NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F081796

Metagenome / Metatranscriptome Family F081796

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081796
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 174 residues
Representative Sequence AALKEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRAMLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Number of Associated Samples 106
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.75 %
% of genes near scaffold ends (potentially truncated) 96.49 %
% of genes from short scaffolds (< 2000 bps) 95.61 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.77

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(41.228 % of family members)
Environment Ontology (ENVO) Unclassified
(45.614 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(50.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 64.29%    β-sheet: 0.00%    Coil/Unstructured: 35.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.77
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.118.8.6: SusD-liked3ckca_3ckc0.72459
a.118.7.1: 14-3-3 proteind3efza13efz0.70352
a.118.8.0: automated matchesd5j90a_5j900.68982
a.118.7.1: 14-3-3 proteind3mhra13mhr0.68202
a.118.8.6: SusD-liked3cgha13cgh0.67503


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF16697Yop-YscD_cpl 1.75
PF04828GFA 0.88
PF00498FHA 0.88
PF00478IMPDH 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000651|AP72_2010_repI_A10DRAFT_1015129All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium992Open in IMG/M
3300001978|JGI24747J21853_1038790All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Melioribacteraceae → Melioribacter → Melioribacter roseus561Open in IMG/M
3300002074|JGI24748J21848_1014056All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium949Open in IMG/M
3300002076|JGI24749J21850_1015108All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1083Open in IMG/M
3300003659|JGI25404J52841_10026522All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1246Open in IMG/M
3300005162|Ga0066814_10116837All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium513Open in IMG/M
3300005290|Ga0065712_10516915All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium638Open in IMG/M
3300005293|Ga0065715_10286906All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1072Open in IMG/M
3300005363|Ga0008090_15868404All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium578Open in IMG/M
3300005434|Ga0070709_11120288All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium630Open in IMG/M
3300005439|Ga0070711_101791479All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium539Open in IMG/M
3300005458|Ga0070681_10476140All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1161Open in IMG/M
3300005530|Ga0070679_100448920All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1234Open in IMG/M
3300005614|Ga0068856_101514143All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium685Open in IMG/M
3300005615|Ga0070702_100776320All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium739Open in IMG/M
3300005764|Ga0066903_102265355All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1049Open in IMG/M
3300005764|Ga0066903_103420546All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium856Open in IMG/M
3300005841|Ga0068863_101410934All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium704Open in IMG/M
3300005983|Ga0081540_1000442All Organisms → cellular organisms → Bacteria → Proteobacteria40989Open in IMG/M
3300006163|Ga0070715_10701497All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium604Open in IMG/M
3300006173|Ga0070716_101761270All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium512Open in IMG/M
3300006358|Ga0068871_100726990All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium911Open in IMG/M
3300006804|Ga0079221_10201147All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1091Open in IMG/M
3300006854|Ga0075425_101821199All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium683Open in IMG/M
3300006871|Ga0075434_101843427All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium611Open in IMG/M
3300006904|Ga0075424_101569571All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium698Open in IMG/M
3300009553|Ga0105249_10002029All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales17572Open in IMG/M
3300009792|Ga0126374_10407106All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium953Open in IMG/M
3300010046|Ga0126384_11665584All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium602Open in IMG/M
3300010358|Ga0126370_12039323All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium562Open in IMG/M
3300010376|Ga0126381_100711520All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1437Open in IMG/M
3300010376|Ga0126381_101181025All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1106Open in IMG/M
3300010398|Ga0126383_10945889All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium949Open in IMG/M
3300010398|Ga0126383_11242978All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium835Open in IMG/M
3300011107|Ga0151490_1717237All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium722Open in IMG/M
3300012951|Ga0164300_10794669All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium586Open in IMG/M
3300012989|Ga0164305_12038678All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium524Open in IMG/M
3300013296|Ga0157374_10484184All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1241Open in IMG/M
3300014326|Ga0157380_10260858All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1574Open in IMG/M
3300015261|Ga0182006_1123345All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium898Open in IMG/M
3300015372|Ga0132256_100954790All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium973Open in IMG/M
3300016294|Ga0182041_10566460All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium994Open in IMG/M
3300016319|Ga0182033_10753355All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium855Open in IMG/M
3300016371|Ga0182034_11806833All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium539Open in IMG/M
3300017792|Ga0163161_10010160All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium6516Open in IMG/M
3300018064|Ga0187773_10548734All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium698Open in IMG/M
3300020070|Ga0206356_11603747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium585Open in IMG/M
3300021560|Ga0126371_13037944All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium568Open in IMG/M
3300025885|Ga0207653_10367926All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium562Open in IMG/M
3300025899|Ga0207642_10009316All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium3412Open in IMG/M
3300025913|Ga0207695_10403220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1252Open in IMG/M
3300025931|Ga0207644_10998383All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium702Open in IMG/M
3300025939|Ga0207665_11661526All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium506Open in IMG/M
3300026078|Ga0207702_11652949All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium633Open in IMG/M
3300027725|Ga0209178_1138994All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium833Open in IMG/M
3300030336|Ga0247826_10435650All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium977Open in IMG/M
3300030336|Ga0247826_10508289All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium911Open in IMG/M
3300031538|Ga0310888_10460429All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium755Open in IMG/M
3300031543|Ga0318516_10643566All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium604Open in IMG/M
3300031543|Ga0318516_10719020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium566Open in IMG/M
3300031549|Ga0318571_10124258All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium869Open in IMG/M
3300031561|Ga0318528_10774625All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium513Open in IMG/M
3300031572|Ga0318515_10078738All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1705Open in IMG/M
3300031573|Ga0310915_10670872All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium733Open in IMG/M
3300031681|Ga0318572_10976506All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium503Open in IMG/M
3300031719|Ga0306917_11550007All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium509Open in IMG/M
3300031723|Ga0318493_10747469All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium549Open in IMG/M
3300031724|Ga0318500_10285352All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium806Open in IMG/M
3300031736|Ga0318501_10050909All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1935Open in IMG/M
3300031747|Ga0318502_10360255All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium861Open in IMG/M
3300031764|Ga0318535_10356239All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium654Open in IMG/M
3300031781|Ga0318547_10227772All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1119Open in IMG/M
3300031792|Ga0318529_10253890All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium818Open in IMG/M
3300031794|Ga0318503_10187247All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium670Open in IMG/M
3300031795|Ga0318557_10143810All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1076Open in IMG/M
3300031796|Ga0318576_10359945All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium687Open in IMG/M
3300031797|Ga0318550_10356738All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium708Open in IMG/M
3300031798|Ga0318523_10226452All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium934Open in IMG/M
3300031819|Ga0318568_10033485All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2888Open in IMG/M
3300031819|Ga0318568_10398520All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium857Open in IMG/M
3300031832|Ga0318499_10300276All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium620Open in IMG/M
3300031835|Ga0318517_10084947All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1374Open in IMG/M
3300031846|Ga0318512_10077813All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1528Open in IMG/M
3300031859|Ga0318527_10213946All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium817Open in IMG/M
3300031860|Ga0318495_10062385All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1657Open in IMG/M
3300031880|Ga0318544_10398495All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium535Open in IMG/M
3300031894|Ga0318522_10262631All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium654Open in IMG/M
3300031896|Ga0318551_10116401All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1436Open in IMG/M
3300031896|Ga0318551_10354076All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium831Open in IMG/M
3300031897|Ga0318520_10254392All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1049Open in IMG/M
3300031912|Ga0306921_11790235All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium661Open in IMG/M
3300031941|Ga0310912_10468104All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium983Open in IMG/M
3300031942|Ga0310916_10480700All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1058Open in IMG/M
3300031945|Ga0310913_10811123All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium660Open in IMG/M
3300031946|Ga0310910_10571006All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium897Open in IMG/M
3300031946|Ga0310910_11529857All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium511Open in IMG/M
3300032010|Ga0318569_10138837All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1114Open in IMG/M
3300032012|Ga0310902_10954226All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium593Open in IMG/M
3300032041|Ga0318549_10098914All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1270Open in IMG/M
3300032043|Ga0318556_10242268All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium941Open in IMG/M
3300032044|Ga0318558_10049701All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1850Open in IMG/M
3300032055|Ga0318575_10431045All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium669Open in IMG/M
3300032060|Ga0318505_10312065All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium742Open in IMG/M
3300032067|Ga0318524_10717322All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium528Open in IMG/M
3300032090|Ga0318518_10588057All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium568Open in IMG/M
3300032091|Ga0318577_10548477All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium550Open in IMG/M
3300032094|Ga0318540_10406787All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium657Open in IMG/M
3300032770|Ga0335085_10377693All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1652Open in IMG/M
3300032892|Ga0335081_10735453All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1190Open in IMG/M
3300032954|Ga0335083_10363202All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1249Open in IMG/M
3300032955|Ga0335076_11403586All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium584Open in IMG/M
3300033004|Ga0335084_12269383All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium525Open in IMG/M
3300033290|Ga0318519_10115607All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1462Open in IMG/M
3300033480|Ga0316620_11675189All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium630Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil41.23%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.02%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.14%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.51%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.63%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.75%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.75%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.75%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.75%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.88%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.88%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.88%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.88%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000651Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10EnvironmentalOpen in IMG/M
3300001978Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6Host-AssociatedOpen in IMG/M
3300002074Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1Host-AssociatedOpen in IMG/M
3300002076Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3Host-AssociatedOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015261Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AP72_2010_repI_A10DRAFT_101512913300000651Forest SoilDPKLVDAQAGLAACIGLRMYLHKTPDDEMKAMLARVKALLADAQALEPGNPRLLWVRGPMEWWTPKGSPDDTIDAHQAKAMATYARGLDEIQASTRAAPRPLQPTWGEAELHMSLAWSYLHLRRDPDVAQSEIHGRRALELVPSWHYVRDILMPQIEKARRTATR*
JGI24747J21853_103879013300001978Corn, Switchgrass And Miscanthus RhizosphereAGNAPRSLVLYWQGFALWRRAINGFNETPTPTDLESDVLAASAHFEAALTDNPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARK
JGI24748J21848_101405623300002074Corn, Switchgrass And Miscanthus RhizosphereVLYWQGFALWRRAINGFNETPTPTDLESDVLAASAHFEAALTDNPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR*
JGI24749J21850_101510813300002076Corn, Switchgrass And Miscanthus RhizosphereWRRAINGFNETPTPTDLESDVLAASAHFEAALTDNPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR*
JGI25404J52841_1002652223300003659Tabebuia Heterophylla RhizosphereVLYWRGFALWRRTINGFNVTPPPDDLAADAEAAGAEFEAALKEDPKLVDAQVGLIGCLGIRMYLHGKQDDETQALIARAKTLFADARALEPENPRLLWVTGPVEWRTPKGSPEDVVDSHQAKAMATYQRGLRAFPAASRPGPEPLRPTWGEAELHMSLAWSYLHRREPDASQAEIHGRRALELVPSWHYMRDVLMPQIEAARRTATR*
Ga0066814_1011683713300005162SoilNGFNETPTPTDLDADALAASTDFEAALKEDPRLVDAQAALAACIGLRMFLHGTVDDEMRAMLARAQGLLAAAQALEPANPRLLWVRGPMEWFTPRGSPEEMVDARQAKSIATYHRGLEGLPGSLRSGPEPLRPTWGEPELHMSLGWAYSKKRVPDLALAELHARKALELVP
Ga0065712_1051691513300005290Miscanthus RhizosphereGNAPRSLVLYWQGFALWRRAINGFNETPTPTDLESDVLAASAHFEAALTDNPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTA
Ga0065715_1028690623300005293Miscanthus RhizosphereSLVLYWQGFALWRRAINGFNETPTPTDLESDVLAASAHFEAALTDNPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR*
Ga0008090_1586840413300005363Tropical Rainforest SoilDLHAALASTPTGDSPKSLVLYWRAFALWRRAINGFNETPTPTDLEADATAAGAEFETALKEDPKFVDAQAGLAACLGMKMYFHGKVDDEMRALLARVKGLFADAEALEPQNPRLLWVKGPMEWWTPKGSPQEMVDTRQAKAIATYVRALEGLPGSLRSGPEPLRPTWGEAELHMSLAWSYLHRRVPDVPQAE
Ga0070709_1112028813300005434Corn, Switchgrass And Miscanthus RhizosphereLAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR*
Ga0070711_10179147913300005439Corn, Switchgrass And Miscanthus RhizosphereGNAPRSLVLYWQGFALWRRAINGFNETPTPTDLESDVLAASAHFEAALTDNPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQ
Ga0070681_1047614023300005458Corn RhizosphereAINGFNETPTPTDLESDVLAASAHFEAALTDNPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR*
Ga0070679_10044892013300005530Corn RhizosphereLVLYWQGFALWRRAINGFNETPTPTDLESDVLAASAHFEAALTDNPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR*
Ga0068856_10151414313300005614Corn RhizosphereTDLDSDALAASADFEAALKEDPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLARAKGLLAEAQALEPANPRLLWVRGPMEWFTPKDSPEEMIDARQAKSIATYHRGLEGLPGSLRSGPEPLRPTWGEPELHMSLGWAYSNRRVPDLAQAELHARRALELVPTWHYVRDILLPQIESARRTAAR*
Ga0070702_10077632013300005615Corn, Switchgrass And Miscanthus RhizosphereHFEAALTDNPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR*
Ga0066903_10226535513300005764Tropical Forest SoilNEKPTPTDLQADVEAASAEFEEALKEDPKLVDAQAGLAACLGLRMYLHGKPDEEMRALLARVQALLSEAQALEPGNPRLLWVRGPMEWFTPKGSPDDVLDARQAKSIATYLRGLEGIPGSLRSGPGPLRPTWGEPELHMSLAWAYLHRRVPDVSVAEVHGRKALQLVPSWHYMRDILMPQIEAARRTASRQD*
Ga0066903_10342054613300005764Tropical Forest SoilLAAAGDFQSALEEDPKLVDAQAGLAACIGIRMYLHGTPDDEMRAMLARVKALLADAQALEPGNPRLLWVRGPMEWWTPKGSPDDTMDTHQAKAMATYARGLEEIQAAPRTTSGSLQPSWGEAELHMSLAWSYLHLRRDPDVTQAEIHGRRALELVPSWHYMRDILMPQIEKARRTATR*
Ga0068863_10141093423300005841Switchgrass RhizosphereDDEMRAMLARAKGLLAEAQALEPANPRLLWVRGPMEWFTPKDSPEEMIDARQAKSIATYHRGLEGLPGSLRSGPEPLRPTWGEPELHMSLGWAYSNRRVPDLAQAELHARRALELVPTWHYVRDILLPQIESARRTAAR*
Ga0081540_1000442233300005983Tabebuia Heterophylla RhizosphereVRYWQGFALWRRAINGFNETPTPTDLDADALAAGEDFEGALKADPKLVDAQAGLAACIGLRMYLHGTPDDEMKAMLARVKTLFTGAQALEPGNPRLLWVRGPMEWWTPKGSPDDTIDAHQARAMATYARGLEEIQAAPRTTPRPLQPTWGEAELHMSLAWSYLHLRRDPDVAQAEIHGRRALELVPSWHYMRDILMPQIEKARRTATR*
Ga0070715_1070149713300006163Corn, Switchgrass And Miscanthus RhizosphereRALVLYWRGFALWRRAINGFNETPTPDDLGADANAAAAEFEASLQENPKLVDSQAALAACIGLRMYLHGTVDDEMRAMLARVKSLLAEAQALEPENPRLLWVRGPMEWFTPKGSPQEMLDERQARSIATYRRGLEGLPASLRSGPEPLRPTWGEPELHMSLGWAYLKKREPDVAQAELHARKALALVPSWHYVRDILVPQI
Ga0070716_10176127013300006173Corn, Switchgrass And Miscanthus RhizosphereRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR*
Ga0068871_10072699023300006358Miscanthus RhizosphereGFALWRRAINGFNETPTPTDLESDVVAASADFEAALREDPRLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPGNPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQRALEGLPGTLRSGPEPLRPTWGEPELHMSLGWAYSKKRVPDLAQAELHARKALALVPSWHYVRDILLPQIESARGTAAR*
Ga0079221_1020114713300006804Agricultural SoilQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPEDMLDAHQARSIATYQRALEGLPGTLRSGPEALRPTWGEPELHMSLGWAYAKKRVPDLAQAELHARKALALVPSWHYVRDILLPQIESARGTAAR*
Ga0075425_10182119913300006854Populus RhizosphereRALLARVQALLVQAQSLEPANPRLLWVRGPMEWFTPKGSPDDVLDARQAKSIATYRRGLEGLPGSLRSGPDPLQPTWGEPELHMSLAWSYLHRRVPDVSEAEVHGRKALQLVPSWHYMRDILMPQIEAARRTASRQD*
Ga0075434_10184342713300006871Populus RhizosphereGADASGAAAEFEASLKEDPKLVDAQAALAACIGLRMYLHGTVDDEMRAMLARVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPQEMLDERQARSIATYQRGLGGLPASLRSGPEPLRPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR*
Ga0075424_10156957123300006904Populus RhizosphereESDVLAASAHFEAALTDNPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPEDMLDAHQARSIATYQRALEGLPGTLRSGPEPLRPTWGEPELHMSLGWAYSKKRVPDLAQAELHARKALALVPSWHYVRDILLPQIESARGTAAR*
Ga0105249_10002029133300009553Switchgrass RhizosphereMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR*
Ga0126374_1040710623300009792Tropical Forest SoilQAGLAACLGLRMYLHGKPDDEMRALLARVQALLSEAQALEPGNPRLLWVRGPMEWFTPKGSPDDVLDARQAKSIATYLRGLEGIPGSLRSGPGPLRPTWGEPELHMSLAWAYLHRRVPDVSEAEVHGRKALQLVPSWHYMRDILMPQIEDARRTASRQE*
Ga0126384_1166558413300010046Tropical Forest SoilIRMFLHKTVDDEMRTMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPEEILDARQAKSIATYQRGLDGLPGSLRSGPDPLQPTWGEPELHMSLGWAYSKKRVPDLAQAELHARKALELVPSWHYVRDILLPQIESARRTAVR*
Ga0126370_1203932313300010358Tropical Forest SoilAQLAAAPTGDAPKSLVLYWQGFALWRRAINGFNETPTPTDLLQDAVAASDEFEAALKEDPKLVDAHAGLAACLGLRMYLHGTPDDEMRALLAQVKEHLAEAQALEPENPRLLWVRGPMEWWTPKGSPQDVIEAHQAKSMATYLRALEGLPGSLRSGPEPLRPTWGEPELHMSLGWAFLKKHEPDIA
Ga0126381_10071152023300010376Tropical Forest SoilAGCLGMRMYLHKTVDDEMRALLARVKQLLAEAEALEPENPRLLWVRGPMEWWTPKGSPQDVIEAHQAKALTTYSRALEGLPGSLRSGPEPLRPTWGEPELHMSLGWSYLKKREPDLVQAELHARKALALVPTWHYVRDILLPQIEAAKRTAAR*
Ga0126381_10118102523300010376Tropical Forest SoilTPTDLEADVLAASAEFEAALKEDPKLVDAQAGLAACIGLRMFLHKTVDDEMRTMLERVKALLAAAQALEPENPRLLWVRGPMEWFTPKGSPEEILDARQAKSIATYHRGLDGLPGSLRSGPDPLQPTWGEPELHMSLGWAYSKKRVPDLAQAELHARKALELVPSWHYVRDILLPQIESARRTAVR*
Ga0126383_1094588913300010398Tropical Forest SoilPRLVDAQAALVACIGIRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPEEILDARQAKSIATYHSGLEGLPGSLRSGPDPLQPTWGEPELHMSLGWAYSKKRVPDLAQAELHARKALELVPSWHYVRDILLPQIESARRTAVR*
Ga0126383_1124297823300010398Tropical Forest SoilAINGFNETPTPTDLLQDAVAASDEFEAALKEDPKLVDAHAGLAACLGLRMYLHGTPDDEMRALLAQVKEHLAEAQALEPENPRLLWVRGPMEWWTPKGSPQDVIEAHQAKSMATYLRALEGLPGSLRSGPEPLRPTWGEPELHMSLGWAFLKKHEPDIAQAELHARKALALVPTWHYVRDVLLPQIETAKRTAAR*
Ga0151490_171723713300011107SoilPRSLVLYWQGFSLWRRAINGFNETPTPTDLDADALAASTDFEAALKEDPRLVDAQAALAACIGLRMFLHGTVDDEMRAMLARAQGLLAAAQALEPANPRLLWVRGPMEWFTPRGSPEEMVDARQAKSIATYHRGLEGLPGSLRSGPEPLRPTWGEPELHMSLGWAYSKKRVPDLALAELHARKALELVPTWHYVRDILLPQIEVARTANR*
Ga0164300_1079466913300012951SoilVDAQAALAACIGLGMFLHESVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQRALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR*
Ga0164305_1203867813300012989SoilAHFEAALTDNPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQRALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR*
Ga0157374_1048418413300013296Miscanthus RhizosphereLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR*
Ga0157380_1026085813300014326Switchgrass RhizosphereINGFNETPTPTDLESDVLAASAHFEAALTDNPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR*
Ga0182006_112334523300015261RhizosphereLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYSKKRVPDLAQAEVHARKALGLVPSWHYVRDILLPQIESARRTAAR*
Ga0132256_10095479023300015372Arabidopsis RhizosphereGGDFEAALTADPKLVDAQAGLAACIGLRMYLHKTPDDEMRAMLARVKSLLADAQALEPGNPRLLWVRGPMEWWTPKGSPQDMLDAHQAKAMTTYARGLEEIQGSHGRPSEPLRPSWGEAELHMSLAWAYLNRREPDVAQAEIHGRRALELVPSWHYMRDILMPQIEKARRTATR*
Ga0182041_1056646013300016294SoilETPTPTDLEADAVAAGADFEAALKEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRAMLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAMATYLRGLEEIQGAGPLRPEPLRPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0182033_1075335523300016319SoilEAALKEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRALLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDPAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0182034_1180683313300016371SoilLEADVLAASSEFEAALKENPRLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPEEMVDARQAKSIATYHRGLEGLPGSLRSGPDSLQPTWGEPELHMSLGWAYSKKRVPDLAQAELHARKALELVPSWHYVRDILLPQIESARRT
Ga0163161_1001016013300017792Switchgrass RhizosphereAPRSLVLYWQGFALWRRAINGFNETPTPTDLESDVLAASAHFEAALTDNPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR
Ga0187773_1054873423300018064Tropical PeatlandAEAEALEPENPRLLWVRGPTEWWAPPGSPPDQVDARQARAIATYRRGIEALGSSGPGAGPLRPSWGEPELHMSLAWSYLNRRLPDLEQAELHARQALALVPSWHYVRDILLPQIEAARGSAAR
Ga0206356_1160374713300020070Corn, Switchgrass And Miscanthus RhizosphereTDLESDVLAASAHFEAALTDNPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQRALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR
Ga0126371_1303794413300021560Tropical Forest SoilPKLVDAQAGLAACIGLKMYFHGKPDDEMRAMLARVQAILADAQAREPENPRLLWVRGPMEWFTPKGSPDDVVDARQAKSIATYQRGLAGLPGSLRSRPEALQPTWGEPELHMSLGWAYLKRRVPDLGQADAHARKALELVPTWHYVRDILIPQIEKARRTASR
Ga0207653_1036792613300025885Corn, Switchgrass And Miscanthus RhizosphereETPTPTDLESDVLAASAHFEAALTDNPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQILEAKAK
Ga0207642_1000931643300025899Miscanthus RhizosphereMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQRALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR
Ga0207695_1040322013300025913Corn RhizosphereMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR
Ga0207644_1099838323300025931Switchgrass RhizosphereRMFHKTVDDEMRAMLARAKGLLAEAQALEPANPRLLWVRGPMEWFTPKDSPEEMIDARQAKSIATYHRGLEGLPGSLRSGPEPLRPTWGEPELHMSLGWAYSNRRVPDLAQAELHARRALELVPTWHYVRDILLPQIESARRTAAR
Ga0207665_1166152613300025939Corn, Switchgrass And Miscanthus RhizosphereLTDNPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR
Ga0207702_1165294913300026078Corn RhizosphereFALWRRAINGFNETPTPTDLDSDALAASADFEAALKEDPKLVDAQAALAACIGLRMFHKTVDDEMRAMLARAKGLLAEAQALEPANPRLLWVRGPMEWFTPKDSPEEMIDARQAKSIATYHRGLEGLPGSLRSGPEPLRPTWGEPELHMSLGWAYSNRRVPDLAQAELHARRALELVPTWHYVRDILLPQIESARRTAAR
Ga0209178_113899423300027725Agricultural SoilMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPEDMLDAHQARSIATYQRALEGLPGTLRSGPEALRPTWGEPELHMSLGWAYAKKRVPDLAQAELHARKALALVPSWHYVRDILLPQIESARGTAAR
Ga0247826_1043565013300030336SoilLLAASAEFEAALQDDPRFVDAQAGLASCLGMRMFLRGRVDDETRALIPRVRALLAEAQTLEPENPRLLWVRGPTEWWTPKGSPAETVDERQARAIATYLRGLEGLPGSIRSGPEPLRPAWGEPELHMSLAWSYLNRRVPDLVQAELHARKALALVPSWHYVRDILLPQIESARRTAAR
Ga0247826_1050828913300030336SoilLHDALAAAPVGNAPRSLVLYWQGFALWRRAINGFNETPTPTDLESDVLAASAHFEAALTDNPKLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPDDMLDAHQARSIATYQHALQGLPGSLRSGPEPLQPTWGEPELHMSLGWAYAKKRVPDLAQAEVHARKALALVPSWHYVRDILLPQIESARRTAAR
Ga0310888_1046042913300031538SoilGKDFEAALKEDPRLVDAQAGLAACIGLRMYLHGTPDDEMRAMLAQVKSLLADAQALEPGNPRLLWVRGPMEWWTPKGSPDDAIDAHQARAMATYARGLEEIQASRGTSARPLQPSWGEAELHMSLAWSYLHLRRDPDVAQAEIHGRRALELVPSWHYMRDILMPQIEKARRTATR
Ga0318516_1064356613300031543SoilLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPEEMVDARQAKSIATYHRGLEGLPGSLRSGPDSLQPTWGEPELHMSLGWAYSKKRVPDLAQAELHARKALELVPSWHYVRDILLPQIESARRTAVR
Ga0318516_1071902013300031543SoilINGFNETPTPTDLQADVNAASAEFEASLKENPKLVDAQAGLAACLGLRMYLHGKPDDEMRALLARVQALLTDAQALEPGNPRLLWVRGPMEWFTPKGSPDDVLDARQAKAVATYRRGLEGIPGSLRSGPGPLQPIWGEPELHMSLAWSYLHRRVPDASEAEVHARKALQLVPSWHYMRDILLPQIEAA
Ga0318571_1012425813300031549SoilEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRALLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLRRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318528_1077462513300031561SoilDFEAALKEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRALLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPRIEAARTAS
Ga0318515_1007873813300031572SoilAGVDFEAALKEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRAMLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0310915_1067087213300031573SoilPTPTDLEADALGASAEFEAALKEDPKLVDAQAGLAACLGMQMYLHATPDDEMRALLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLRRREPDLAQAEIHGRRALELVPSWHYMRDILMPRIEAARTASR
Ga0318572_1097650613300031681SoilLHGKPDDEMRALLTRVQALLTDAQTLEPGNPRLLWVRGPMEWFTPKGSPDDVLDARQAKAIATYRRGLEGIPGSLRSGPGPLQPTWGEPELHMSLAWSYLHQRVPDASEAEVHGRKALQLVPSWHYMRDILLPQIEAARRTASRQE
Ga0306917_1155000713300031719SoilPTPTDLEADVLAASSEFEAALKENPRLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPEEMVDARQAKSIATYHRGLEGLPGSLRSGPDSLQPTWGEPELHMSLGWAYSKKRVPDLAQAELHARKALELVPSWHY
Ga0318493_1074746913300031723SoilFEASLKENPKLVDAQAGLAACLGLRMYLHGKPDDEMRALLARVQALLTDAQALEPGNPRLLWVRGPMEWFTPKGSPDDVLDARQAKAVATYRRGLEGIPGSLRSGPGPLQPIWGEPELHMSLAWSYLHRRVPDASEAEVHARKALQLVPSWHYMRDILLPQIEAARRTASRQE
Ga0318500_1028535213300031724SoilLWRRAINGFNETPTPTDLLEDVVAASDELEAALKEDPKLVDAQAALAGCLGLRMFLHKTADDEMRALLARVKELLAEAQALEPENPRLLWVRGPMEWWTPAGSPQDAVDAHQARAMATYHRALEGLPGSLRSGPEALRPTWGEPELHMSLSWSFMKKREPDLAQAEIHARKALALVPSWHYVRDILLPQIEAAKRTAAR
Ga0318501_1005090923300031736SoilRSLVLYWRGFALWRRAINGFNETPTPTDLLEDVVAASDELEAALKEDPKLVDAQAALAGCLGLRMFLHKTADDEMRALLARVKELLAEAQALEPENPRLLWVRGPMEWWTPAGSPQDAVDAHQARAMATYHRALEGLPGSLRSGPEALRPTWGEPELHMSLSWSFMKKREPDLAQAEIHARKALALVPSWHYVRDILLPQIEAAKRTAAR
Ga0318502_1036025513300031747SoilASAPTDSSPRSLVLYWQGFALWRRAINGFNETPTPTDLEADAVSAGVDFEAALKEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRALLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLRRREPDLAQAEIHGRRALELVPSWHYMRDILMPRIEAARTASR
Ga0318535_1035623913300031764SoilYWQGFALWRRAINGFNETPTPTDLEADAVSAGVDFEAALKEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRALLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318547_1022777223300031781SoilYWRGFALWRRVINGFNETPTPTDLEADALGASAEFEAALKEDPKLVDAQAGLAACLGMQMYLHATPDDEMRALLARVKALFADAQALEPGNPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAMATYLRGLEEIQGAGPLRPEPLRPSWGEAELHMSLAWSYLHRREPDPAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318529_1025389023300031792SoilTPDDEMRALLARVKALFADAQALEPGNPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAMATYLRGLEEIQGAGPLGPEPLRPSWGEAELHMSLAWSYLHRREPDPAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318503_1018724713300031794SoilAGVDFEAALKEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRALLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLRRREPDLAQAEIHGRRALELVPSWHYMRDILMPRIEAARTASR
Ga0318557_1014381013300031795SoilPTPTDLEADALGASAEFEAALKEDPKLVDAQAGLAACLGMQMYLHATPDDEMRALLARVKALFADAQALEPGNPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAMATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDPAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318576_1035994523300031796SoilAMLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318550_1035673813300031797SoilYLHKTQDDEMRAMLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318523_1022645213300031798SoilAQAGLAACLGMQMYLHATPDDEMRALLARVKALFADAQALEPGNPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAMATYLRGLEEIQGAGPLGPEPLRPSWGEAELHMSLAWSYLHRREPDPAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318568_1003348513300031819SoilAGSSPRSLVLYWRGFALWRRAINGFNETPTPTDLLEDVVAASDELEAALKEDPKLVDAQAALAGCLGLRMFLHKTADDEMRALLARVKELLAEAQALEPENPRLLWVRGPMEWWTPAGSPQDAVDAHQARAMATYHRALEGLPGSLRSGPEALRPTWGEPELHMSLSWSFMKKREPDLAQAEIHARKALALVPSWHYVRDILLPQIEAAKRTAAR
Ga0318568_1039852013300031819SoilLVLYWQGFALWRRAINGFNETPTPTDLEADAVSAGVDFEAALKEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRALLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318499_1030027613300031832SoilCLGMRMYLHKTQDDEMRALLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318517_1008494723300031835SoilHAQLASAPTDSSPRSLVLYWQGFALWRRAINGFNETPTPTDLEADAVSAGVDFEAALKEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRAMLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318512_1007781323300031846SoilHATPDDEMRALLARVKALFADAQALEPGNPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAMATYLRGLEEIQGAGPLGPEPLRPSWGEAELHMSLAWSYLHRREPDPAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318527_1021394613300031859SoilTDSSPRSLVLYWQGFALWRRAINGFNETPTPTDLEADAVSAGVDFEAALKEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRALLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318495_1006238513300031860SoilYWQGFALWRRAINGFNETPTPTDLEADAVSAGVDFEAALKEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRALLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLRRREPDLAQAEIHGRRALELVPSWHYMRDILMPRIEAARTASR
Ga0318544_1039849513300031880SoilHKTQDDEMRALLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318522_1026263113300031894SoilLEADALGASAEFEAALKEDPKLVDAQAGLAACLGMQMYLHATPDDEMRALLARVKALFADAQALEPGNPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAMATYLRGLEEIQGAGPLGPEPLRPSWGEAELHMSLAWSYLHRREPDPAQAEIHGRRALELVPSWHYMRDILMPQIEAARTAS
Ga0318551_1011640113300031896SoilPKLVDAQAGLAACLGMQMYLHATPDDEMRALLARVKALFADAQALEPGNPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAMATYLRGLEEIQGAGPLGPEPLRPSWGEAELHMSLAWSYLHRREPDPAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318551_1035407623300031896SoilNGFNETPTPTDLQADVNAASAEFEASLEENPKLVDAQAGLAACLGLRMYLHGKPDDEMRALLTRVQALLTDAQTLEPGNPRLLWVRGPMEWFTPKGSPDDVLDARQAKAIATYRRGLEGIPGSLRSGPGPLQPTWGEPELHMSLAWSYLHQRVPDASEAEVHGRKALQLVPSWHYMRDILLPQIEAARRTASRQE
Ga0318520_1025439223300031897SoilMYLHKTQDDEMRAMLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPRIEAARTASR
Ga0306921_1179023513300031912SoilGDRQALRDLHPALASAPAGSSPRSLVLYWRGFALWRRAINGFNETPTPTDLLEDVVAASDELEAALKEDPKLVDAQAALAGCLGLRMFLHKTADDEMRALLARVKELLAEAQALEPENPRLLWVRGPMEWWTPAGSPQDAVDAHQARAMATYHRALEGLPGSLRSGPEALRPTWGEPELHMSLSWSFMKKREPDLAQAEIHARKALALVPSWHYARDIL
Ga0310912_1046810413300031941SoilVDAQAGLAACLGMRMYLHKTQDDEMRALLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLRRREPDLAQAEIHGRRALELVPSWHYMRDILMPRIEAARTASR
Ga0310916_1048070023300031942SoilRAINGFNETPTPTDLEADAVSAGVDFEAALKEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRAMLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0310913_1081112313300031945SoilNETPTPTDLEADALGASAEFEAALKEDPKLVDAQAGLAACLGMQMYLHATPDDEMRALLARVKALFADAQALEPGNPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0310910_1057100613300031946SoilLKEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRALLARVKALFADAQALEPGNPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAMATYLRGLEEIQGAGPLGPEPLRPSWGEAELHMSLAWSYLHRREPDPAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0310910_1152985713300031946SoilAALKEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRAMLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318569_1013883713300032010SoilCLGMQMYLHATPDDEMRALLARVKALFADAQALEPGNPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAMATYLRGLEEIQGAGPLGPEPLRPSWGEAELHMSLAWSYLHRREPDPAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0310902_1095422613300032012SoilGTTPRSLVRYWQGFALWRRAINGFNETPTPTDLAADALAAGKDFEAALKEDPKLVDAQAGLAACIGLRMYLHGTPDDEMRAMLAQVKSLLADAQALEPGNPRLLWVRGPMEWWTPKGSPDDAIDAHQARAMATYARGLEEIQASRGTSARPLQPSWGEAELHMSLAWSYLHLRRDPDVAQAEIHGRRALELVPSWHY
Ga0318549_1009891423300032041SoilEFEAALKEDPKLVDAQAGLAACLGMQMYLHATPDDEMRALLARVKALFADAQALEPGNPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318556_1024226813300032043SoilLASAPTDSSPRSLVLYWQGFALWRRAINGFNETPTPTDLEADAVSAGVDFEAALKEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRAMLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318558_1004970123300032044SoilSPVLYWRGFALWRRAINGFNETPTPTDLLEDVVAASDELEAALKEDPKLVDAQAALAGCLGLRMFLHKTADDEMRALLARVKELLAEAQALEPENPRLLWVRGPMEWWTPAGSPQDAVDAHQARAMATYHRALEGLPGSLRSGPEALRPTWGEPELHMSLSWSFMKKREPDLAQAEIHARKALALVPSWHYVRDILLPQIEAAKRTAAR
Ga0318575_1043104513300032055SoilDLEADAVSAGVDFEAALKEDPKLVDAQAGLAACLGMRMYLHKTQDDEMRAMLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASRWPAHDRAKRIDVALALRWD
Ga0318505_1031206523300032060SoilRMYLHKTQDDEMRAMLARVKALFADAQALEPANPRLLWVRGLMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318524_1071732213300032067SoilEDPKLVDAQAALAGCLGLRMFLHKTADDEMRALLARVKELLAEAQALEPENPRLLWVRGPMEWWTPAGSPQDAVDAHQARAMATYHRALEGLPGSLRSGPEALRPTWGEPELHMSLSWSFMKKREPDLAQAEIHARKALALVPSWHYARDILLPQIEAAKRTAAR
Ga0318518_1058805713300032090SoilENPRLVDAQAALAACIGLRMFLHKTVDDEMRAMLERVKALLAEAQALEPENPRLLWVRGPMEWFTPKGSPEEMVDARQAKSIATYHRGLEGLPGSLRSGPDSLQPTWGEPELHMSLGWAYSKKRVPDLAQAELHARKALELVPSWHYVRDILLPQIESARRTAVR
Ga0318577_1054847713300032091SoilHKTQDDEMRAMLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAMATYLRGLEEIQGAGPLGPEPLRPSWGEAELHMSLAWSYLHRREPDPAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0318540_1040678713300032094SoilDPKLVDAQAGLAACLGMRMYLHKTQDDEMRALLARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPRIEAARTASR
Ga0335085_1037769323300032770SoilRAMLQRVKALLAEAQALEPENPRLLWVRGPMEWFTPMGSPEDVLDAHQARSIATYHRALEGLPGTLRSGPEPLRPTWGEAELHMSLGWAYSKKRVPDLAQAELHARKALALVPSWHYVRDILLPQIESARGTAAR
Ga0335081_1073545313300032892SoilLVDAQAGLASCLGMRMFLRRKLDDESRAMLTRMLGLLEEARTLEPENPRLLWVRGPTEFWSPNDSPPEKVDERQARAIATYQRGLEALASSRSGGPLRPSWGEPELHMSLAWTYLNRRLPDLEQAELHARQALALVPSWHYVRDILLPQIEAARGTAAR
Ga0335083_1036320223300032954SoilARTLEPENPRLLWVRGPTEFWSPKDSPPEKVDERQARAIATYRRGLEALASSRSGGPLRPSWGEPELHMSLAWTYLNRRLPDLEQAELHARQALALVPSWHYVRDILLPQIEAARGTAAR
Ga0335076_1140358623300032955SoilAMLTRMLGLLEEARTLEPENPRLLWVRGPTEFWSPNDSPPEKVDERQARAIATYQRGLEALASSRSGGPLRPSWGEPELHMSLAWTYLNRRLPDLEQAELHARQALALVPSWHYVRDILLPQIEAARGTAAR
Ga0335084_1226938313300033004SoilDALAASADFEAALEEDPRLVDAQAALAACIGLRMFLHKTVDDEMRAMLQRVKALLAEAQALEPENPRLLWVRGPMEWFTPMGSPEDVLDAHQARSIATYHRALEGLPGTLRSGPEPLRPTWGEAELHMSLGWAYSKKRVPDLAQAELHARKALALVPSWHYVRDILLPQIESAR
Ga0318519_1011560723300033290SoilARVKALFADAQALEPANPRLLWVRGPMEWWTPKGSPQDAVDAHQAKAIATYLRGLEEIQGARPRGPEPLEPSWGEAELHMSLAWSYLHRREPDLAQAEIHGRRALELVPSWHYMRDILMPQIEAARTASR
Ga0316620_1167518913300033480SoilMFLRGRQDEEVRALVPRVRALLAEAEALEPENPRLLWVRGPTEWWAPPGSPRETVDARQAKAIATYTRGLEALRRARRPAPDSLRPAWGEPELEMNLAWSFLNRRVPDVALAEAHARKALALVPAWHYVRDILLPQIELARRGVAR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.