NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F081911

Metagenome Family F081911

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081911
Family Type Metagenome
Number of Sequences 114
Average Sequence Length 48 residues
Representative Sequence NTGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY
Number of Associated Samples 101
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.12 %
% of genes from short scaffolds (< 2000 bps) 91.23 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (72.807 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(10.526 % of family members)
Environment Ontology (ENVO) Unclassified
(29.825 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(50.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF00180Iso_dh 83.33
PF00268Ribonuc_red_sm 7.89
PF07992Pyr_redox_2 2.63
PF01575MaoC_dehydratas 0.88
PF01127Sdh_cyt 0.88
PF12071DUF3551 0.88
PF01292Ni_hydr_CYTB 0.88
PF01734Patatin 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG0208Ribonucleotide reductase beta subunit, ferritin-like domainNucleotide transport and metabolism [F] 7.89
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.88
COG1969Ni,Fe-hydrogenase I cytochrome b subunitEnergy production and conversion [C] 0.88
COG2009Succinate dehydrogenase/fumarate reductase, cytochrome b subunitEnergy production and conversion [C] 0.88
COG2142Succinate dehydrogenase, hydrophobic anchor subunitEnergy production and conversion [C] 0.88
COG2864Cytochrome b subunit of formate dehydrogenaseEnergy production and conversion [C] 0.88
COG3038Cytochrome b561Energy production and conversion [C] 0.88
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.88
COG3658Cytochrome b subunit of Ni2+-dependent hydrogenaseEnergy production and conversion [C] 0.88
COG4117Thiosulfate reductase cytochrome b subunitInorganic ion transport and metabolism [P] 0.88
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A72.81 %
All OrganismsrootAll Organisms27.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_106330518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1317Open in IMG/M
3300001430|JGI24032J14994_100145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3376Open in IMG/M
3300001915|JGI24741J21665_1075174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300004025|Ga0055433_10069571Not Available751Open in IMG/M
3300004463|Ga0063356_104960835Not Available572Open in IMG/M
3300004479|Ga0062595_101877937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium573Open in IMG/M
3300005104|Ga0066818_1010404Not Available682Open in IMG/M
3300005336|Ga0070680_100864841Not Available780Open in IMG/M
3300005336|Ga0070680_101725699Not Available543Open in IMG/M
3300005337|Ga0070682_100055025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2498Open in IMG/M
3300005337|Ga0070682_100325133Not Available1137Open in IMG/M
3300005341|Ga0070691_10147133Not Available1205Open in IMG/M
3300005356|Ga0070674_101633858Not Available582Open in IMG/M
3300005439|Ga0070711_101819085Not Available534Open in IMG/M
3300005468|Ga0070707_101664620Not Available605Open in IMG/M
3300005530|Ga0070679_102026881Not Available525Open in IMG/M
3300005564|Ga0070664_100772509Not Available897Open in IMG/M
3300005577|Ga0068857_100105638All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2528Open in IMG/M
3300005764|Ga0066903_102786110Not Available948Open in IMG/M
3300006871|Ga0075434_101168370Not Available782Open in IMG/M
3300006880|Ga0075429_100924817Not Available763Open in IMG/M
3300006903|Ga0075426_10230382Not Available1346Open in IMG/M
3300006904|Ga0075424_102340799Not Available561Open in IMG/M
3300009093|Ga0105240_10906271All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium948Open in IMG/M
3300009094|Ga0111539_10205028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.2299Open in IMG/M
3300009098|Ga0105245_10650212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1084Open in IMG/M
3300009098|Ga0105245_11319390Not Available771Open in IMG/M
3300009174|Ga0105241_10763366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium888Open in IMG/M
3300009176|Ga0105242_10236451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1640Open in IMG/M
3300009545|Ga0105237_11345202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium720Open in IMG/M
3300009553|Ga0105249_11217240Not Available824Open in IMG/M
3300010043|Ga0126380_10086642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1834Open in IMG/M
3300010047|Ga0126382_11640935Not Available598Open in IMG/M
3300010371|Ga0134125_12954383Not Available516Open in IMG/M
3300010373|Ga0134128_11422803Not Available764Open in IMG/M
3300010373|Ga0134128_11568344Not Available725Open in IMG/M
3300010375|Ga0105239_11127678Not Available903Open in IMG/M
3300010379|Ga0136449_100566835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.1947Open in IMG/M
3300010379|Ga0136449_103299935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis621Open in IMG/M
3300010399|Ga0134127_10947199All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium919Open in IMG/M
3300012477|Ga0157336_1036570Not Available513Open in IMG/M
3300012483|Ga0157337_1006797Not Available801Open in IMG/M
3300012489|Ga0157349_1045430Not Available507Open in IMG/M
3300012490|Ga0157322_1015066Not Available684Open in IMG/M
3300012498|Ga0157345_1031512Not Available597Open in IMG/M
3300012885|Ga0157287_1003503Not Available1468Open in IMG/M
3300012908|Ga0157286_10068580Not Available963Open in IMG/M
3300012948|Ga0126375_10012781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3636Open in IMG/M
3300012948|Ga0126375_11778406Not Available537Open in IMG/M
3300012955|Ga0164298_10356297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium929Open in IMG/M
3300012957|Ga0164303_10211771Not Available1082Open in IMG/M
3300012984|Ga0164309_10421567Not Available1001Open in IMG/M
3300012984|Ga0164309_11517874Not Available573Open in IMG/M
3300013102|Ga0157371_11211140Not Available582Open in IMG/M
3300013105|Ga0157369_11737904Not Available634Open in IMG/M
3300013105|Ga0157369_12581869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria514Open in IMG/M
3300013296|Ga0157374_11601893Not Available675Open in IMG/M
3300013296|Ga0157374_11844608Not Available630Open in IMG/M
3300013296|Ga0157374_12445079Not Available550Open in IMG/M
3300013307|Ga0157372_10804685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1092Open in IMG/M
3300014325|Ga0163163_10140460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2458Open in IMG/M
3300015077|Ga0173483_10671049Not Available581Open in IMG/M
3300015372|Ga0132256_101876376Not Available707Open in IMG/M
3300015373|Ga0132257_103786904Not Available550Open in IMG/M
3300017944|Ga0187786_10217043All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri737Open in IMG/M
3300017947|Ga0187785_10114864Not Available1093Open in IMG/M
3300017973|Ga0187780_10201429Not Available1388Open in IMG/M
3300018032|Ga0187788_10319928Not Available633Open in IMG/M
3300018058|Ga0187766_10896426Not Available625Open in IMG/M
3300019877|Ga0193722_1046322Not Available1106Open in IMG/M
3300019879|Ga0193723_1023148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1896Open in IMG/M
3300021560|Ga0126371_11788107Not Available736Open in IMG/M
3300021560|Ga0126371_13244874All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300025227|Ga0207638_1006897Not Available517Open in IMG/M
3300025560|Ga0210108_1039226Not Available894Open in IMG/M
3300025728|Ga0207655_1122483Not Available859Open in IMG/M
3300025916|Ga0207663_11535064Not Available536Open in IMG/M
3300025922|Ga0207646_11413277Not Available605Open in IMG/M
3300025925|Ga0207650_11568238Not Available559Open in IMG/M
3300025936|Ga0207670_11012326Not Available699Open in IMG/M
3300025937|Ga0207669_11709669Not Available537Open in IMG/M
3300025941|Ga0207711_10046325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3715Open in IMG/M
3300025941|Ga0207711_11386693Not Available645Open in IMG/M
3300025945|Ga0207679_10286103Not Available1415Open in IMG/M
3300026041|Ga0207639_11170699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium721Open in IMG/M
3300026116|Ga0207674_11068622Not Available776Open in IMG/M
3300026772|Ga0207596_105618Not Available534Open in IMG/M
3300026853|Ga0207443_1012335Not Available510Open in IMG/M
3300026898|Ga0207788_1025086Not Available526Open in IMG/M
3300026904|Ga0207584_1001578Not Available846Open in IMG/M
3300027003|Ga0207722_1000483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5555Open in IMG/M
3300027036|Ga0207467_1023206Not Available532Open in IMG/M
3300027364|Ga0209967_1003985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621949Open in IMG/M
3300027665|Ga0209983_1037686Not Available1041Open in IMG/M
3300027682|Ga0209971_1174359Not Available530Open in IMG/M
3300028587|Ga0247828_10386252Not Available801Open in IMG/M
3300028711|Ga0307293_10211348Not Available617Open in IMG/M
3300028875|Ga0307289_10087280Not Available1267Open in IMG/M
(restricted) 3300031248|Ga0255312_1090031Not Available745Open in IMG/M
3300031474|Ga0170818_112369589Not Available815Open in IMG/M
3300031716|Ga0310813_11331604Not Available664Open in IMG/M
3300031720|Ga0307469_12417763Not Available513Open in IMG/M
3300031724|Ga0318500_10110093Not Available1262Open in IMG/M
3300031748|Ga0318492_10149855Not Available1176Open in IMG/M
3300031777|Ga0318543_10206165Not Available873Open in IMG/M
3300031781|Ga0318547_10003817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68606170Open in IMG/M
3300032025|Ga0318507_10123320Not Available1095Open in IMG/M
3300032051|Ga0318532_10074383Not Available1184Open in IMG/M
3300032174|Ga0307470_10754108Not Available748Open in IMG/M
3300032174|Ga0307470_11168160Not Available623Open in IMG/M
3300032180|Ga0307471_101661991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium793Open in IMG/M
3300032261|Ga0306920_100203640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2953Open in IMG/M
3300033289|Ga0310914_11247029Not Available645Open in IMG/M
3300034090|Ga0326723_0345392Not Available671Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.14%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.39%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.39%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.39%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.39%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.39%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.51%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.51%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.51%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere3.51%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere3.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.51%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.51%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.51%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.63%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.75%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.88%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.88%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.88%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.88%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.88%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.88%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.88%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001430Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5EnvironmentalOpen in IMG/M
3300001915Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7Host-AssociatedOpen in IMG/M
3300004025Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005104Soil and rhizosphere microbial communities from Laval, Canada - mgHACEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012477Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610Host-AssociatedOpen in IMG/M
3300012483Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610Host-AssociatedOpen in IMG/M
3300012489Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610EnvironmentalOpen in IMG/M
3300012490Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610Host-AssociatedOpen in IMG/M
3300012498Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410Host-AssociatedOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025227Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes)Host-AssociatedOpen in IMG/M
3300025560Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025728Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026772Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A2-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026853Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5w-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026898Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 79 (SPAdes)EnvironmentalOpen in IMG/M
3300026904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A5-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027003Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes)EnvironmentalOpen in IMG/M
3300027036Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A5-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027364Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027682Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10633051823300000955SoilPGERVGNTGYIENPNQRAGSVINNTSAGLLNTQSALPGPWTLPFKTNPWIGY*
JGI24032J14994_10014543300001430Corn, Switchgrass And Miscanthus RhizosphereNTGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY*
JGI24741J21665_107517413300001915Corn RhizosphereSYLDPGTETFPGERVGNTGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY*
Ga0055433_1006957123300004025Natural And Restored WetlandsERVGNTGYVENPGQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0063356_10496083513300004463Arabidopsis Thaliana RhizosphereNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0062595_10187793723300004479SoilHFYAQLPNQRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY*
Ga0066818_101040413300005104SoilRIGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0070680_10086484113300005336Corn RhizospherePGERVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0070680_10172569913300005336Corn RhizosphereNPNQYAGSVINNTSAGLYNTSSALPGPWTLPFKSNPWIGY*
Ga0070682_10005502513300005337Corn RhizosphereVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0070682_10032513323300005337Corn RhizosphereTGYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY*
Ga0070691_1014713313300005341Corn, Switchgrass And Miscanthus RhizosphereKRSYLDPGTETFPGERVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0070674_10163385813300005356Miscanthus RhizospherePTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY*
Ga0070711_10181908523300005439Corn, Switchgrass And Miscanthus RhizosphereRSDHFYAQLPNQRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY*
Ga0070707_10166462013300005468Corn, Switchgrass And Miscanthus RhizosphereVGNTGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY*
Ga0070679_10202688123300005530Corn RhizosphereTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0070664_10077250913300005564Corn RhizosphereERVGNTGYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY*
Ga0068857_10010563813300005577Corn RhizosphereRVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0066903_10278611013300005764Tropical Forest SoilRSFLDPGTETSPGERVRNTGYVENPNQRASSVIDNTSAGLLNTQSALPGPWTLPSKNNPWLQY*
Ga0075434_10116837013300006871Populus RhizosphereERVRNTGYIENPNQRAGSVIDNTAAGIMNNQTALPGPWTLPFKSNPWIGY*
Ga0075429_10092481723300006880Populus RhizosphereGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0075426_1023038213300006903Populus RhizosphereVGNTGYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY*
Ga0075424_10234079913300006904Populus RhizosphereQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0105240_1090627123300009093Corn RhizosphereGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY*
Ga0111539_1020502833300009094Populus RhizosphereGTETFPGERVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0105245_1065021223300009098Miscanthus RhizosphereLDPGTESFPGERSDHFYAQLPNQRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY*
Ga0105245_1131939023300009098Miscanthus RhizosphereTETFPGERVGNTGYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY*
Ga0105241_1076336623300009174Corn RhizosphereESFPGERSDHFYAQLPNQRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY*
Ga0105242_1023645133300009176Miscanthus RhizosphereYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY*
Ga0105237_1134520223300009545Corn RhizosphereFYAQLPNQRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY*
Ga0105249_1121724023300009553Switchgrass RhizosphereTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY*
Ga0126380_1008664233300010043Tropical Forest SoilSYLDPGTETFPGERVRNTGYIENPNQRASSVINNTSAGLLNTQSALPGPWTLPSKNNPWLGY*
Ga0126382_1164093513300010047Tropical Forest SoilDPGTETFPGERVGNTGYIANPNQRAGGVIDNTSAGLLNTQSALPGPWTLPFKTNPWIGY*
Ga0134125_1295438323300010371Terrestrial SoilFPGERVGNTGYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY*
Ga0134128_1142280313300010373Terrestrial SoilENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0134128_1156834413300010373Terrestrial SoilGERVGNTGYVENPGQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0105239_1112767823300010375Corn RhizosphereERVGNTGYVQTMTQTAGSPIDNTSAGLSNRQSPLPGPFTLPSKNNPWLQY*
Ga0136449_10056683513300010379Peatlands SoilPNQRAAGVLDNTIFGLQNTQSPLPGPWTLPGKNNPWIGY*
Ga0136449_10329993523300010379Peatlands SoilQRASSVLDSTIFGLSNTQSPLPGPWTLPGKNNPWLQY*
Ga0134127_1094719913300010399Terrestrial SoilFPGERSDHFYAQLPNQRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY*
Ga0157336_103657013300012477Arabidopsis RhizosphereYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0157337_100679713300012483Arabidopsis RhizosphereTETFPGERVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0157349_104543013300012489Unplanted SoilYLDPGTETFPGERVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0157322_101506623300012490Arabidopsis RhizosphereQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY*
Ga0157345_103151213300012498Arabidopsis RhizosphereIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0157287_100350313300012885SoilIGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY*
Ga0157286_1006858013300012908SoilSYLDPGTETFPGERVGNTGYVENPGQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY*
Ga0126375_1001278163300012948Tropical Forest SoilERVGNTGYIENPNQRAGSVINNTSAGLLNTQSALPGPWTLPFKSNPWIGY*
Ga0126375_1177840623300012948Tropical Forest SoilYIENPNQRAGSVINNTSAGLLNTQSALPGPWTLPSKNNPWLGY*
Ga0164298_1035629713300012955SoilQRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY*
Ga0164303_1021177123300012957SoilAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY*
Ga0164309_1042156713300012984SoilNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY*
Ga0164309_1151787413300012984SoilNQYAGSVINNTSAGLYNTQSALPGPWTLPSKRNPWIGY*
Ga0157371_1121114013300013102Corn RhizosphereIENPNQRAGSVIDNTAAGIMNNQTALPGPWTLPFKSNPWIGY*
Ga0157369_1173790413300013105Corn RhizosphereKRSYLDPGTETFPGERVGNTGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY*
Ga0157369_1258186913300013105Corn RhizosphereKRSFLDPGTETFPGERVGNTGYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY*
Ga0157374_1160189323300013296Miscanthus RhizosphereGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY*
Ga0157374_1184460823300013296Miscanthus RhizosphereDPGTETFPGERVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPSKRNPWIGY*
Ga0157374_1244507923300013296Miscanthus RhizospherePGERVRNTGYIENPNQRAGSVIDNTAAGIMNNQTALPGPWTLPFKSNPWIGY*
Ga0157372_1080468513300013307Corn RhizosphereAGGVIDNTSAVLLNTHSALPGPWTLPSKNNPWLFY*
Ga0163163_1014046033300014325Switchgrass RhizosphereQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY*
Ga0173483_1067104923300015077SoilNTGYIENPGQYAGSVINNTSAGLYNTSSALPGPWTLPFKSNPWIGY*
Ga0132256_10187637613300015372Arabidopsis RhizosphereAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY*
Ga0132257_10378690423300015373Arabidopsis RhizosphereGERVGNTGYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY*
Ga0187786_1021704313300017944Tropical PeatlandPGTETFPGERSDHYYIENPNHRAGSTIDNTSAGLLNTQSALPGPWTLPSKNNPWLFGP
Ga0187785_1011486423300017947Tropical PeatlandDPGTETFPGERVGNTGYVENPNQRASGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLQY
Ga0187780_1020142913300017973Tropical PeatlandPNHRAAGVVDNTSAGLYNTQSALPGPWTLPGKNNPWIFGP
Ga0187788_1031992813300018032Tropical PeatlandRASGVLDNTPAGLLNTQSALPGPWTLPSKNNPWLQY
Ga0187766_1089642613300018058Tropical PeatlandTGFIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPGKNNPWIGY
Ga0193722_104632213300019877SoilGERVGNTGYVQTPTQTAGSVINNTSAGLSNTQSALPGPFTLPSKNNPWLQY
Ga0193723_102314813300019879SoilLNPGTETFPGERVGNTGYVQTPTQTAGSVINNTSAGLSNTQSALPGPFTLPSKNNPWLQY
Ga0126371_1178810723300021560Tropical Forest SoilERVGNTGYVQNATQTAGSVIDNTSAGLSNTQSALPGPFTLPSKNNPWLQY
Ga0126371_1324487423300021560Tropical Forest SoilGTETFPGERVGNTAYIENPNQRASSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY
Ga0207638_100689723300025227Corn, Switchgrass And Miscanthus RhizosphereERVGNTGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY
Ga0210108_103922623300025560Natural And Restored WetlandsGTETFPGEHGRNTDYVERPNQRASGVLDNTPAGLYNTQSALPGPWTLPSKNNPWLQY
Ga0207655_112248323300025728Miscanthus RhizosphereTETFPGERVGNTGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY
Ga0207663_1153506413300025916Corn, Switchgrass And Miscanthus RhizosphereLDPGTETFPGERVGNTGYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY
Ga0207646_1141327713300025922Corn, Switchgrass And Miscanthus RhizosphereVGNTGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY
Ga0207650_1156823823300025925Switchgrass RhizosphereTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY
Ga0207670_1101232623300025936Switchgrass RhizosphereVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY
Ga0207669_1170966913300025937Miscanthus RhizosphereGYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY
Ga0207711_1004632553300025941Switchgrass RhizosphereVGNTGYIENPNQYAGSVINNTSAGLYNTSSALPGPWTLPFKSNPWIGY
Ga0207711_1138669313300025941Switchgrass RhizosphereTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY
Ga0207679_1028610313300025945Corn RhizosphereYLDPGTESFPGERVRNTGYIENPNQRAGSVIDNTAAGIMNNQTALPGPWTLPFKSNPWIG
Ga0207639_1117069923300026041Corn RhizosphereQKRSFLDPGTETFPGERVGNTGYVQNPTQTAGSVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY
Ga0207674_1106862213300026116Corn RhizosphereERVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY
Ga0207596_10561813300026772SoilRVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY
Ga0207443_101233523300026853SoilENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY
Ga0207788_102508623300026898Tropical Forest SoilHFYAELPNHRAAGVVDNTSAGLYNTQSALPGPFTLPFKNSPWLQY
Ga0207584_100157813300026904SoilGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY
Ga0207722_100048313300027003Tropical Forest SoilHRAGGVIDNTIYGLTNTQSPLPGPWTLPGKNNPWIGY
Ga0207467_102320613300027036SoilGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY
Ga0209967_100398533300027364Arabidopsis Thaliana RhizosphereIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY
Ga0209983_103768613300027665Arabidopsis Thaliana RhizosphereYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY
Ga0209971_117435913300027682Arabidopsis Thaliana RhizosphereQTFPGERIGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY
Ga0247828_1038625223300028587SoilIGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY
Ga0307293_1021134813300028711SoilIGNTGYVQNPTQTAGSVIDNTSAGLSNTQSALPGPFTLPSKNNPWLQY
Ga0307289_1008728013300028875SoilFPGERVGNTGYVQTPTQTAGSVINNTSAGLSNTQSALPGPFTLPSKNNPWLQY
(restricted) Ga0255312_109003123300031248Sandy SoilPGERVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY
Ga0170818_11236958923300031474Forest SoilETFPGERVGNTGYIENPNQYAGSVLNNTSAGLYNTQSALPGPWTLPSKRNPWIGY
Ga0310813_1133160413300031716SoilYAQLPNQRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY
Ga0307469_1241776323300031720Hardwood Forest SoilERVGNTGYIENPNQRAGSVINNTSAGLLNTQSALPGPWTLPFKTNPWIGY
Ga0318500_1011009323300031724SoilPNHRAGGVIDNTIYGLTNTQSPLPGPWTLPGKNNPWIGY
Ga0318492_1014985513300031748SoilLDPGTETFPGERVGNIGYVQNPTQTAGSVIDNTSAGLLNKQSPLPGPWTLPSKNNPWIQY
Ga0318543_1020616523300031777SoilETFPGEHISSTDYVWLPNHRAGGVIDNTIYGLENTQSPLPGPWTLPGKNNPWIGY
Ga0318547_1000381713300031781SoilSFLDPGTETFPGERVGNIGYVQNPTQTAGSVIDNTSAGLLNRQSPLPGPWTLPSKNNPWIQY
Ga0318507_1012332013300032025SoilISSTDYVWLPNHRAGGVIDNTIYGLENTQSPLPGPWTLPGKNNPWIGY
Ga0318532_1007438323300032051SoilNHRAGGVIDNTIYGLENTQSPLPGPWTLPGKNNPWIGY
Ga0307470_1075410823300032174Hardwood Forest SoilPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY
Ga0307470_1116816023300032174Hardwood Forest SoilFYAELPNQRAGGVIDNTSAGLLNTQSALPGPWTLPSRNNPWLFY
Ga0307471_10166199113300032180Hardwood Forest SoilNQRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY
Ga0306920_10020364053300032261SoilAGGVIDNTIYGLENTQSPLPGPWTLPGKNNPWIGY
Ga0310914_1124702913300033289SoilETSPGERVRNTGYVENPNQRASSVIDNTSAGLLNTQSALPGPWTLPSKNNPWLQY
Ga0326723_0345392_504_6713300034090Peat SoilETFPGEHGRNTDYVERPNQRASGVLDNTPAGLLNTQSALPGPWTLPSKNNPWLQY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.