| Basic Information | |
|---|---|
| Family ID | F081792 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAAHRTANRAMFWRILRRLLGANRGRLFVILLALGAGAAV |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 90.99 % |
| % of genes near scaffold ends (potentially truncated) | 97.37 % |
| % of genes from short scaffolds (< 2000 bps) | 93.86 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.614 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.053 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.316 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF02687 | FtsX | 78.95 |
| PF12704 | MacB_PCD | 16.67 |
| PF10080 | FtrD-like | 2.63 |
| PF02033 | RBFA | 0.88 |
| PF03239 | FTR1 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0858 | Ribosome-binding factor RbfA | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.61 % |
| Unclassified | root | N/A | 4.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002908|JGI25382J43887_10086985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1670 | Open in IMG/M |
| 3300002910|JGI25615J43890_1079458 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300002917|JGI25616J43925_10074278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1433 | Open in IMG/M |
| 3300005167|Ga0066672_10435159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300005454|Ga0066687_10513815 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005467|Ga0070706_100420251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1244 | Open in IMG/M |
| 3300005471|Ga0070698_100469934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1194 | Open in IMG/M |
| 3300005538|Ga0070731_10923027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300005552|Ga0066701_10796132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300005561|Ga0066699_10923532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300005568|Ga0066703_10328461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300005602|Ga0070762_10729970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300005602|Ga0070762_11084972 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005617|Ga0068859_100379791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1508 | Open in IMG/M |
| 3300005844|Ga0068862_102179833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300005921|Ga0070766_11163575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300006028|Ga0070717_11905313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300006163|Ga0070715_10877528 | Not Available | 550 | Open in IMG/M |
| 3300006791|Ga0066653_10712881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300006806|Ga0079220_11082233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300006806|Ga0079220_11439096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300006871|Ga0075434_102115679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300006893|Ga0073928_10510526 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300006904|Ga0075424_102127494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300007255|Ga0099791_10072345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1564 | Open in IMG/M |
| 3300007255|Ga0099791_10444317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300007265|Ga0099794_10513030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300009038|Ga0099829_11762771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300009088|Ga0099830_10225666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1474 | Open in IMG/M |
| 3300010320|Ga0134109_10073958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
| 3300010321|Ga0134067_10072412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1142 | Open in IMG/M |
| 3300010337|Ga0134062_10468120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300010359|Ga0126376_10812405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300010359|Ga0126376_12831728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300010360|Ga0126372_10394199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
| 3300010379|Ga0136449_104187881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300011269|Ga0137392_11240784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300011270|Ga0137391_10267058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1480 | Open in IMG/M |
| 3300012198|Ga0137364_11136702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300012203|Ga0137399_10640138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300012207|Ga0137381_10811682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300012210|Ga0137378_11310166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300012351|Ga0137386_10968807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300012359|Ga0137385_10806859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300012361|Ga0137360_10317621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1297 | Open in IMG/M |
| 3300012582|Ga0137358_10129620 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300012685|Ga0137397_10280128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1242 | Open in IMG/M |
| 3300012924|Ga0137413_11382655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300012929|Ga0137404_10266683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1475 | Open in IMG/M |
| 3300012930|Ga0137407_10264194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1563 | Open in IMG/M |
| 3300012944|Ga0137410_10313617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1245 | Open in IMG/M |
| 3300012986|Ga0164304_10799886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300015054|Ga0137420_1065746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300016341|Ga0182035_11264407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300016341|Ga0182035_11665646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300018468|Ga0066662_10776808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300019789|Ga0137408_1431453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
| 3300020579|Ga0210407_10667490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300020579|Ga0210407_11216311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300020580|Ga0210403_10807349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300021046|Ga0215015_10869421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300021168|Ga0210406_11177346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300021170|Ga0210400_11250473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300021178|Ga0210408_10155019 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
| 3300021178|Ga0210408_10217049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1522 | Open in IMG/M |
| 3300021478|Ga0210402_11751972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300022532|Ga0242655_10265776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300024225|Ga0224572_1056528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300025905|Ga0207685_10491646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300025905|Ga0207685_10697473 | Not Available | 552 | Open in IMG/M |
| 3300025922|Ga0207646_11708261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300026296|Ga0209235_1004912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7472 | Open in IMG/M |
| 3300026308|Ga0209265_1198340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300026334|Ga0209377_1206431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300026482|Ga0257172_1076195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300026496|Ga0257157_1072775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300027460|Ga0207506_1013351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300027725|Ga0209178_1042514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1447 | Open in IMG/M |
| 3300027855|Ga0209693_10462858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300027884|Ga0209275_10632056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300027903|Ga0209488_10104560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2124 | Open in IMG/M |
| 3300028047|Ga0209526_10555425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300028536|Ga0137415_10536075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
| 3300028792|Ga0307504_10042864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1259 | Open in IMG/M |
| 3300028792|Ga0307504_10434269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300028906|Ga0308309_11713575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300030007|Ga0311338_11637436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300030520|Ga0311372_11710568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300030520|Ga0311372_12687148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300030580|Ga0311355_10904595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300031564|Ga0318573_10042021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2195 | Open in IMG/M |
| 3300031708|Ga0310686_113498157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300031715|Ga0307476_10122121 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300031719|Ga0306917_10505600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
| 3300031720|Ga0307469_10424787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1143 | Open in IMG/M |
| 3300031720|Ga0307469_11576042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300031740|Ga0307468_100677248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300031753|Ga0307477_10438991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
| 3300031753|Ga0307477_11019379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300031754|Ga0307475_10158938 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
| 3300031754|Ga0307475_11259411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300031770|Ga0318521_10950525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300031795|Ga0318557_10443616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300031798|Ga0318523_10536885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300031820|Ga0307473_11047163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300032001|Ga0306922_12126678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300032174|Ga0307470_10879321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300032515|Ga0348332_13566520 | All Organisms → cellular organisms → Bacteria | 2777 | Open in IMG/M |
| 3300032892|Ga0335081_12686434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300032898|Ga0335072_10541127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1191 | Open in IMG/M |
| 3300033412|Ga0310810_10951631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.16% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.02% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.02% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.51% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.75% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.88% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.88% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.88% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.88% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300027460 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-C (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25382J43887_100869852 | 3300002908 | Grasslands Soil | MADLRTINRAMFWRIIRRLFGANRGRLFVMLLALGAGAAVT |
| JGI25615J43890_10794582 | 3300002910 | Grasslands Soil | MPDRKMFWRIMRRLLSANRGRLFVILLALGAGAAITAALL |
| JGI25616J43925_100742782 | 3300002917 | Grasslands Soil | MPDSRATNRAMFWRIIRRLFGANPGRLFVMLLALGAGAAVTAALLNLQ |
| Ga0066672_104351592 | 3300005167 | Soil | MNKRAANRPMFRRILRRLLFANRGRLFVILLALSAGAAVSAALLN |
| Ga0066687_105138151 | 3300005454 | Soil | MDERRAMNRSMFWRVLRRSAFANRGRLFVILLALGAGSAITAALLN |
| Ga0070706_1004202512 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MMASYLTANRAMFWRILRRLLGANRGRLFVILLALGAGAA |
| Ga0070698_1004699342 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLAQKNDRRSVNRRMFWRVLSRSIFANRGRLIVILLALGA |
| Ga0070731_109230272 | 3300005538 | Surface Soil | MSALRTGNRAMFWRIIRRLLGANRGRLFVILLALGA |
| Ga0066701_107961321 | 3300005552 | Soil | MMASYLTANRAMFWRILRRLLGANRGRLFVILLALGAG |
| Ga0066699_109235322 | 3300005561 | Soil | MDERRSMNRSMFWRVLRRSAFANRGRLVVILLALGAGSTITAAL |
| Ga0066703_103284612 | 3300005568 | Soil | MSLAQKNDRRSVNRRMFWRVLSRSIFANRGRLIVILLALGAGAAIT |
| Ga0070762_107299701 | 3300005602 | Soil | MSKASAISRTPNRKMFWRIVRHLLTANRSRLFVILLALAAGAAITAA |
| Ga0070762_110849721 | 3300005602 | Soil | MPSSLTSNRTMFWRIVRRLITAHRGRLFVILLALSAGATI |
| Ga0068859_1003797911 | 3300005617 | Switchgrass Rhizosphere | MDERRAVNRSMFWRVIRRMVFANTGRLFVILLALGA |
| Ga0070764_108384341 | 3300005712 | Soil | MPSPSSQNRQMFWRIVRRLLGANRGRLFVILLALGAGA |
| Ga0068862_1021798331 | 3300005844 | Switchgrass Rhizosphere | MPNPPFDNRAMFWRIVRRLLAANRPRLFVLLLALGVGAAI |
| Ga0070766_111635751 | 3300005921 | Soil | MAAPRTANRAMFWRILRRLLGANRGRLFVMLLALGSGAAVTAALLN |
| Ga0070717_119053132 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLTPNRSNSRPMFWRIVRRLATANRARLIVILLALGAGAAVTA |
| Ga0070715_108775281 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDRRSVNRSMFWRVIRRSMFANHGRLLVILLALGAGAAI |
| Ga0070765_1003723581 | 3300006176 | Soil | MGPDMSNSRPMFWRIVRRLLTANPGRLFVILLALGA |
| Ga0066653_107128811 | 3300006791 | Soil | MTSSRATNKAMFWRIIRRLLGANRGRLFVMLLALGAGAAVTAAMLNLQV |
| Ga0079220_110822331 | 3300006806 | Agricultural Soil | MTELRKPNRAMFWRILRRLLGANRGRLFVMLQALGAGAAVT |
| Ga0079220_114390961 | 3300006806 | Agricultural Soil | MTEHRALNRAMFWRILRRLLGANRGRLFVMLLALGA |
| Ga0075434_1021156791 | 3300006871 | Populus Rhizosphere | MPNPPFDNRAMFWRIVRRLLAANRPRLFVLLLALGAGAAITS |
| Ga0073928_105105262 | 3300006893 | Iron-Sulfur Acid Spring | MAGHGSQNRQMFWRIVRRLLGANRGRLLVILLALGAGAAVTAALL |
| Ga0075424_1021274941 | 3300006904 | Populus Rhizosphere | MPNPPFDNRAMFWRIVRRLLAANRPRLFVLLLALGA |
| Ga0099791_100723451 | 3300007255 | Vadose Zone Soil | MAAHRTANRAMFWRILRRLLGANRGRLFVILLALGAGAAV |
| Ga0099791_104443171 | 3300007255 | Vadose Zone Soil | MMAAYRTANRAMFWRIIRRLLGANRGRLFVILLALGAGAVVTAALLN |
| Ga0099794_105130302 | 3300007265 | Vadose Zone Soil | MMADRRATNRTMFWRIIRRFFGANRGRLFVMLLALGSGAAVTA |
| Ga0099829_117627711 | 3300009038 | Vadose Zone Soil | MMADRRATNRAMFWRIIRRLFGANPGRLFVMILALGAGAA |
| Ga0099830_102256662 | 3300009088 | Vadose Zone Soil | MDALRTSNRAMFWRIIRRLFGANRGRLFVMLLALGAGAAV |
| Ga0134109_100739582 | 3300010320 | Grasslands Soil | MMTELHALNRAMFWRILRRLLGANRGRLFVMLLALGAGA |
| Ga0134067_100724121 | 3300010321 | Grasslands Soil | MMTSPRATNKAMFWRIIRRLLGANRGRLFVMLLALG |
| Ga0134062_104681202 | 3300010337 | Grasslands Soil | MMPGQATNRAMFWRIIRRLLGANRGRLFIILLALGAGA |
| Ga0126376_108124051 | 3300010359 | Tropical Forest Soil | MTELRATNRAMFWRILRRLLSANRGRLFVMLLALVPPA |
| Ga0126376_128317282 | 3300010359 | Tropical Forest Soil | MMPDVHTSNRAMFWRVIRRFFAANPTRLFVILLALGAGAA |
| Ga0126372_103941991 | 3300010360 | Tropical Forest Soil | MTELRATNGAMFWRILRRLLSANRGRLFVMLLALGAGAAVTAAL |
| Ga0136449_1041878811 | 3300010379 | Peatlands Soil | MTSLLTDNRAMFWRIVRSLLTANRGRLFVILLALGAGAAVTAALLNLQ |
| Ga0137392_112407842 | 3300011269 | Vadose Zone Soil | MMADRRATNRAMFWRIIRRLFGANRGRLFVMLLALGAGAAVTAALL |
| Ga0137391_102670582 | 3300011270 | Vadose Zone Soil | MMADRRATNRAMFWRIIRRLFGANPGRLFVMLLALGAGA |
| Ga0137364_111367022 | 3300012198 | Vadose Zone Soil | MMAGSRATNKAMFWRIIRRLFGANRGRLFVLLLALSA |
| Ga0137399_106401381 | 3300012203 | Vadose Zone Soil | MAAHRTANRAMFWRILRRLLGANRGRLFVILLALGAGA |
| Ga0137381_108116822 | 3300012207 | Vadose Zone Soil | MMTELRATNRAMFWRIIRRLLSANRGRLFVMLLALGAGAAVTAALLNL |
| Ga0137378_113101661 | 3300012210 | Vadose Zone Soil | MMPDRRVTNRAMFWRIIRRLLGANRGRLFVMLLALGAG |
| Ga0137386_109688071 | 3300012351 | Vadose Zone Soil | MMTELRATNRAMFWRIIRRLLSANRGRLFVMLLALGAGAAVTAA |
| Ga0137385_108068591 | 3300012359 | Vadose Zone Soil | MMTELRATNRAMFWRIIRRLLSANRGRLFVMLLALGAGSA |
| Ga0137360_103176211 | 3300012361 | Vadose Zone Soil | MMADRRSANRSMFWRVLRRSVFANRGRLFVILLALGAGAA |
| Ga0137358_101296203 | 3300012582 | Vadose Zone Soil | MMAAYRTANRAMFWRILRRLLSANRGRLFVILLALGAG |
| Ga0137397_102801281 | 3300012685 | Vadose Zone Soil | MVDRRSVNRSMFWRLIRRSLFANRGRLLVILLALGAGAAITA |
| Ga0137413_113826552 | 3300012924 | Vadose Zone Soil | MMPDRKMFWRMIRRLLAANRGRLFVILLALGAGAAITAALL |
| Ga0137404_102666831 | 3300012929 | Vadose Zone Soil | MAAHRTANRAMFWRILRRLLGANRGRLFVILLALGAG |
| Ga0137407_102641943 | 3300012930 | Vadose Zone Soil | MAAHRTANRAMFWRILRRLLGANRGRLFVILLALGA |
| Ga0137410_103136171 | 3300012944 | Vadose Zone Soil | MMASYLTANRAMFWRILRRLLGANRGRLFVILLAL |
| Ga0164304_107998862 | 3300012986 | Soil | MSDRRSVNRSMFWRVIRRSMFANRGRLLVILLALGAGAA |
| Ga0137420_10657461 | 3300015054 | Vadose Zone Soil | MMADRRANNRVMFWRIIRRLLGANRGRLFVMLLALGAGAA |
| Ga0182035_112644072 | 3300016341 | Soil | MALESTNNRSMFWRIVRRLVFAHRGRLFVILLALGSGAT |
| Ga0182035_116656462 | 3300016341 | Soil | MPAARSIQRSMFWRIIRRLLSANRGRLWVMLLALGAGAAITAA |
| Ga0066662_107768082 | 3300018468 | Grasslands Soil | MTSSRATNKAMFWRIISRLLGANRGRLFVILLALGAGAAVTAALLN |
| Ga0137408_14314532 | 3300019789 | Vadose Zone Soil | MTSSRSSNRQMFWRILRRLLGANRGRLFVILLALGAGAAVTAAL |
| Ga0210407_106674901 | 3300020579 | Soil | MDALRASNRAMFWRIIRRLFGANPGRLFVMLLALGAGAAVTAALLNLQ |
| Ga0210407_112163112 | 3300020579 | Soil | VPDRRSINRSMFWRVLRRSVFANRGRLLVILLALGAGAA |
| Ga0210403_108073491 | 3300020580 | Soil | MAAPHTTNRAMFWRIIRRLFGANRGRLFVMLLALGSGAAVT |
| Ga0215015_108694211 | 3300021046 | Soil | MMPDRKMFWRIVRRLLAANRGRLFVILLALGAGAA |
| Ga0210406_111773461 | 3300021168 | Soil | MLPLLTTNRKMFWRIVRRLITAHRGRLFVILLALGAGA |
| Ga0210400_112504731 | 3300021170 | Soil | MPDRKMFWRIIRRLLSANRGRLLVILLALGAGATITAALLNL |
| Ga0210408_101550191 | 3300021178 | Soil | MADRRATNRAMFWRIIRRLFGANPGRLFVMLLALGAGA |
| Ga0210408_102170491 | 3300021178 | Soil | MADRRSTNRAMFWRIIRRLFGANPGRLFVMLLALGAGAAV |
| Ga0210402_117519721 | 3300021478 | Soil | MADRRSANRSMFWRVLRRSVFANRGRLIVILLALGA |
| Ga0242655_102657762 | 3300022532 | Soil | MSAPGSGNRAMFWRIVRRLLGANRGRLFVILLALGA |
| Ga0224572_10565282 | 3300024225 | Rhizosphere | MSAPGIGNRAMFWRIVRRLLGANRGRLFVILLALGAGAA |
| Ga0207685_104916461 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLAQKNDRRSVNRRMFWRVLSRSVFANRGRLIVILLALGAGAAI |
| Ga0207685_106974732 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDRRSVNRSMFWRVIRRSMFANHGRLLVILLALGAGAAIT |
| Ga0207646_117082611 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDRRSANRSMFWRVLRRSIFANRGRLFVILLALGAGAAIT |
| Ga0209235_10049121 | 3300026296 | Grasslands Soil | MADLRTTNRAMFWRILRRLLGANRGRLFVILLALGA |
| Ga0209265_11983402 | 3300026308 | Soil | MTELRDTNRAMFWRILRRLLGANRGRLFVMLLALGAGAAVTAAL |
| Ga0209377_12064311 | 3300026334 | Soil | MADLRTTNRAMFWRILRRLFSANPGRLFVMLLALGAGAAVTAALL |
| Ga0257172_10761952 | 3300026482 | Soil | MAALHSGNRAMFWRIIRRLFGANRGRLFVMLLALGAGA |
| Ga0257157_10727751 | 3300026496 | Soil | MAAHRTSNRAMFWRIIRRLFGANPGRLFVMLLALGAGAAVTAALLNLEV |
| Ga0207506_10133512 | 3300027460 | Soil | MASHRSQNRQMFWRIVRRLLGANRGRLFVILLALGAGAAVTA |
| Ga0209178_10425142 | 3300027725 | Agricultural Soil | MADQRSLNRSMFWRIERRLLSANRGRVFVILLALGAGAAV |
| Ga0209693_104628582 | 3300027855 | Soil | MPEPPRDNGQMFWRIVRRLLGANRGRLFVILLALGAGAAITAALLNLQ |
| Ga0209275_106320561 | 3300027884 | Soil | MSNSRPMFWRIIRRLLTANRGRLFVILLALGAGAAV |
| Ga0209488_101045601 | 3300027903 | Vadose Zone Soil | MASSRATNRAMFWRIIRRLFGANPGRLFVMLLALGAGAA |
| Ga0209526_105554252 | 3300028047 | Forest Soil | MMADRKMFWLILRRIFTSNRGRLFVILVALGAGAA |
| Ga0137415_105360752 | 3300028536 | Vadose Zone Soil | MDNRRSRNRTMFWRVLRRSVFANRGRLFVILLALGAGAAIT |
| Ga0307504_100428641 | 3300028792 | Soil | MSAHRTANRAMFWRILRRLLGANRGRLFVILLALGAGGAVSAALLNLQ |
| Ga0307504_104342691 | 3300028792 | Soil | MSTPSSTNRSMFWRIIRRLLSANPGRLFVILLALGAGAAVTAA |
| Ga0308309_117135752 | 3300028906 | Soil | MPDRRMFWRIVGRLFAAQRGRLLVILLALGASAALTA |
| Ga0311338_116374362 | 3300030007 | Palsa | MGAAVGNNRGMFWRILRRQIFANRGRLFVVLLALAAGAAITAALLN |
| Ga0311372_117105681 | 3300030520 | Palsa | MGAAVGNNRGMFWRILRRQIFANRGRLFVVLLALAAGAAITAALLNL |
| Ga0311372_126871482 | 3300030520 | Palsa | MGGSLVGNRKMFWRILRRMLLANRGRVLVILLALAAGA |
| Ga0311355_109045951 | 3300030580 | Palsa | MGAAVGNNRGMFWRILRRQIFANRGRLFVVLLALAAGAAITAAL |
| Ga0318573_100420213 | 3300031564 | Soil | MSELRNTNRVMFWRILRRLLAANRGRLFVMLLALGAGAAVTAALLNL |
| Ga0310686_1134981572 | 3300031708 | Soil | MPDHRATNRAMFWRIIRRLLGANRGRLFVILLALGA |
| Ga0307476_101221213 | 3300031715 | Hardwood Forest Soil | MADRRATNRAMFWRIMRRLFGANPGRLFVMLLALGAGAAVTAALLNL |
| Ga0306917_105056002 | 3300031719 | Soil | MEERQTENRRMFRRVIRRMVFANRGRLLVILLALGAG |
| Ga0307469_104247871 | 3300031720 | Hardwood Forest Soil | MADRRSANRSMFWRVLRRSVFANRGRLFVILLALGAG |
| Ga0307469_115760422 | 3300031720 | Hardwood Forest Soil | MPAPLNKNRAMFWRILRRLLFAHRGRLLVILLALGAGAS |
| Ga0307468_1006772481 | 3300031740 | Hardwood Forest Soil | MTASLTANRSMFWRIVRRLLFAHRGRLFVILLALGAGAAVTA |
| Ga0307477_104389912 | 3300031753 | Hardwood Forest Soil | MAALLTKNRAMFWRIIRRLLESNRGRLFVILLALGAGAAVT |
| Ga0307477_110193792 | 3300031753 | Hardwood Forest Soil | MADRRATNRAMFWRIIRRLFGANRGRLFVLILALGTGAAVTAALLNLQV |
| Ga0307475_101589381 | 3300031754 | Hardwood Forest Soil | MPDRKMFWRIMRRLLSANRGRLFVILLALGAGAAI |
| Ga0307475_112594111 | 3300031754 | Hardwood Forest Soil | MPEPRRNNGQMFWRIVRRLIGANRGRLFVILLALGA |
| Ga0318521_109505251 | 3300031770 | Soil | MALESTNNRSMFWRIVRRLVFAHRGRLFVILLALGSGA |
| Ga0318557_104436161 | 3300031795 | Soil | MSELRNTNRVMFWRILRRLLAANRGRLFVMLLALGAGAAVTAALL |
| Ga0318523_105368851 | 3300031798 | Soil | MEERQTENRRMFRRVIRRMVFANRGRLLVILLALGAGAAVTAA |
| Ga0307473_110471632 | 3300031820 | Hardwood Forest Soil | MADRRATNRAMFWRIIRRLFGANPGRLFVMLLALGAGAAV |
| Ga0306922_121266781 | 3300032001 | Soil | MTELRDTNRAMFWRILRRLLGANRGRLFVMLLALGAGAAVTAALLNLQ |
| Ga0307470_108793212 | 3300032174 | Hardwood Forest Soil | MPGQATNRAMFWRIIRRLLGANRGRLFIILLALGAGA |
| Ga0348332_135665201 | 3300032515 | Plant Litter | MTAPGTGNRAMFWRIVRRLLGANRGRLFVILLALGAGAAVTA |
| Ga0335081_126864341 | 3300032892 | Soil | MMTEFNAMNRAMFWRIIRRLLGANRGRLFVMLLALGAGA |
| Ga0335072_105411272 | 3300032898 | Soil | MAAFRTGNRTMFWRIIRRLLGANRGRLFVVLLALGAGAAV |
| Ga0310810_109516312 | 3300033412 | Soil | MASHRSQNRQMFWRIVRRLLGANRGRLFVILLALGAGAAVTAALL |
| Ga0316212_10650771 | 3300033547 | Roots | MANASPSAVPNRTMFWRIVRRLITANRGRLFVVLLALAAGA |
| ⦗Top⦘ |