| Basic Information | |
|---|---|
| Family ID | F081911 |
| Family Type | Metagenome |
| Number of Sequences | 114 |
| Average Sequence Length | 48 residues |
| Representative Sequence | NTGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.12 % |
| % of genes from short scaffolds (< 2000 bps) | 91.23 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.807 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.526 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.825 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF00180 | Iso_dh | 83.33 |
| PF00268 | Ribonuc_red_sm | 7.89 |
| PF07992 | Pyr_redox_2 | 2.63 |
| PF01575 | MaoC_dehydratas | 0.88 |
| PF01127 | Sdh_cyt | 0.88 |
| PF12071 | DUF3551 | 0.88 |
| PF01292 | Ni_hydr_CYTB | 0.88 |
| PF01734 | Patatin | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 7.89 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.88 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.88 |
| COG2009 | Succinate dehydrogenase/fumarate reductase, cytochrome b subunit | Energy production and conversion [C] | 0.88 |
| COG2142 | Succinate dehydrogenase, hydrophobic anchor subunit | Energy production and conversion [C] | 0.88 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.88 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.88 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.88 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.88 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.88 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.81 % |
| All Organisms | root | All Organisms | 27.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_106330518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1317 | Open in IMG/M |
| 3300001430|JGI24032J14994_100145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3376 | Open in IMG/M |
| 3300001915|JGI24741J21665_1075174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300004025|Ga0055433_10069571 | Not Available | 751 | Open in IMG/M |
| 3300004463|Ga0063356_104960835 | Not Available | 572 | Open in IMG/M |
| 3300004479|Ga0062595_101877937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 573 | Open in IMG/M |
| 3300005104|Ga0066818_1010404 | Not Available | 682 | Open in IMG/M |
| 3300005336|Ga0070680_100864841 | Not Available | 780 | Open in IMG/M |
| 3300005336|Ga0070680_101725699 | Not Available | 543 | Open in IMG/M |
| 3300005337|Ga0070682_100055025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2498 | Open in IMG/M |
| 3300005337|Ga0070682_100325133 | Not Available | 1137 | Open in IMG/M |
| 3300005341|Ga0070691_10147133 | Not Available | 1205 | Open in IMG/M |
| 3300005356|Ga0070674_101633858 | Not Available | 582 | Open in IMG/M |
| 3300005439|Ga0070711_101819085 | Not Available | 534 | Open in IMG/M |
| 3300005468|Ga0070707_101664620 | Not Available | 605 | Open in IMG/M |
| 3300005530|Ga0070679_102026881 | Not Available | 525 | Open in IMG/M |
| 3300005564|Ga0070664_100772509 | Not Available | 897 | Open in IMG/M |
| 3300005577|Ga0068857_100105638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2528 | Open in IMG/M |
| 3300005764|Ga0066903_102786110 | Not Available | 948 | Open in IMG/M |
| 3300006871|Ga0075434_101168370 | Not Available | 782 | Open in IMG/M |
| 3300006880|Ga0075429_100924817 | Not Available | 763 | Open in IMG/M |
| 3300006903|Ga0075426_10230382 | Not Available | 1346 | Open in IMG/M |
| 3300006904|Ga0075424_102340799 | Not Available | 561 | Open in IMG/M |
| 3300009093|Ga0105240_10906271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 948 | Open in IMG/M |
| 3300009094|Ga0111539_10205028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 2299 | Open in IMG/M |
| 3300009098|Ga0105245_10650212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1084 | Open in IMG/M |
| 3300009098|Ga0105245_11319390 | Not Available | 771 | Open in IMG/M |
| 3300009174|Ga0105241_10763366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 888 | Open in IMG/M |
| 3300009176|Ga0105242_10236451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1640 | Open in IMG/M |
| 3300009545|Ga0105237_11345202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 720 | Open in IMG/M |
| 3300009553|Ga0105249_11217240 | Not Available | 824 | Open in IMG/M |
| 3300010043|Ga0126380_10086642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1834 | Open in IMG/M |
| 3300010047|Ga0126382_11640935 | Not Available | 598 | Open in IMG/M |
| 3300010371|Ga0134125_12954383 | Not Available | 516 | Open in IMG/M |
| 3300010373|Ga0134128_11422803 | Not Available | 764 | Open in IMG/M |
| 3300010373|Ga0134128_11568344 | Not Available | 725 | Open in IMG/M |
| 3300010375|Ga0105239_11127678 | Not Available | 903 | Open in IMG/M |
| 3300010379|Ga0136449_100566835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1947 | Open in IMG/M |
| 3300010379|Ga0136449_103299935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 621 | Open in IMG/M |
| 3300010399|Ga0134127_10947199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 919 | Open in IMG/M |
| 3300012477|Ga0157336_1036570 | Not Available | 513 | Open in IMG/M |
| 3300012483|Ga0157337_1006797 | Not Available | 801 | Open in IMG/M |
| 3300012489|Ga0157349_1045430 | Not Available | 507 | Open in IMG/M |
| 3300012490|Ga0157322_1015066 | Not Available | 684 | Open in IMG/M |
| 3300012498|Ga0157345_1031512 | Not Available | 597 | Open in IMG/M |
| 3300012885|Ga0157287_1003503 | Not Available | 1468 | Open in IMG/M |
| 3300012908|Ga0157286_10068580 | Not Available | 963 | Open in IMG/M |
| 3300012948|Ga0126375_10012781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3636 | Open in IMG/M |
| 3300012948|Ga0126375_11778406 | Not Available | 537 | Open in IMG/M |
| 3300012955|Ga0164298_10356297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 929 | Open in IMG/M |
| 3300012957|Ga0164303_10211771 | Not Available | 1082 | Open in IMG/M |
| 3300012984|Ga0164309_10421567 | Not Available | 1001 | Open in IMG/M |
| 3300012984|Ga0164309_11517874 | Not Available | 573 | Open in IMG/M |
| 3300013102|Ga0157371_11211140 | Not Available | 582 | Open in IMG/M |
| 3300013105|Ga0157369_11737904 | Not Available | 634 | Open in IMG/M |
| 3300013105|Ga0157369_12581869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300013296|Ga0157374_11601893 | Not Available | 675 | Open in IMG/M |
| 3300013296|Ga0157374_11844608 | Not Available | 630 | Open in IMG/M |
| 3300013296|Ga0157374_12445079 | Not Available | 550 | Open in IMG/M |
| 3300013307|Ga0157372_10804685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1092 | Open in IMG/M |
| 3300014325|Ga0163163_10140460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2458 | Open in IMG/M |
| 3300015077|Ga0173483_10671049 | Not Available | 581 | Open in IMG/M |
| 3300015372|Ga0132256_101876376 | Not Available | 707 | Open in IMG/M |
| 3300015373|Ga0132257_103786904 | Not Available | 550 | Open in IMG/M |
| 3300017944|Ga0187786_10217043 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 737 | Open in IMG/M |
| 3300017947|Ga0187785_10114864 | Not Available | 1093 | Open in IMG/M |
| 3300017973|Ga0187780_10201429 | Not Available | 1388 | Open in IMG/M |
| 3300018032|Ga0187788_10319928 | Not Available | 633 | Open in IMG/M |
| 3300018058|Ga0187766_10896426 | Not Available | 625 | Open in IMG/M |
| 3300019877|Ga0193722_1046322 | Not Available | 1106 | Open in IMG/M |
| 3300019879|Ga0193723_1023148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1896 | Open in IMG/M |
| 3300021560|Ga0126371_11788107 | Not Available | 736 | Open in IMG/M |
| 3300021560|Ga0126371_13244874 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300025227|Ga0207638_1006897 | Not Available | 517 | Open in IMG/M |
| 3300025560|Ga0210108_1039226 | Not Available | 894 | Open in IMG/M |
| 3300025728|Ga0207655_1122483 | Not Available | 859 | Open in IMG/M |
| 3300025916|Ga0207663_11535064 | Not Available | 536 | Open in IMG/M |
| 3300025922|Ga0207646_11413277 | Not Available | 605 | Open in IMG/M |
| 3300025925|Ga0207650_11568238 | Not Available | 559 | Open in IMG/M |
| 3300025936|Ga0207670_11012326 | Not Available | 699 | Open in IMG/M |
| 3300025937|Ga0207669_11709669 | Not Available | 537 | Open in IMG/M |
| 3300025941|Ga0207711_10046325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3715 | Open in IMG/M |
| 3300025941|Ga0207711_11386693 | Not Available | 645 | Open in IMG/M |
| 3300025945|Ga0207679_10286103 | Not Available | 1415 | Open in IMG/M |
| 3300026041|Ga0207639_11170699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 721 | Open in IMG/M |
| 3300026116|Ga0207674_11068622 | Not Available | 776 | Open in IMG/M |
| 3300026772|Ga0207596_105618 | Not Available | 534 | Open in IMG/M |
| 3300026853|Ga0207443_1012335 | Not Available | 510 | Open in IMG/M |
| 3300026898|Ga0207788_1025086 | Not Available | 526 | Open in IMG/M |
| 3300026904|Ga0207584_1001578 | Not Available | 846 | Open in IMG/M |
| 3300027003|Ga0207722_1000483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5555 | Open in IMG/M |
| 3300027036|Ga0207467_1023206 | Not Available | 532 | Open in IMG/M |
| 3300027364|Ga0209967_1003985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1949 | Open in IMG/M |
| 3300027665|Ga0209983_1037686 | Not Available | 1041 | Open in IMG/M |
| 3300027682|Ga0209971_1174359 | Not Available | 530 | Open in IMG/M |
| 3300028587|Ga0247828_10386252 | Not Available | 801 | Open in IMG/M |
| 3300028711|Ga0307293_10211348 | Not Available | 617 | Open in IMG/M |
| 3300028875|Ga0307289_10087280 | Not Available | 1267 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1090031 | Not Available | 745 | Open in IMG/M |
| 3300031474|Ga0170818_112369589 | Not Available | 815 | Open in IMG/M |
| 3300031716|Ga0310813_11331604 | Not Available | 664 | Open in IMG/M |
| 3300031720|Ga0307469_12417763 | Not Available | 513 | Open in IMG/M |
| 3300031724|Ga0318500_10110093 | Not Available | 1262 | Open in IMG/M |
| 3300031748|Ga0318492_10149855 | Not Available | 1176 | Open in IMG/M |
| 3300031777|Ga0318543_10206165 | Not Available | 873 | Open in IMG/M |
| 3300031781|Ga0318547_10003817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 6170 | Open in IMG/M |
| 3300032025|Ga0318507_10123320 | Not Available | 1095 | Open in IMG/M |
| 3300032051|Ga0318532_10074383 | Not Available | 1184 | Open in IMG/M |
| 3300032174|Ga0307470_10754108 | Not Available | 748 | Open in IMG/M |
| 3300032174|Ga0307470_11168160 | Not Available | 623 | Open in IMG/M |
| 3300032180|Ga0307471_101661991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 793 | Open in IMG/M |
| 3300032261|Ga0306920_100203640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2953 | Open in IMG/M |
| 3300033289|Ga0310914_11247029 | Not Available | 645 | Open in IMG/M |
| 3300034090|Ga0326723_0345392 | Not Available | 671 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.39% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.39% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.39% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.39% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.39% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.51% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.51% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.51% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 3.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.63% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.75% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.88% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.88% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.88% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.88% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Environmental | Open in IMG/M |
| 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Host-Associated | Open in IMG/M |
| 3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005104 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAC | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
| 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Host-Associated | Open in IMG/M |
| 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
| 3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025227 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026772 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A2-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026853 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026898 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 79 (SPAdes) | Environmental | Open in IMG/M |
| 3300026904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A5-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027003 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes) | Environmental | Open in IMG/M |
| 3300027036 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A5-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1063305182 | 3300000955 | Soil | PGERVGNTGYIENPNQRAGSVINNTSAGLLNTQSALPGPWTLPFKTNPWIGY* |
| JGI24032J14994_1001454 | 3300001430 | Corn, Switchgrass And Miscanthus Rhizosphere | NTGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY* |
| JGI24741J21665_10751741 | 3300001915 | Corn Rhizosphere | SYLDPGTETFPGERVGNTGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY* |
| Ga0055433_100695712 | 3300004025 | Natural And Restored Wetlands | ERVGNTGYVENPGQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0063356_1049608351 | 3300004463 | Arabidopsis Thaliana Rhizosphere | NTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0062595_1018779372 | 3300004479 | Soil | HFYAQLPNQRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY* |
| Ga0066818_10104041 | 3300005104 | Soil | RIGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0070680_1008648411 | 3300005336 | Corn Rhizosphere | PGERVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0070680_1017256991 | 3300005336 | Corn Rhizosphere | NPNQYAGSVINNTSAGLYNTSSALPGPWTLPFKSNPWIGY* |
| Ga0070682_1000550251 | 3300005337 | Corn Rhizosphere | VGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0070682_1003251332 | 3300005337 | Corn Rhizosphere | TGYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY* |
| Ga0070691_101471331 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | KRSYLDPGTETFPGERVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0070674_1016338581 | 3300005356 | Miscanthus Rhizosphere | PTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY* |
| Ga0070711_1018190852 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RSDHFYAQLPNQRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY* |
| Ga0070707_1016646201 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VGNTGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY* |
| Ga0070679_1020268812 | 3300005530 | Corn Rhizosphere | TGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0070664_1007725091 | 3300005564 | Corn Rhizosphere | ERVGNTGYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY* |
| Ga0068857_1001056381 | 3300005577 | Corn Rhizosphere | RVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0066903_1027861101 | 3300005764 | Tropical Forest Soil | RSFLDPGTETSPGERVRNTGYVENPNQRASSVIDNTSAGLLNTQSALPGPWTLPSKNNPWLQY* |
| Ga0075434_1011683701 | 3300006871 | Populus Rhizosphere | ERVRNTGYIENPNQRAGSVIDNTAAGIMNNQTALPGPWTLPFKSNPWIGY* |
| Ga0075429_1009248172 | 3300006880 | Populus Rhizosphere | GYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0075426_102303821 | 3300006903 | Populus Rhizosphere | VGNTGYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY* |
| Ga0075424_1023407991 | 3300006904 | Populus Rhizosphere | QYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0105240_109062712 | 3300009093 | Corn Rhizosphere | GGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY* |
| Ga0111539_102050283 | 3300009094 | Populus Rhizosphere | GTETFPGERVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0105245_106502122 | 3300009098 | Miscanthus Rhizosphere | LDPGTESFPGERSDHFYAQLPNQRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY* |
| Ga0105245_113193902 | 3300009098 | Miscanthus Rhizosphere | TETFPGERVGNTGYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY* |
| Ga0105241_107633662 | 3300009174 | Corn Rhizosphere | ESFPGERSDHFYAQLPNQRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY* |
| Ga0105242_102364513 | 3300009176 | Miscanthus Rhizosphere | YVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY* |
| Ga0105237_113452022 | 3300009545 | Corn Rhizosphere | FYAQLPNQRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY* |
| Ga0105249_112172402 | 3300009553 | Switchgrass Rhizosphere | TQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY* |
| Ga0126380_100866423 | 3300010043 | Tropical Forest Soil | SYLDPGTETFPGERVRNTGYIENPNQRASSVINNTSAGLLNTQSALPGPWTLPSKNNPWLGY* |
| Ga0126382_116409351 | 3300010047 | Tropical Forest Soil | DPGTETFPGERVGNTGYIANPNQRAGGVIDNTSAGLLNTQSALPGPWTLPFKTNPWIGY* |
| Ga0134125_129543832 | 3300010371 | Terrestrial Soil | FPGERVGNTGYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY* |
| Ga0134128_114228031 | 3300010373 | Terrestrial Soil | ENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0134128_115683441 | 3300010373 | Terrestrial Soil | GERVGNTGYVENPGQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0105239_111276782 | 3300010375 | Corn Rhizosphere | ERVGNTGYVQTMTQTAGSPIDNTSAGLSNRQSPLPGPFTLPSKNNPWLQY* |
| Ga0136449_1005668351 | 3300010379 | Peatlands Soil | PNQRAAGVLDNTIFGLQNTQSPLPGPWTLPGKNNPWIGY* |
| Ga0136449_1032999352 | 3300010379 | Peatlands Soil | QRASSVLDSTIFGLSNTQSPLPGPWTLPGKNNPWLQY* |
| Ga0134127_109471991 | 3300010399 | Terrestrial Soil | FPGERSDHFYAQLPNQRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY* |
| Ga0157336_10365701 | 3300012477 | Arabidopsis Rhizosphere | YAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0157337_10067971 | 3300012483 | Arabidopsis Rhizosphere | TETFPGERVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0157349_10454301 | 3300012489 | Unplanted Soil | YLDPGTETFPGERVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0157322_10150662 | 3300012490 | Arabidopsis Rhizosphere | QTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY* |
| Ga0157345_10315121 | 3300012498 | Arabidopsis Rhizosphere | IENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0157287_10035031 | 3300012885 | Soil | IGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY* |
| Ga0157286_100685801 | 3300012908 | Soil | SYLDPGTETFPGERVGNTGYVENPGQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY* |
| Ga0126375_100127816 | 3300012948 | Tropical Forest Soil | ERVGNTGYIENPNQRAGSVINNTSAGLLNTQSALPGPWTLPFKSNPWIGY* |
| Ga0126375_117784062 | 3300012948 | Tropical Forest Soil | YIENPNQRAGSVINNTSAGLLNTQSALPGPWTLPSKNNPWLGY* |
| Ga0164298_103562971 | 3300012955 | Soil | QRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY* |
| Ga0164303_102117712 | 3300012957 | Soil | AGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY* |
| Ga0164309_104215671 | 3300012984 | Soil | NPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY* |
| Ga0164309_115178741 | 3300012984 | Soil | NQYAGSVINNTSAGLYNTQSALPGPWTLPSKRNPWIGY* |
| Ga0157371_112111401 | 3300013102 | Corn Rhizosphere | IENPNQRAGSVIDNTAAGIMNNQTALPGPWTLPFKSNPWIGY* |
| Ga0157369_117379041 | 3300013105 | Corn Rhizosphere | KRSYLDPGTETFPGERVGNTGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY* |
| Ga0157369_125818691 | 3300013105 | Corn Rhizosphere | KRSFLDPGTETFPGERVGNTGYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY* |
| Ga0157374_116018932 | 3300013296 | Miscanthus Rhizosphere | GSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY* |
| Ga0157374_118446082 | 3300013296 | Miscanthus Rhizosphere | DPGTETFPGERVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPSKRNPWIGY* |
| Ga0157374_124450792 | 3300013296 | Miscanthus Rhizosphere | PGERVRNTGYIENPNQRAGSVIDNTAAGIMNNQTALPGPWTLPFKSNPWIGY* |
| Ga0157372_108046851 | 3300013307 | Corn Rhizosphere | AGGVIDNTSAVLLNTHSALPGPWTLPSKNNPWLFY* |
| Ga0163163_101404603 | 3300014325 | Switchgrass Rhizosphere | QNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY* |
| Ga0173483_106710492 | 3300015077 | Soil | NTGYIENPGQYAGSVINNTSAGLYNTSSALPGPWTLPFKSNPWIGY* |
| Ga0132256_1018763761 | 3300015372 | Arabidopsis Rhizosphere | AGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY* |
| Ga0132257_1037869042 | 3300015373 | Arabidopsis Rhizosphere | GERVGNTGYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY* |
| Ga0187786_102170431 | 3300017944 | Tropical Peatland | PGTETFPGERSDHYYIENPNHRAGSTIDNTSAGLLNTQSALPGPWTLPSKNNPWLFGP |
| Ga0187785_101148642 | 3300017947 | Tropical Peatland | DPGTETFPGERVGNTGYVENPNQRASGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLQY |
| Ga0187780_102014291 | 3300017973 | Tropical Peatland | PNHRAAGVVDNTSAGLYNTQSALPGPWTLPGKNNPWIFGP |
| Ga0187788_103199281 | 3300018032 | Tropical Peatland | RASGVLDNTPAGLLNTQSALPGPWTLPSKNNPWLQY |
| Ga0187766_108964261 | 3300018058 | Tropical Peatland | TGFIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPGKNNPWIGY |
| Ga0193722_10463221 | 3300019877 | Soil | GERVGNTGYVQTPTQTAGSVINNTSAGLSNTQSALPGPFTLPSKNNPWLQY |
| Ga0193723_10231481 | 3300019879 | Soil | LNPGTETFPGERVGNTGYVQTPTQTAGSVINNTSAGLSNTQSALPGPFTLPSKNNPWLQY |
| Ga0126371_117881072 | 3300021560 | Tropical Forest Soil | ERVGNTGYVQNATQTAGSVIDNTSAGLSNTQSALPGPFTLPSKNNPWLQY |
| Ga0126371_132448742 | 3300021560 | Tropical Forest Soil | GTETFPGERVGNTAYIENPNQRASSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY |
| Ga0207638_10068972 | 3300025227 | Corn, Switchgrass And Miscanthus Rhizosphere | ERVGNTGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY |
| Ga0210108_10392262 | 3300025560 | Natural And Restored Wetlands | GTETFPGEHGRNTDYVERPNQRASGVLDNTPAGLYNTQSALPGPWTLPSKNNPWLQY |
| Ga0207655_11224832 | 3300025728 | Miscanthus Rhizosphere | TETFPGERVGNTGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY |
| Ga0207663_115350641 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LDPGTETFPGERVGNTGYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY |
| Ga0207646_114132771 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VGNTGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY |
| Ga0207650_115682382 | 3300025925 | Switchgrass Rhizosphere | TQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY |
| Ga0207670_110123262 | 3300025936 | Switchgrass Rhizosphere | VQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY |
| Ga0207669_117096691 | 3300025937 | Miscanthus Rhizosphere | GYVQNPTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY |
| Ga0207711_100463255 | 3300025941 | Switchgrass Rhizosphere | VGNTGYIENPNQYAGSVINNTSAGLYNTSSALPGPWTLPFKSNPWIGY |
| Ga0207711_113866931 | 3300025941 | Switchgrass Rhizosphere | TAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY |
| Ga0207679_102861031 | 3300025945 | Corn Rhizosphere | YLDPGTESFPGERVRNTGYIENPNQRAGSVIDNTAAGIMNNQTALPGPWTLPFKSNPWIG |
| Ga0207639_111706992 | 3300026041 | Corn Rhizosphere | QKRSFLDPGTETFPGERVGNTGYVQNPTQTAGSVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY |
| Ga0207674_110686221 | 3300026116 | Corn Rhizosphere | ERVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY |
| Ga0207596_1056181 | 3300026772 | Soil | RVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY |
| Ga0207443_10123352 | 3300026853 | Soil | ENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY |
| Ga0207788_10250862 | 3300026898 | Tropical Forest Soil | HFYAELPNHRAAGVVDNTSAGLYNTQSALPGPFTLPFKNSPWLQY |
| Ga0207584_10015781 | 3300026904 | Soil | GYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY |
| Ga0207722_10004831 | 3300027003 | Tropical Forest Soil | HRAGGVIDNTIYGLTNTQSPLPGPWTLPGKNNPWIGY |
| Ga0207467_10232061 | 3300027036 | Soil | GYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY |
| Ga0209967_10039853 | 3300027364 | Arabidopsis Thaliana Rhizosphere | IENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY |
| Ga0209983_10376861 | 3300027665 | Arabidopsis Thaliana Rhizosphere | YIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY |
| Ga0209971_11743591 | 3300027682 | Arabidopsis Thaliana Rhizosphere | QTFPGERIGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY |
| Ga0247828_103862522 | 3300028587 | Soil | IGYIENPNQRAGSVIDNTSAGLLNTQSALPGPWTLPFKSNPWIGY |
| Ga0307293_102113481 | 3300028711 | Soil | IGNTGYVQNPTQTAGSVIDNTSAGLSNTQSALPGPFTLPSKNNPWLQY |
| Ga0307289_100872801 | 3300028875 | Soil | FPGERVGNTGYVQTPTQTAGSVINNTSAGLSNTQSALPGPFTLPSKNNPWLQY |
| (restricted) Ga0255312_10900312 | 3300031248 | Sandy Soil | PGERVGNTGYIENPNQYAGSVINNTSAGLYNTQSALPGPWTLPFKSNPWIGY |
| Ga0170818_1123695892 | 3300031474 | Forest Soil | ETFPGERVGNTGYIENPNQYAGSVLNNTSAGLYNTQSALPGPWTLPSKRNPWIGY |
| Ga0310813_113316041 | 3300031716 | Soil | YAQLPNQRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY |
| Ga0307469_124177632 | 3300031720 | Hardwood Forest Soil | ERVGNTGYIENPNQRAGSVINNTSAGLLNTQSALPGPWTLPFKTNPWIGY |
| Ga0318500_101100932 | 3300031724 | Soil | PNHRAGGVIDNTIYGLTNTQSPLPGPWTLPGKNNPWIGY |
| Ga0318492_101498551 | 3300031748 | Soil | LDPGTETFPGERVGNIGYVQNPTQTAGSVIDNTSAGLLNKQSPLPGPWTLPSKNNPWIQY |
| Ga0318543_102061652 | 3300031777 | Soil | ETFPGEHISSTDYVWLPNHRAGGVIDNTIYGLENTQSPLPGPWTLPGKNNPWIGY |
| Ga0318547_100038171 | 3300031781 | Soil | SFLDPGTETFPGERVGNIGYVQNPTQTAGSVIDNTSAGLLNRQSPLPGPWTLPSKNNPWIQY |
| Ga0318507_101233201 | 3300032025 | Soil | ISSTDYVWLPNHRAGGVIDNTIYGLENTQSPLPGPWTLPGKNNPWIGY |
| Ga0318532_100743832 | 3300032051 | Soil | NHRAGGVIDNTIYGLENTQSPLPGPWTLPGKNNPWIGY |
| Ga0307470_107541082 | 3300032174 | Hardwood Forest Soil | PTQTAGSVIDNTSAGLNNRQSPLPGPFTLPSKNNPWLQY |
| Ga0307470_111681602 | 3300032174 | Hardwood Forest Soil | FYAELPNQRAGGVIDNTSAGLLNTQSALPGPWTLPSRNNPWLFY |
| Ga0307471_1016619911 | 3300032180 | Hardwood Forest Soil | NQRAGGVIDNTSAGLLNTQSALPGPWTLPSKNNPWLFY |
| Ga0306920_1002036405 | 3300032261 | Soil | AGGVIDNTIYGLENTQSPLPGPWTLPGKNNPWIGY |
| Ga0310914_112470291 | 3300033289 | Soil | ETSPGERVRNTGYVENPNQRASSVIDNTSAGLLNTQSALPGPWTLPSKNNPWLQY |
| Ga0326723_0345392_504_671 | 3300034090 | Peat Soil | ETFPGEHGRNTDYVERPNQRASGVLDNTPAGLLNTQSALPGPWTLPSKNNPWLQY |
| ⦗Top⦘ |