| Basic Information | |
|---|---|
| Family ID | F081761 |
| Family Type | Metagenome |
| Number of Sequences | 114 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MTTDKVIPLHPPQSEIDQQWAALEAQQKQIREQLEKILEQKQ |
| Number of Associated Samples | 61 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 57.02 % |
| % of genes near scaffold ends (potentially truncated) | 14.04 % |
| % of genes from short scaffolds (< 2000 bps) | 78.07 % |
| Associated GOLD sequencing projects | 49 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.895 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (39.474 % of family members) |
| Environment Ontology (ENVO) | Unclassified (92.105 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (94.737 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 64.29% β-sheet: 0.00% Coil/Unstructured: 35.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF01510 | Amidase_2 | 38.05 |
| PF13539 | Peptidase_M15_4 | 10.62 |
| PF09374 | PG_binding_3 | 9.73 |
| PF16778 | Phage_tail_APC | 5.31 |
| PF11351 | GTA_holin_3TM | 4.42 |
| PF05838 | Glyco_hydro_108 | 3.54 |
| PF01381 | HTH_3 | 0.88 |
| PF04860 | Phage_portal | 0.88 |
| PF00589 | Phage_integrase | 0.88 |
| PF11367 | DUF3168 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG3926 | Lysozyme family protein | General function prediction only [R] | 3.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.89 % |
| All Organisms | root | All Organisms | 42.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10080951 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1439 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10132696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 952 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10132696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 952 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10019274 | Not Available | 3592 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10045183 | Not Available | 1994 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10081917 | Not Available | 1253 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10245590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300001450|JGI24006J15134_10052504 | Not Available | 1656 | Open in IMG/M |
| 3300001460|JGI24003J15210_10039567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1649 | Open in IMG/M |
| 3300001460|JGI24003J15210_10044112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Shimia → unclassified Shimia → Shimia sp. WX04 | 1525 | Open in IMG/M |
| 3300001460|JGI24003J15210_10045319 | Not Available | 1497 | Open in IMG/M |
| 3300001460|JGI24003J15210_10064358 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300001472|JGI24004J15324_10002588 | Not Available | 7140 | Open in IMG/M |
| 3300001589|JGI24005J15628_10032962 | Not Available | 2137 | Open in IMG/M |
| 3300001589|JGI24005J15628_10062379 | Not Available | 1384 | Open in IMG/M |
| 3300001589|JGI24005J15628_10143826 | Not Available | 734 | Open in IMG/M |
| 3300001589|JGI24005J15628_10162945 | Not Available | 663 | Open in IMG/M |
| 3300001589|JGI24005J15628_10194271 | Not Available | 575 | Open in IMG/M |
| 3300001589|JGI24005J15628_10201318 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 558 | Open in IMG/M |
| 3300001589|JGI24005J15628_10219549 | Not Available | 520 | Open in IMG/M |
| 3300001853|JGI24524J20080_1008819 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1250 | Open in IMG/M |
| 3300001853|JGI24524J20080_1026671 | Not Available | 569 | Open in IMG/M |
| 3300004448|Ga0065861_1149329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
| 3300004457|Ga0066224_1156274 | Not Available | 611 | Open in IMG/M |
| 3300006026|Ga0075478_10197570 | Not Available | 615 | Open in IMG/M |
| 3300006029|Ga0075466_1052521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1197 | Open in IMG/M |
| 3300006164|Ga0075441_10187689 | Not Available | 772 | Open in IMG/M |
| 3300006165|Ga0075443_10099324 | Not Available | 1003 | Open in IMG/M |
| 3300006193|Ga0075445_10067811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1380 | Open in IMG/M |
| 3300006193|Ga0075445_10251675 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 605 | Open in IMG/M |
| 3300006352|Ga0075448_10194777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 621 | Open in IMG/M |
| 3300006803|Ga0075467_10660255 | Not Available | 533 | Open in IMG/M |
| 3300006916|Ga0070750_10145938 | Not Available | 1072 | Open in IMG/M |
| 3300006916|Ga0070750_10161285 | Not Available | 1010 | Open in IMG/M |
| 3300006947|Ga0075444_10033218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2555 | Open in IMG/M |
| 3300006947|Ga0075444_10103301 | Not Available | 1244 | Open in IMG/M |
| 3300006947|Ga0075444_10226100 | Not Available | 745 | Open in IMG/M |
| 3300007229|Ga0075468_10000112 | Not Available | 26371 | Open in IMG/M |
| 3300007229|Ga0075468_10200617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Shimia → unclassified Shimia → Shimia sp. WX04 | 582 | Open in IMG/M |
| 3300007276|Ga0070747_1100212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Shimia → unclassified Shimia → Shimia sp. WX04 | 1069 | Open in IMG/M |
| 3300007276|Ga0070747_1316242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 535 | Open in IMG/M |
| 3300007540|Ga0099847_1172986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 636 | Open in IMG/M |
| 3300007540|Ga0099847_1236769 | Not Available | 527 | Open in IMG/M |
| 3300008221|Ga0114916_1082898 | Not Available | 808 | Open in IMG/M |
| 3300009428|Ga0114915_1051584 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300009428|Ga0114915_1142924 | Not Available | 684 | Open in IMG/M |
| 3300009428|Ga0114915_1159588 | Not Available | 636 | Open in IMG/M |
| 3300009428|Ga0114915_1171425 | Not Available | 607 | Open in IMG/M |
| 3300009428|Ga0114915_1189386 | Not Available | 570 | Open in IMG/M |
| 3300009428|Ga0114915_1217993 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 521 | Open in IMG/M |
| 3300009428|Ga0114915_1224124 | Not Available | 511 | Open in IMG/M |
| 3300009428|Ga0114915_1229233 | Not Available | 504 | Open in IMG/M |
| 3300009436|Ga0115008_10041420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3611 | Open in IMG/M |
| 3300009507|Ga0115572_10144650 | Not Available | 1398 | Open in IMG/M |
| 3300009512|Ga0115003_10056657 | All Organisms → cellular organisms → Bacteria | 2470 | Open in IMG/M |
| 3300011128|Ga0151669_106009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 3414 | Open in IMG/M |
| 3300017697|Ga0180120_10441284 | Not Available | 508 | Open in IMG/M |
| 3300017743|Ga0181402_1003749 | Not Available | 5020 | Open in IMG/M |
| 3300017753|Ga0181407_1079069 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 840 | Open in IMG/M |
| 3300017771|Ga0181425_1161048 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300017772|Ga0181430_1115802 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 791 | Open in IMG/M |
| 3300017786|Ga0181424_10077420 | Not Available | 1436 | Open in IMG/M |
| 3300020185|Ga0206131_10311260 | Not Available | 699 | Open in IMG/M |
| 3300021371|Ga0213863_10001960 | Not Available | 14798 | Open in IMG/M |
| 3300021959|Ga0222716_10599466 | Not Available | 602 | Open in IMG/M |
| 3300022053|Ga0212030_1020670 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300022053|Ga0212030_1029134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Shimia → unclassified Shimia → Shimia sp. WX04 | 764 | Open in IMG/M |
| 3300022169|Ga0196903_1000259 | Not Available | 8719 | Open in IMG/M |
| 3300025039|Ga0207878_131618 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 526 | Open in IMG/M |
| 3300025048|Ga0207905_1002389 | Not Available | 3872 | Open in IMG/M |
| 3300025079|Ga0207890_1033783 | Not Available | 925 | Open in IMG/M |
| 3300025098|Ga0208434_1047228 | Not Available | 953 | Open in IMG/M |
| 3300025108|Ga0208793_1059276 | Not Available | 1155 | Open in IMG/M |
| 3300025120|Ga0209535_1002016 | Not Available | 13365 | Open in IMG/M |
| 3300025120|Ga0209535_1011117 | Not Available | 5054 | Open in IMG/M |
| 3300025120|Ga0209535_1022247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 3180 | Open in IMG/M |
| 3300025120|Ga0209535_1042680 | All Organisms → Viruses | 2011 | Open in IMG/M |
| 3300025120|Ga0209535_1144497 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 762 | Open in IMG/M |
| 3300025120|Ga0209535_1195793 | Not Available | 575 | Open in IMG/M |
| 3300025137|Ga0209336_10001769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 10404 | Open in IMG/M |
| 3300025138|Ga0209634_1000371 | Not Available | 34719 | Open in IMG/M |
| 3300025138|Ga0209634_1040288 | Not Available | 2386 | Open in IMG/M |
| 3300025138|Ga0209634_1047035 | Not Available | 2154 | Open in IMG/M |
| 3300025138|Ga0209634_1049685 | All Organisms → Viruses | 2078 | Open in IMG/M |
| 3300025138|Ga0209634_1079543 | All Organisms → Viruses | 1511 | Open in IMG/M |
| 3300025138|Ga0209634_1089892 | Not Available | 1387 | Open in IMG/M |
| 3300025138|Ga0209634_1174059 | Not Available | 852 | Open in IMG/M |
| 3300025138|Ga0209634_1195099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 780 | Open in IMG/M |
| 3300025138|Ga0209634_1211385 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300025138|Ga0209634_1232586 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 679 | Open in IMG/M |
| 3300025138|Ga0209634_1236531 | Not Available | 671 | Open in IMG/M |
| 3300025138|Ga0209634_1320654 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 523 | Open in IMG/M |
| 3300025168|Ga0209337_1227871 | Not Available | 733 | Open in IMG/M |
| 3300025276|Ga0208814_1022527 | All Organisms → cellular organisms → Bacteria | 2086 | Open in IMG/M |
| 3300025276|Ga0208814_1024253 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
| 3300025276|Ga0208814_1034049 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300025276|Ga0208814_1042340 | Not Available | 1373 | Open in IMG/M |
| 3300025276|Ga0208814_1043118 | Not Available | 1356 | Open in IMG/M |
| 3300025276|Ga0208814_1058294 | Not Available | 1096 | Open in IMG/M |
| 3300025276|Ga0208814_1092121 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 780 | Open in IMG/M |
| 3300025276|Ga0208814_1100152 | Not Available | 731 | Open in IMG/M |
| 3300025543|Ga0208303_1062692 | Not Available | 867 | Open in IMG/M |
| 3300025886|Ga0209632_10396289 | Not Available | 658 | Open in IMG/M |
| 3300027668|Ga0209482_1000885 | Not Available | 23316 | Open in IMG/M |
| 3300027672|Ga0209383_1078651 | Not Available | 1151 | Open in IMG/M |
| 3300027788|Ga0209711_10200487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Shimia → unclassified Shimia → Shimia sp. WX04 | 920 | Open in IMG/M |
| 3300027833|Ga0209092_10031611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3410 | Open in IMG/M |
| 3300028125|Ga0256368_1031650 | Not Available | 944 | Open in IMG/M |
| 3300029448|Ga0183755_1002930 | All Organisms → cellular organisms → Bacteria | 8791 | Open in IMG/M |
| 3300031569|Ga0307489_11166126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Shimia → unclassified Shimia → Shimia sp. WX04 | 555 | Open in IMG/M |
| 3300031621|Ga0302114_10076005 | Not Available | 1592 | Open in IMG/M |
| 3300031851|Ga0315320_10385424 | Not Available | 976 | Open in IMG/M |
| 3300034374|Ga0348335_098093 | Not Available | 931 | Open in IMG/M |
| 3300034375|Ga0348336_057187 | Not Available | 1556 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 39.47% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 14.91% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 14.91% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.65% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 6.14% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.39% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.75% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.88% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.88% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.88% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.88% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.88% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.88% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.88% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.88% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.88% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001853 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006352 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300011128 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02 | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300025039 | Marine viral communities from the Pacific Ocean - LP-41 (SPAdes) | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100809515 | 3300000101 | Marine | VTTDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILEQKK* |
| DelMOSum2010_101326962 | 3300000101 | Marine | MTTDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILEQKK* |
| DelMOSum2010_101326964 | 3300000101 | Marine | MTTDKVIPLHPPQSETDKQWAALERQQQQIREQLEKILEQKK* |
| DelMOWin2010_100192745 | 3300000117 | Marine | MTTDKVVPLHPPKSDIDEQWQILEAQQKQIKEQLLKILETKPK* |
| DelMOWin2010_100451835 | 3300000117 | Marine | MTTDKVIPLHPPRSDIDEQWQVLEAQQKQIKEQLLKILETKPK* |
| DelMOWin2010_100819172 | 3300000117 | Marine | MTTDKVIPLHPPQSEIDQQWLALERQQKLIREQLEKILEQKQ* |
| DelMOWin2010_102455902 | 3300000117 | Marine | MTTDKVIPLHPPQSELDQQWAALEAQQKQIREQLEKILEQKK* |
| JGI24006J15134_100525042 | 3300001450 | Marine | MTTDKVIPLHPPQSELDQQWVALEAQQKQIREQLKKILERKK* |
| JGI24003J15210_100395671 | 3300001460 | Marine | QILWQEMTTDKVIPLHPPQSEIDQQWAALEAQQQQIREQLEKILERKQ* |
| JGI24003J15210_100441127 | 3300001460 | Marine | LTTDKVIPLHPPQSELDQQWAALEAQQKQIREQLEKILEQKK* |
| JGI24003J15210_100453192 | 3300001460 | Marine | MTTDKVIPLHPPQSELDQQWLALERQQKLIREQLEKILEQKK* |
| JGI24003J15210_100643585 | 3300001460 | Marine | LTTDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILEQKK* |
| JGI24004J15324_1000258815 | 3300001472 | Marine | MTSDKVIPLHPPKSDIDEQWQQLEAQQKQIKEQLLKILETKPK* |
| JGI24005J15628_100329626 | 3300001589 | Marine | MTXDKVIPLHPPKSDIDEQWQQLEAQQKQIKEQLLKILETKPK* |
| JGI24005J15628_100623794 | 3300001589 | Marine | MTSDKVIPLHPPKSDIDEQWHQLEAQQKQIKEQLLKILETKPK* |
| JGI24005J15628_101438262 | 3300001589 | Marine | MTSDKVIPLHPPKSDIDEQWQTLEAQQKQIKEQLLKILETKPK* |
| JGI24005J15628_101629451 | 3300001589 | Marine | MTSDKVIPLHPPKSDIDDQWQQLEAQQKQIKEQLLKILETKPK* |
| JGI24005J15628_101942712 | 3300001589 | Marine | MTSDKVIPLHPPKSDIDEQWQILEDQQKQIKEQLLKILETKPK* |
| JGI24005J15628_102013182 | 3300001589 | Marine | MTSDKVIPLRPPKSDIDEQWQQLEAQQKQIKEQLLKILETKPK* |
| JGI24005J15628_102195492 | 3300001589 | Marine | MTSDKVIPLHPPKSDIDEQWQTLEAQQKQIKEQLLKILETKAK* |
| JGI24524J20080_10088191 | 3300001853 | Marine | VTTDKVIPLHPPQSETDKQWAALERQQQQIREQLE |
| JGI24524J20080_10266712 | 3300001853 | Marine | DKVIPLHPPQSETDKQWAALERQQQQIREQLEKILERKK* |
| Ga0065861_11493292 | 3300004448 | Marine | MTTDKVIPLHPPQSEIDQQWAALEAQQKQIREQLEKILEQKQ* |
| Ga0066224_11562742 | 3300004457 | Marine | MTTDKVIPLHPPQSETDKQWAALEAQQQQIREQLEKILEQKK* |
| Ga0075478_101975702 | 3300006026 | Aqueous | MTTDKVIPLHNPHSEIDQQWLALERQQQQIREQLEKILEQKR* |
| Ga0075466_10525214 | 3300006029 | Aqueous | MTTDKVIPLHNPHSEIDQQWLALERQQQQIREQLEKILEQKK* |
| Ga0075441_101876892 | 3300006164 | Marine | MTTDKVIPLHPPQSELDQQWAVLELPQKQIREQLEKILEQKQ* |
| Ga0075443_100993242 | 3300006165 | Marine | MTTDKVIPLHPPQSELDQQWAVLELQQKQIREQLEKILEQKQ* |
| Ga0075445_100678112 | 3300006193 | Marine | MTTDKVIPLHQPKSDIDEQWQQLEAQQKQIKEQLLKILETKPK* |
| Ga0075445_102516752 | 3300006193 | Marine | VTTDKVIPLHPPQSETDKQWAALERQQQQIREQLEKILERKK* |
| Ga0075448_101947771 | 3300006352 | Marine | MTPDKVIPLHPPQSETDKQWAALERQQQQIREQLQKILE |
| Ga0075467_106602552 | 3300006803 | Aqueous | MTTDKVIPLHPPRSDIDEQWQILEAQQKQIKEQLLKILETKPK* |
| Ga0070750_101459382 | 3300006916 | Aqueous | VTTDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILERKK* |
| Ga0070750_101612852 | 3300006916 | Aqueous | VTTDKVIPLHPPQSEIDQQWLALKRQQQQIREQLEKILEQKK* |
| Ga0075444_100332182 | 3300006947 | Marine | MTTDKVIPLHPPRSDIDEQWQQLEAQQKQIKEQLLKILETKLK* |
| Ga0075444_101033015 | 3300006947 | Marine | MTPDKVIPLHPPQSETDKQWAALERQQQQIREQLEKILEQKK* |
| Ga0075444_102261002 | 3300006947 | Marine | MTTDKVIPLHPPQSEIDKQWAALERQQQQIREQLEKILERKK* |
| Ga0075468_1000011210 | 3300007229 | Aqueous | MTSDKVIPLHRPKSDIDEQWQQLEAQQKQIKEQLLKILETKPK* |
| Ga0075468_102006171 | 3300007229 | Aqueous | CQQILWQEMTTDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILEQKK* |
| Ga0070747_11002122 | 3300007276 | Aqueous | VTTDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILEQKQ* |
| Ga0070747_13162422 | 3300007276 | Aqueous | MTTDKVIPLHRPKSDIDEQWQQLEAQQKQIKEQLLKILETKPK* |
| Ga0099847_11729863 | 3300007540 | Aqueous | MTTDKVIPLHPPQSETDKQWAALEAQQKQIREQLEKILEQKK* |
| Ga0099847_12367692 | 3300007540 | Aqueous | MTSDKVIPLHRPKSDIDEQWQQLEAQQKQIKEQLLKILEIKAK* |
| Ga0114916_10828983 | 3300008221 | Deep Ocean | MTTDKVIPLHPPQSETDKQWAALERQQQQIREQLEKILERKK* |
| Ga0114915_10515842 | 3300009428 | Deep Ocean | MTTDKVIPLHPPKSDIDEQWQLLEAQQKQIKEQLLKILETKPK* |
| Ga0114915_11429243 | 3300009428 | Deep Ocean | MTADKVIPLHPPQSEIDKQWAALERQQQQIREQLEKILERKK* |
| Ga0114915_11595881 | 3300009428 | Deep Ocean | DKVIPLHPPKSEIDQQWQILEAQQKQIKEQLLKILETKHK* |
| Ga0114915_11714252 | 3300009428 | Deep Ocean | MTTDKVVPLHPPRSDIDEQWQQLEAQQKQIKEQLLKIMETKLK* |
| Ga0114915_11893862 | 3300009428 | Deep Ocean | MTTDKVIPLHPPKSDIDEQWQQLEAQQKQIKLQLLEILETKLK* |
| Ga0114915_12179932 | 3300009428 | Deep Ocean | MTTDKVIPLHPPQSDTDKQWAALERQQQQIREQLEKILEQK* |
| Ga0114915_12241242 | 3300009428 | Deep Ocean | MTTDKVIPLHPPQSEIDKQWAALELQQKQIREQLEKILEQKK* |
| Ga0114915_12292332 | 3300009428 | Deep Ocean | LTTDKVIPLHPPQSELDQQWAALELQQKQIREQLEKILEQKK* |
| Ga0115008_100414202 | 3300009436 | Marine | MTTDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILEQKQ* |
| Ga0115572_101446505 | 3300009507 | Pelagic Marine | VTTDKVIPLHPPQSETDKQWAALEAQQKQIREQLEKILERKK* |
| Ga0115003_100566575 | 3300009512 | Marine | MTTDKVIPLHPPQSETDKQWAALEAQQKQIREQLEKILERKK* |
| Ga0151669_1060094 | 3300011128 | Marine | VTTEKVIPLHNPHSEIDQQWLALERQQQQIREQLEKILEQKR* |
| Ga0180120_104412842 | 3300017697 | Freshwater To Marine Saline Gradient | MTSDKVIPLHRPKSDIDEQWQQLEAQQKQIKEQLLKILEIKAK |
| Ga0181402_10037496 | 3300017743 | Seawater | MTTDKVIPLHPPKSDIDEQWQILEAQQKQIKEQLLKILETKPK |
| Ga0181407_10790691 | 3300017753 | Seawater | MTTDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILEQK |
| Ga0181425_11610481 | 3300017771 | Seawater | MTTDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILERKK |
| Ga0181430_11158022 | 3300017772 | Seawater | MTTDKVIPLHPPQSELDQQWAALERQQQQIREQLKKILERKK |
| Ga0181424_100774202 | 3300017786 | Seawater | MTTDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILERKQ |
| Ga0206131_103112603 | 3300020185 | Seawater | MTTDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILEQKK |
| Ga0213863_100019609 | 3300021371 | Seawater | MTTAKVIPLHPPKSDIDEQWQILEAQQKQIKEQLLKILETKPK |
| Ga0222716_105994662 | 3300021959 | Estuarine Water | MTTDKVIPLHNPHSEIDQQWLALERQQQQIREQLEKILERKQ |
| Ga0212030_10206702 | 3300022053 | Aqueous | MTTDKVIPLHNPHSEIDQQWLALERQQQQIREQLEKILEQKR |
| Ga0212030_10291342 | 3300022053 | Aqueous | VTTDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILEQKK |
| Ga0196903_10002599 | 3300022169 | Aqueous | MTSDKVIPLHRPKSDIDEQWQQLEAQQKQIKEQLLKILETKPK |
| Ga0207878_1316182 | 3300025039 | Marine | VTTDKVIPLHPPQSETDKQWAALERQQQQIREQLEKILERKK |
| Ga0207905_100238910 | 3300025048 | Marine | MTTDKVIPLHNPHSEIDQQWLALERQQQQIREQLEKILEQKK |
| Ga0207890_10337832 | 3300025079 | Marine | VTTDKVIPLHPPQSETDKQWAALERQQQQIREQLKKILEQKK |
| Ga0208434_10472281 | 3300025098 | Marine | MTTDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKI |
| Ga0208793_10592765 | 3300025108 | Marine | TDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILEQKK |
| Ga0209535_10020165 | 3300025120 | Marine | MTTDKVVPLHPPKSDIDEQWQILEAQQKQIKEQLLKILETKPK |
| Ga0209535_10111176 | 3300025120 | Marine | MTTDKVIPLHPPQSEIDQQWAALEAQQQQIREQLEKILERKQ |
| Ga0209535_10222478 | 3300025120 | Marine | MTTDKVIPLHNPHSEIDQQWLALERQQQQIREQLEKILERKK |
| Ga0209535_10426806 | 3300025120 | Marine | MTTDKVIPLHPPQSELDQQWLALERQQKLIREQLEKILEQKK |
| Ga0209535_11444972 | 3300025120 | Marine | VTTDKVIPLHNPHSEIDQQWLALERQQQQIREQLEKILEQKK |
| Ga0209535_11957932 | 3300025120 | Marine | MTTDKVIPLHPPQSELDQQWAALEAQQKQIREQLEKILERKK |
| Ga0209336_100017692 | 3300025137 | Marine | MTSDKVIPLHPPKSDIDEQWQQLEAQQKQIKEQLLKILETKPK |
| Ga0209634_100037124 | 3300025138 | Marine | MTSDKVIPLHPPKSDIDEQWHQLEAQQKQIKEQLLKILETKPK |
| Ga0209634_10402882 | 3300025138 | Marine | MTTDKVIPLHPPQSETDKQWAALERQQQQIREQLEKILERKK |
| Ga0209634_10470352 | 3300025138 | Marine | MTSDKVIPLHPPKSDIDEQWQQLEAQQKQIKEQLLKILETKTK |
| Ga0209634_10496856 | 3300025138 | Marine | LTTDKVIPLHPPQSELDQQWAALEAQQKQIREQLEKILEQKK |
| Ga0209634_10795432 | 3300025138 | Marine | LTTDKVIPLHPPQSEIDQQWAALERQQKQIREQLEKILERKK |
| Ga0209634_10898924 | 3300025138 | Marine | MTTDKVIPLHPPKSDIDEQWQQLEAQQKQIKEQLLKILETKPK |
| Ga0209634_11740593 | 3300025138 | Marine | LTTDKVIPLHPPQSETDKQWAALEAQQKQIREQLEKILEQKR |
| Ga0209634_11950992 | 3300025138 | Marine | MTSDKVIPLHPPKSDIDEQWQILEDQQKQIKEQLLKILETKPK |
| Ga0209634_12113853 | 3300025138 | Marine | PREMTADKVIPLHPPQSETDKQWQLLEAQQRQIREQLEKILERK |
| Ga0209634_12325861 | 3300025138 | Marine | MTADKVIPLHPPQSETDKQWQLLEAQQRQIREQLEKILE |
| Ga0209634_12365312 | 3300025138 | Marine | MTTDKVIPLHPPQSELDQQWAALERQQQQIREQLEKILERKK |
| Ga0209634_13206541 | 3300025138 | Marine | MTSDKVIPLRPPKSDIDEQWQQLEAQQKQIKEQLLKILETKPK |
| Ga0209337_12278712 | 3300025168 | Marine | LTTDKVIPLHPPQSELDQQWAALEAQQKQIREQLEKILERKK |
| Ga0208814_10225272 | 3300025276 | Deep Ocean | MTTDKVIPLHQPKSDIDEQWQQLEAQQKQIKEQLLKILETKPK |
| Ga0208814_10242534 | 3300025276 | Deep Ocean | MTTDKVIPLHPPKSDIDEQWQLLEAQQKQIKEQLLKILETKPK |
| Ga0208814_10340497 | 3300025276 | Deep Ocean | VTTDKVIPLHPPQSELDQQWAALELQQKQIREQLEKILEQKQ |
| Ga0208814_10423403 | 3300025276 | Deep Ocean | MTTDKVIPLHPPQSELDQQWAVLELQQKQIREQLEKILEQKQ |
| Ga0208814_10431182 | 3300025276 | Deep Ocean | LTTDKVIPLHPPQSETDKQWQLLEAQQRQIREQLQKILERKK |
| Ga0208814_10582944 | 3300025276 | Deep Ocean | MTTDKVIPLHPPRSDIDEQWQQLEAQQKQIKEQLLKILETKRK |
| Ga0208814_10921212 | 3300025276 | Deep Ocean | MTADKVIPLHPPQSETDKQWQLLEAQQRQIREQLEKILEQK |
| Ga0208814_11001522 | 3300025276 | Deep Ocean | MTTDKVIPLHPPQSETDKQWAALERQQQQIREQLEKILEKKQ |
| Ga0208303_10626922 | 3300025543 | Aqueous | VTTDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILERKK |
| Ga0209632_103962892 | 3300025886 | Pelagic Marine | DKVIPLHNPHSEIDQQWLALERQQQQIREQLEKILEQKK |
| Ga0209482_10008854 | 3300027668 | Marine | MTTDKVIPLHPPRSDIDEQWQQLEAQQKQIKEQLLKILETKLK |
| Ga0209383_10786512 | 3300027672 | Marine | MTTDKVIPLHPPQSELDQQWAVLELPQKQIREQLEKILEQKQ |
| Ga0209711_102004873 | 3300027788 | Marine | MTTDKVIPLHPPQSETDKQWAALEAQQKQIREQLEKILERKK |
| Ga0209092_100316119 | 3300027833 | Marine | MTTDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILEQKQ |
| Ga0256368_10316502 | 3300028125 | Sea-Ice Brine | LTTDKVIPLHPPQSETDKQWAALEAQQQQIREQLEKILEQKK |
| Ga0183755_100293021 | 3300029448 | Marine | LTTDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILEQKK |
| Ga0307489_111661261 | 3300031569 | Sackhole Brine | TDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILERKK |
| Ga0302114_100760052 | 3300031621 | Marine | VTIDKVIPLHPPQSETDKQWAALEAQQRQIREQLEKILEQK |
| Ga0315320_103854244 | 3300031851 | Seawater | MTTDKVIPLHNPHSEIDQQWLALERQQKQIREQLEKILEQKK |
| Ga0348335_098093_794_931 | 3300034374 | Aqueous | DQKVTTDKVIPLHNPHSEIDQQWLALERQQKLIREQLEKILEQKK |
| Ga0348336_057187_921_1049 | 3300034375 | Aqueous | MTTDKVIPLHNPHSEIDQQWLALKRQQKLIREQLEKILEQKK |
| ⦗Top⦘ |