3300015283|Ga0182156_1068727	Not Available	542
3300015286|Ga0182176_1023323	Not Available	754
3300015286|Ga0182176_1078512	Not Available	517
3300015287|Ga0182171_1070417	Not Available	539
3300015288|Ga0182173_1084707	Not Available	505
3300015289|Ga0182138_1038555	Not Available	643
3300015291|Ga0182125_1063064	Not Available	569
3300015291|Ga0182125_1064133	Not Available	566
3300015292|Ga0182141_1029205	Not Available	707
3300015292|Ga0182141_1049937	Not Available	607
3300015294|Ga0182126_1070295	Not Available	553
3300015295|Ga0182175_1047651	Not Available	626
3300015295|Ga0182175_1078869	Not Available	539
3300015296|Ga0182157_1075141	Not Available	555
3300015299|Ga0182107_1017762	Not Available	844
3300015299|Ga0182107_1054216	Not Available	615
3300015299|Ga0182107_1092793	Not Available	522
3300015300|Ga0182108_1054964	Not Available	617
3300015300|Ga0182108_1058478	Not Available	606
3300015302|Ga0182143_1100048	Not Available	509
3300015303|Ga0182123_1023128	Not Available	758
3300015303|Ga0182123_1089000	Not Available	519
3300015303|Ga0182123_1091556	Not Available	514
3300015305|Ga0182158_1057215	Not Available	604
3300015314|Ga0182140_1043808	Not Available	677
3300015321|Ga0182127_1060565	Not Available	632
3300015321|Ga0182127_1099349	Not Available	541
3300015322|Ga0182110_1007616	Not Available	1136
3300015323|Ga0182129_1073172	Not Available	579
3300015341|Ga0182187_1141079	Not Available	572
3300015343|Ga0182155_1072682	Not Available	755
3300015343|Ga0182155_1188966	Not Available	537
3300015344|Ga0182189_1194976	Not Available	535
3300015344|Ga0182189_1196558	Not Available	533
3300015344|Ga0182189_1200926	Not Available	529
3300015345|Ga0182111_1141100	Not Available	623
3300015345|Ga0182111_1189819	Not Available	555
3300015345|Ga0182111_1202558	Not Available	541
3300015345|Ga0182111_1228001	Not Available	517
3300015346|Ga0182139_1077550	Not Available	779
3300015347|Ga0182177_1193994	Not Available	554
3300015351|Ga0182161_1200531	Not Available	565
3300015351|Ga0182161_1268263	Not Available	501
3300015355|Ga0182159_1158187	Not Available	710
3300015355|Ga0182159_1294854	Not Available	543
3300015355|Ga0182159_1304206	Not Available	535
3300015361|Ga0182145_1151116	Not Available	547
3300015361|Ga0182145_1163927	Not Available	532
3300015361|Ga0182145_1165538	Not Available	531
3300017404|Ga0182203_1098698	Not Available	594
3300017404|Ga0182203_1134049	Not Available	538
3300017407|Ga0182220_1041375	Not Available	658
3300017409|Ga0182204_1067416	Not Available	600
3300017410|Ga0182207_1101476	Not Available	607
3300017410|Ga0182207_1143437	Not Available	540
3300017410|Ga0182207_1158812	Not Available	521
3300017415|Ga0182202_1129962	Not Available	514
3300017415|Ga0182202_1134328	Not Available	508
3300017415|Ga0182202_1137216	Not Available	504
3300017420|Ga0182228_1068254	Not Available	634
3300017424|Ga0182219_1013684	Not Available	1048
3300017425|Ga0182224_1149287	Not Available	520
3300017425|Ga0182224_1151382	Not Available	517
3300017430|Ga0182192_1103735	Not Available	602
3300017433|Ga0182206_1088672	Not Available	607
3300017433|Ga0182206_1157955	Not Available	503
3300017436|Ga0182209_1064491	Not Available	691
3300017436|Ga0182209_1113334	Not Available	578
3300017436|Ga0182209_1149591	Not Available	528
3300017438|Ga0182191_1137176	Not Available	555
3300017442|Ga0182221_1044767	Not Available	758
3300017442|Ga0182221_1090826	Not Available	612
3300017442|Ga0182221_1135911	Not Available	540
3300017443|Ga0182193_1113283	Not Available	610
3300017443|Ga0182193_1189331	Not Available	509
3300017682|Ga0182229_1090688	Not Available	537
3300017683|Ga0182218_1098523	Not Available	578
3300017683|Ga0182218_1115064	Not Available	551
3300017683|Ga0182218_1149926	Not Available	506
3300017684|Ga0182225_1146196	Not Available	500
3300017685|Ga0182227_1103053	Not Available	558
3300017686|Ga0182205_1083656	Not Available	641
3300017686|Ga0182205_1103698	Not Available	597
3300017686|Ga0182205_1150019	Not Available	526
3300017686|Ga0182205_1154412	Not Available	521
3300017686|Ga0182205_1172270	Not Available	501
3300017689|Ga0182231_1121796	Not Available	510
3300017690|Ga0182223_1025333	Not Available	775
3300017690|Ga0182223_1037262	Not Available	700
3300017690|Ga0182223_1083202	Not Available	563
3300025908|Ga0207643_10681963	Not Available	664
3300025908|Ga0207643_11031300	Not Available	532

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	96.46%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.77%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.77%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	96.46%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.77%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	96.46%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.77%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	96.46%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.77%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.77%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0157378_116664512	3300013297	Miscanthus Rhizosphere	CERERECSMLSLVTYAIGYKMIVGAHNTVNVRYMWEVASSSSGMADIGAYHTVDA*
Ga0157378_122401161	3300013297	Miscanthus Rhizosphere	MLSLVAHAVGYKMIVGGHNTVNIRCMWEVASSSSDIADVGA
Ga0182122_10202591	3300015267	Miscanthus Phyllosphere	VLLSLVAHAVGYKLVVGTHNTANVRRMWVVALSSFGMADVGVCHTIDA*
Ga0182154_10015882	3300015268	Miscanthus Phyllosphere	MLSLVAHVIRYKMIVGAHNNVNVRCMWEVASSSSGMADVGVCHTVDA*
Ga0182113_10448431	3300015269	Miscanthus Phyllosphere	MLSLVAHTVGYKMIVGTHNTVNVRCMWEVASSSSGMADV
Ga0182113_10680141	3300015269	Miscanthus Phyllosphere	MLTLVAHAVGYKMIVGVHNTVNVRCMWEVALSSSGMANVGACHTIDV*
Ga0182188_10165021	3300015274	Miscanthus Phyllosphere	MLLSLIAHDVRYKMMVGANNTVNVRCMSEVAASSSGMADVGACYTVDA*
Ga0182188_10207451	3300015274	Miscanthus Phyllosphere	SVCMLNLVAHVVGYKIIVGTHNTVNVIYMWDVALSSSGMADVDACHTVDT*
Ga0182188_10345761	3300015274	Miscanthus Phyllosphere	MLLSLVAYAVGYKTIVGAHNTVDVRCMWKVASSSFGMVDVGAYHIVDA*
Ga0182170_10106221	3300015276	Miscanthus Phyllosphere	MLSLVAHAIVYKMIVGAHNTINVRCMWEVALSSSGMADIGACHIVDA*
Ga0182170_10445711	3300015276	Miscanthus Phyllosphere	MLSLIAHVVGYKMIVGAHNTVNVRCMWEIAPSSFGMTDVGAWHTVDA*
Ga0182170_10461791	3300015276	Miscanthus Phyllosphere	MLLSLVVHAVGYRTIVGAHNTVDVRCMWEVASSSSGMADV
Ga0182170_10658531	3300015276	Miscanthus Phyllosphere	MLLSLVAYAVGYKIIVGAHNTVNVRCMWEVPSSSSGMTDVGAYHTVDA*
Ga0182128_10227451	3300015277	Miscanthus Phyllosphere	MLLSLVAHVVGYKMIVGAHNTVNVRRIWEVLSSSSGMADIGAYHTVDA*
Ga0182128_10573973	3300015277	Miscanthus Phyllosphere	MLSLVAHAIGYRMIIGVHNTVNVRCMWEVASSSLGMADVGACHTVDT*
Ga0182128_10589811	3300015277	Miscanthus Phyllosphere	MLSLVAYAIGYKMVVGAHNTVNVRCMWEITSSSSSMADVGACHTVDA*
Ga0182156_10532861	3300015283	Miscanthus Phyllosphere	MLSLVAHGIGYKMIIGAHNTVNVRCMWDVASSSSSMADVGAYHTIDA*
Ga0182156_10687271	3300015283	Miscanthus Phyllosphere	LSLVAHAVGYKMIVGAHNTVNIRCMLEVASSSSGIADVGACHTVDT*
Ga0182176_10233231	3300015286	Miscanthus Phyllosphere	MLSLVAHTVGYKMIVGTHNTVNVRCIWEVASSFSSMADISACHTVDA*
Ga0182176_10785122	3300015286	Miscanthus Phyllosphere	MLSLVAHAVGYKMIVGTHNTVNVRCMWEVASSSSGMADVGACHTVDS*
Ga0182171_10704171	3300015287	Miscanthus Phyllosphere	MLSLVEHTVGFKMIVGAHNTVNVRCMWEVMSSSSGMTDIGACHTIDA
Ga0182173_10847071	3300015288	Miscanthus Phyllosphere	MLPSLFAHAVGYKMFVGVHNTVNVRCMWEVASSSSGMTDVGACHIVDAHRH
Ga0182138_10385552	3300015289	Miscanthus Phyllosphere	VRERVRMLLSLVAHAVGYKMIVGAHNTVNVRCMWEVASSSSGMADVGACHIVDS*
Ga0182125_10630642	3300015291	Miscanthus Phyllosphere	MLSLVAHAIVYKMIVGAHNTINVRCMWEVASSSSGMADVDACHTIDA*
Ga0182125_10641331	3300015291	Miscanthus Phyllosphere	MLSLVAHAVEYKMIVGAHNTVNVRCMWEVASSSSNMEGIGACHTVDA*
Ga0182141_10292051	3300015292	Miscanthus Phyllosphere	MLSLVAHVVGYKMIVDAHNTVYVRCMWKVTSSSSG
Ga0182141_10499371	3300015292	Miscanthus Phyllosphere	MLSLVAHAVGYKMIVGAHNTVNVRCTWEVASSSSDMADVDACRTVDA*
Ga0182126_10702952	3300015294	Miscanthus Phyllosphere	MLSLVAHAIGYKMIVGAHNTINVRCMWEVMSSSSGMVDVGACHTVDA*
Ga0182175_10476511	3300015295	Miscanthus Phyllosphere	MLSLIAYTIGYKLILDTHNTVNVRCMWEVASSSSSMIDVDACHTVDAQRHASGFY
Ga0182175_10788692	3300015295	Miscanthus Phyllosphere	MLSLLAHVVGCKMIVGAHNTINVRCMWEVASSSSGIADVGACHTVDV*
Ga0182157_10751411	3300015296	Miscanthus Phyllosphere	SLVAHAVGYKMIVGVHNTVNVRCMWEVASSSSGMADVGACHTVDA*
Ga0182107_10177621	3300015299	Miscanthus Phyllosphere	MLSLVAHAVRYKMFVGAHNTLNVRCMWEVASSSSDMTDVGAYHTVDA*
Ga0182107_10542161	3300015299	Miscanthus Phyllosphere	MLSLVAYAVGYKMIVGAHNTVNVRCMCEVASSSSGMTDVGACHTVDAQR
Ga0182107_10927931	3300015299	Miscanthus Phyllosphere	MLSLVAHAIGYKMIVGAHNTINVRCMWEVPSSSSVMVDLGAYHTVGA*
Ga0182108_10549641	3300015300	Miscanthus Phyllosphere	MLSLVAHAVGYKMIVGAHNTVNVRCMWKVASSSSGVADVG
Ga0182108_10584781	3300015300	Miscanthus Phyllosphere	MPSFVAHAIGYKMIVGAHNNVNVRCMWEVASSSSGMADVGA
Ga0182143_11000481	3300015302	Miscanthus Phyllosphere	MLSLVAHAIRYRMIVGAHNTVNDICMWEVASSSSGMADVGAYHT
Ga0182123_10231281	3300015303	Miscanthus Phyllosphere	MLSLVTYAIGYKMIVGAHNTVNVRYMWEVASSSSGMADIGAYHTVDA*
Ga0182123_10890001	3300015303	Miscanthus Phyllosphere	LVAHAVGYKTIVGAHNTVDVRCMWEVTSSSSGMADVGACYTVDA*
Ga0182123_10915562	3300015303	Miscanthus Phyllosphere	VCERECVRMLSLVAHAIGYKMIVGAHNTIGVRCMWEVASSSSDMADVGAYHTVDA*
Ga0182158_10572151	3300015305	Miscanthus Phyllosphere	MLSLVAHAIGYKMIVGTHNTINVRCMWEVASSSSGMADVSAYHTVDA*
Ga0182140_10438081	3300015314	Miscanthus Phyllosphere	MLPSFVAHAVGYKMVVGAHNTVNVRCMWEVPSSSSGMEDVDAYHIVGA*
Ga0182127_10605651	3300015321	Miscanthus Phyllosphere	MLSLVAHAVGYKMMVGAHNTINVRCTWEVASFSSGMADVCACHTVDTQRHVR
Ga0182127_10993491	3300015321	Miscanthus Phyllosphere	MLSLVAHAVGYKMIVDAHNTVNVRCMWEVASSSSGMTDVGACHTVDA*
Ga0182110_10076161	3300015322	Miscanthus Phyllosphere	MLSLVAHAIGYKIIVDAHNTINVRSMWEVVSSSFGIADVGACYTIDA*
Ga0182129_10731721	3300015323	Miscanthus Phyllosphere	MLSLVAHAVGYKMIVGAHNTINVRCMWEVASSSSGMADVGACHTIDA*
Ga0182187_11410791	3300015341	Miscanthus Phyllosphere	MLLSPVTHAIGYKMIIGAYNTINVRCTWEVASSSSDMADVGACHTVDA
Ga0182155_10726822	3300015343	Miscanthus Phyllosphere	LSLVAHAVRYKMIVGTHNSVDVRCMWKVASSSSGMIDVGAYHTVDA*
Ga0182155_11889661	3300015343	Miscanthus Phyllosphere	MLSLVAHAVGYKMIVGAHNTVNVRNMWEVASSSLGMADVGACHTVDT*
Ga0182189_11949761	3300015344	Miscanthus Phyllosphere	MLSLVAHIVRYKMIVGAHNTVNVRCMWEVVSSSFSIAGVSACYIVDA*
Ga0182189_11965581	3300015344	Miscanthus Phyllosphere	MLLSLVAHAVGYKIIVGAHNTVNVRCMWEILSSSSGMIDAD
Ga0182189_12009261	3300015344	Miscanthus Phyllosphere	MLSFVVHAVGYKIIVGAHNTVNDRCTWEVASSSSGIADVGACHTVDAQRHARSF
Ga0182111_11411001	3300015345	Miscanthus Phyllosphere	MLSLVAYAIGYKMIVGAHNTVNVRCMWEVMSSSSSMADISASHTVDVQRHA
Ga0182111_11898192	3300015345	Miscanthus Phyllosphere	MLLSLVAHAVGYRIVVGTHNTVDVRCMWEVASSSFGMADVGACHTVDA*
Ga0182111_12025581	3300015345	Miscanthus Phyllosphere	MLCLVAHSIGYKMIVGAHNTVNVRCMWEVASYSSGM
Ga0182111_12280011	3300015345	Miscanthus Phyllosphere	ERVRMVQSLVPHAIRYKRIVGTHNTIDVRCMWEVASSSSGMADVGACYTIDA*
Ga0182139_10775501	3300015346	Miscanthus Phyllosphere	MLSLVAHAVGYKMIVGVHNTVNVRCMGEVALFSSGMADVGACHTVDA*
Ga0182177_10339381	3300015347	Miscanthus Phyllosphere	YKMIVGAHNTVNVRCMWEVASSSSGMADVGAHHTVDA*
Ga0182177_11939941	3300015347	Miscanthus Phyllosphere	MLLSLVAHVVGYKIIVGAHNTVNARCMWEVLSSSSGMADVDAYHTVDAQR
Ga0182161_12005311	3300015351	Miscanthus Phyllosphere	MLSLVAHVVGYKIIIGVHNTINVRCMWEVASSSSGMADVGA
Ga0182161_12682631	3300015351	Miscanthus Phyllosphere	AVGYKMIVGGHNTVNARCMWEVASSSSGMADVGVYHTVDA*
Ga0182159_11581871	3300015355	Miscanthus Phyllosphere	AVGYKMIVGIHNTVNVRCMWEVASSSSSMADVSACHTVDA*
Ga0182159_12948541	3300015355	Miscanthus Phyllosphere	MLPSLVTHAIGYKMMVGAHNTVVVRRMWEVSLSSSGMANVGFYHTVDA*
Ga0182159_13042061	3300015355	Miscanthus Phyllosphere	MLSSLVAHAVEYKMTVGAHNTVVVRRMWEVSSPSSGMADVGACHIV
Ga0182145_11511161	3300015361	Miscanthus Phyllosphere	TRDSVRMLSLVAHAIGYKMIIGTHNTINVRCMWEVAPSSSGMADVGACHTVDA*
Ga0182145_11639271	3300015361	Miscanthus Phyllosphere	MLTLVAHAVGYKMIVGAHNTVNVRCMWEVASSSSGMADVGACHTVDA*
Ga0182145_11655381	3300015361	Miscanthus Phyllosphere	IRERECVCALSLVAHAVGYKMIVGPHNTVNVRCTWKVVSSSSGMTDVGACYTVDT*
Ga0182203_10986981	3300017404	Miscanthus Phyllosphere	MLSLVAHAVGYKMIIGAHNTVNVRCMWEITSSSSSMADVGACHTVDA
Ga0182203_11340491	3300017404	Miscanthus Phyllosphere	VHMLSLVAHAIGYKMIVGAHNTVNVICMWEVASSSFGIADVGACYTVDA
Ga0182220_10413751	3300017407	Miscanthus Phyllosphere	LVAHAVRYKMFVGTHNTVNVRCTWEVVSSSSDMADVGDCHTVDS
Ga0182204_10674162	3300017409	Miscanthus Phyllosphere	SLVAHAVGYKMIIGAHNTVNVRCISEVAASSSGMADVGACHTIDA
Ga0182207_11014761	3300017410	Miscanthus Phyllosphere	MLSLVAHAVGYKMIVGAHNTINVRCMWEVASSSSGMADVGACHTI
Ga0182207_11434371	3300017410	Miscanthus Phyllosphere	MLLSLVAHAVRYTMIVGAHNTVNVRCMWEVASSSSGMVDVGACYTIDV
Ga0182207_11588121	3300017410	Miscanthus Phyllosphere	MLSLVAHAVGYKIIVDAHNTVNVRCMWEVASSSSDMADVGVCHTVDA
Ga0182208_10575733	3300017411	Miscanthus Phyllosphere	YKMIVGAHNTVNVRCMWEVASSSSGMADVGACHTVDA
Ga0182202_11299621	3300017415	Miscanthus Phyllosphere	MLLSLVAHAVGYKVIVGAHNTVNVRCMWEVPLSSSGMADVGTYHAIDA
Ga0182202_11343281	3300017415	Miscanthus Phyllosphere	MLSLVAHAVGYKMIVGAHNTVNVRCMWEVASSSSGMVDVGTCQ
Ga0182202_11372161	3300017415	Miscanthus Phyllosphere	MLLSLVAHAVGYKMMVGAHNTIVVRRMWEVASSSSGMADVGDCHTID
Ga0182228_10682541	3300017420	Miscanthus Phyllosphere	MLSLVTHAVGYKMIVGAHNTLNVRCMWEVASSSSSMTDVGGCYTVDAQRHVRGF
Ga0182228_10930701	3300017420	Miscanthus Phyllosphere	MLSLVAHAVGYKMIVGAHNTVDVRCMWEVFPCSPGMGIDGAHNTVGQT
Ga0182219_10136841	3300017424	Miscanthus Phyllosphere	MLSLVAHAVRYKMIVGTHNTVNVRCMWEVALSSSGMADV
Ga0182224_11492871	3300017425	Miscanthus Phyllosphere	MLSLVAHAVGYKMIIGAHNTINARCMWEVVSSSSGMEDVSACHTIDA
Ga0182224_11513821	3300017425	Miscanthus Phyllosphere	MLSLVAHAIGYRMIIGAHNTINVRCMWEVMLSSSGMADVGACHTVDTQRY
Ga0182192_11037351	3300017430	Miscanthus Phyllosphere	MLSLIAHVVGYKMIVGTYNTVNVRRMWVVALSSFGMADVGVCHTIDA
Ga0182206_10886721	3300017433	Miscanthus Phyllosphere	MLSLVAHAVGYKMIVGVPNTVNVRCMWEVTSSSSSMADVGACH
Ga0182206_11579551	3300017433	Miscanthus Phyllosphere	VCPSLVAHAIGYKMIVGAHNTVNVRCMWEVASSSSGMANVGAYHTVDAQRHA
Ga0182209_10644912	3300017436	Miscanthus Phyllosphere	MLSLVAHAVGYKMIVGAHNTINVRCMWEVVSSSSGMADVGACHTIGA
Ga0182209_11133341	3300017436	Miscanthus Phyllosphere	MLLSHVAHDVGYKTIVGGHNTVDVRCMWEVASSSFGMADVGACHTVDA
Ga0182209_11495911	3300017436	Miscanthus Phyllosphere	LSLVAHAIGYKMIVGTHNTVNVRCMWEVASSSSGMANIGACHTV
Ga0182191_11371762	3300017438	Miscanthus Phyllosphere	LSLVAHVVGYKMMVGDHNTVIVRRMWEVASSSSDMADVGACHIVDA
Ga0182221_10447671	3300017442	Miscanthus Phyllosphere	MLVSLVAHAIGYKMIVGAHNSVNVICMWEVALSSSGMVDVGACHTVDA
Ga0182221_10908261	3300017442	Miscanthus Phyllosphere	MLSLVVHAVGYKMIVGVHNTVNVRCMWEVASSSSGMADVG
Ga0182221_11359111	3300017442	Miscanthus Phyllosphere	MPSLVAHAVGYKMIVGAHNTVNVRCMWEVASSSSSMADVGACHTVDA
Ga0182193_11132831	3300017443	Miscanthus Phyllosphere	MLSLVAHAVGYKMIVGAQNTINVRCMWEVMSSSSGMVDVGACHTVDA
Ga0182193_11893311	3300017443	Miscanthus Phyllosphere	MLSLVAHAIGYNMIVGARNTINVRWMWAVASSSSGMADVGACHTIDA
Ga0182229_10906881	3300017682	Miscanthus Phyllosphere	MLSLVAHVVGYKMIIGTHNTINVRCMWEVASSSSGMADVSAYHTVDA
Ga0182218_10985231	3300017683	Miscanthus Phyllosphere	MLSFVSHVVGYKMIVGAHNTVNVRSMWEVTSSSSGMTDIGACPTVDVQR
Ga0182218_11150641	3300017683	Miscanthus Phyllosphere	LLSLVAHTGGYTIIVGTHNTVNVRCIWEVLSSSSGMADVGAYLIVG
Ga0182218_11499261	3300017683	Miscanthus Phyllosphere	MLSLVAHAIGYKMIVGAHNTINVRCIWEAVSSSSGMANVGACHTVDTQRYAR
Ga0182225_11461961	3300017684	Miscanthus Phyllosphere	MLSLVAYVVEYKMIVGTHNTINVRCMWDVASSSSSIANDDACYIVDA
Ga0182227_11030531	3300017685	Miscanthus Phyllosphere	MLSLVAHAVGYKMIVGAHNTVSVRCMWEVASSSSGMADVGACYTVDA
Ga0182205_10836561	3300017686	Miscanthus Phyllosphere	MLLSLVAHVVGYKTIVGAHNTIDVRCMWEVASSSSGMVDVGACHTVDA
Ga0182205_11036981	3300017686	Miscanthus Phyllosphere	MLPSLVAYAVGYKMMVGAHNTVCVRRMWEVPSSSLGMADAGAYHTVD
Ga0182205_11500191	3300017686	Miscanthus Phyllosphere	MLSLVAHAVGYKMIVGAHNTVNVRCMWEVASSSSGMADVGACHTVDA
Ga0182205_11544121	3300017686	Miscanthus Phyllosphere	MLSLVAQAVGYKMIVGAHNTVNVRCMWEVASSSFDKADVDACHTVDA
Ga0182205_11722701	3300017686	Miscanthus Phyllosphere	MLSLVAHVVGYKMIVGAHNTINVRCMWEITSSFDMADVGACYTVDA
Ga0182231_11217961	3300017689	Miscanthus Phyllosphere	MLSLVAHAVGYKMIVGAHNTVNIRCMLEVASSSSGIAD
Ga0182223_10253332	3300017690	Miscanthus Phyllosphere	MLSLVAHAIGYKMIVGTHNTINVRCMWEVASSSSGMADVSACHTVDA
Ga0182223_10372621	3300017690	Miscanthus Phyllosphere	MLSLVAHAVRYKMIVGAHNTVDVRCMWKVASSSSGMIDVGAYHTVDA
Ga0182223_10437891	3300017690	Miscanthus Phyllosphere	VLSLVAYAVGYKMIVDAHNTVNVRYMWEVVSSSSGMADVGVCHTVDAQRHVGGF
Ga0182223_10832021	3300017690	Miscanthus Phyllosphere	YKMMVGAHNTIVVIRTWEVSSSSSGMADVGACITVDA
Ga0207643_106819631	3300025908	Miscanthus Rhizosphere	LSLVAHAVGYKMIVGAHNTVNVGCMWEVASSSSSMVDVGACHTVDA
Ga0207643_110313001	3300025908	Miscanthus Rhizosphere	LSLVAHAVGYKMIVSAHNTVNVRCMWEVASSSFGMADVGACHTVDA