| Basic Information | |
|---|---|
| Family ID | F081680 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 39 residues |
| Representative Sequence | GSKVKQGEADLILAREVVKGNDTLVLRDEKGSPVWSWRR |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 92.98 % |
| % of genes from short scaffolds (< 2000 bps) | 85.09 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.842 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.526 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.684 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.877 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 34.33% Coil/Unstructured: 65.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF02585 | PIG-L | 5.26 |
| PF02557 | VanY | 4.39 |
| PF00903 | Glyoxalase | 3.51 |
| PF00486 | Trans_reg_C | 3.51 |
| PF01040 | UbiA | 2.63 |
| PF13456 | RVT_3 | 2.63 |
| PF13539 | Peptidase_M15_4 | 2.63 |
| PF07366 | SnoaL | 2.63 |
| PF01112 | Asparaginase_2 | 1.75 |
| PF02146 | SIR2 | 1.75 |
| PF08031 | BBE | 0.88 |
| PF13490 | zf-HC2 | 0.88 |
| PF00464 | SHMT | 0.88 |
| PF01381 | HTH_3 | 0.88 |
| PF01261 | AP_endonuc_2 | 0.88 |
| PF13649 | Methyltransf_25 | 0.88 |
| PF03979 | Sigma70_r1_1 | 0.88 |
| PF11706 | zf-CGNR | 0.88 |
| PF00881 | Nitroreductase | 0.88 |
| PF01663 | Phosphodiest | 0.88 |
| PF08530 | PepX_C | 0.88 |
| PF02894 | GFO_IDH_MocA_C | 0.88 |
| PF00216 | Bac_DNA_binding | 0.88 |
| PF13524 | Glyco_trans_1_2 | 0.88 |
| PF01566 | Nramp | 0.88 |
| PF02371 | Transposase_20 | 0.88 |
| PF03544 | TonB_C | 0.88 |
| PF13180 | PDZ_2 | 0.88 |
| PF00255 | GSHPx | 0.88 |
| PF13439 | Glyco_transf_4 | 0.88 |
| PF00175 | NAD_binding_1 | 0.88 |
| PF10633 | NPCBM_assoc | 0.88 |
| PF12680 | SnoaL_2 | 0.88 |
| PF00534 | Glycos_transf_1 | 0.88 |
| PF00583 | Acetyltransf_1 | 0.88 |
| PF02446 | Glyco_hydro_77 | 0.88 |
| PF00293 | NUDIX | 0.88 |
| PF01668 | SmpB | 0.88 |
| PF13432 | TPR_16 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 5.26 |
| COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 4.39 |
| COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 4.39 |
| COG1446 | Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamily | Amino acid transport and metabolism [E] | 1.75 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 1.75 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.88 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.88 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.88 |
| COG1640 | 4-alpha-glucanotransferase | Carbohydrate transport and metabolism [G] | 0.88 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.88 |
| COG0691 | tmRNA-binding protein | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.88 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.88 |
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.88 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.88 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.84 % |
| Unclassified | root | N/A | 13.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_12421333 | Not Available | 503 | Open in IMG/M |
| 3300004118|Ga0058886_1348132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300005187|Ga0066675_11109164 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005436|Ga0070713_100089316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2646 | Open in IMG/M |
| 3300005445|Ga0070708_101688683 | Not Available | 589 | Open in IMG/M |
| 3300005456|Ga0070678_100624933 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300005552|Ga0066701_10171568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1317 | Open in IMG/M |
| 3300005557|Ga0066704_10098078 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
| 3300005557|Ga0066704_10813717 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005559|Ga0066700_10345650 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300005568|Ga0066703_10133726 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300005568|Ga0066703_10491250 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300005610|Ga0070763_10964867 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005616|Ga0068852_100074564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2989 | Open in IMG/M |
| 3300005764|Ga0066903_104417587 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300006034|Ga0066656_10135966 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300006050|Ga0075028_100384017 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300006059|Ga0075017_100316133 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300006162|Ga0075030_101333567 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300006173|Ga0070716_100612212 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300006173|Ga0070716_100881507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300006175|Ga0070712_100983647 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300006796|Ga0066665_11182910 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300006800|Ga0066660_10982183 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300006881|Ga0068865_100500739 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300009090|Ga0099827_11050640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300009177|Ga0105248_10123283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2923 | Open in IMG/M |
| 3300009523|Ga0116221_1075120 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300009551|Ga0105238_11953983 | Not Available | 620 | Open in IMG/M |
| 3300009639|Ga0116122_1292262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300010043|Ga0126380_11420019 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300010048|Ga0126373_11879326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300010048|Ga0126373_12390618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300010336|Ga0134071_10351299 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300010358|Ga0126370_12185348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 545 | Open in IMG/M |
| 3300010366|Ga0126379_10812893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1034 | Open in IMG/M |
| 3300010366|Ga0126379_11331467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300010379|Ga0136449_101238661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1170 | Open in IMG/M |
| 3300010379|Ga0136449_101977987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300010379|Ga0136449_103152911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
| 3300011120|Ga0150983_11952712 | Not Available | 504 | Open in IMG/M |
| 3300011444|Ga0137463_1018861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2458 | Open in IMG/M |
| 3300012198|Ga0137364_10415471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
| 3300012199|Ga0137383_10427256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300012356|Ga0137371_10408430 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300012359|Ga0137385_11589602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300012362|Ga0137361_10395101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1270 | Open in IMG/M |
| 3300012363|Ga0137390_11517433 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300012929|Ga0137404_11026974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300012930|Ga0137407_10302292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1463 | Open in IMG/M |
| 3300012944|Ga0137410_10803266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300012960|Ga0164301_11179983 | Not Available | 614 | Open in IMG/M |
| 3300012971|Ga0126369_10494294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1280 | Open in IMG/M |
| 3300013297|Ga0157378_10651787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300015245|Ga0137409_10745782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300015373|Ga0132257_101220149 | Not Available | 952 | Open in IMG/M |
| 3300015374|Ga0132255_100010821 | All Organisms → cellular organisms → Bacteria | 10671 | Open in IMG/M |
| 3300016294|Ga0182041_10134609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1880 | Open in IMG/M |
| 3300016445|Ga0182038_11506168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300017972|Ga0187781_10825182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300017975|Ga0187782_10203276 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300017975|Ga0187782_10239118 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300018037|Ga0187883_10735403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300018062|Ga0187784_10242030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1469 | Open in IMG/M |
| 3300018062|Ga0187784_10790201 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300018468|Ga0066662_10693398 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300018468|Ga0066662_12414213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300019879|Ga0193723_1109249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300020004|Ga0193755_1030200 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300020581|Ga0210399_10453897 | Not Available | 1067 | Open in IMG/M |
| 3300020583|Ga0210401_11629757 | Not Available | 503 | Open in IMG/M |
| 3300021171|Ga0210405_10301187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1267 | Open in IMG/M |
| 3300021181|Ga0210388_10105875 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
| 3300021388|Ga0213875_10498062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300021420|Ga0210394_11547482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300021432|Ga0210384_11111313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300021474|Ga0210390_11556941 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300021560|Ga0126371_13084903 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300025406|Ga0208035_1033460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300025899|Ga0207642_10529242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300025903|Ga0207680_10549546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300025932|Ga0207690_10837324 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300025944|Ga0207661_11362478 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 651 | Open in IMG/M |
| 3300026313|Ga0209761_1338203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300026358|Ga0257166_1062066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300027109|Ga0208603_1004078 | All Organisms → cellular organisms → Bacteria | 2431 | Open in IMG/M |
| 3300027591|Ga0209733_1006867 | All Organisms → cellular organisms → Bacteria | 2944 | Open in IMG/M |
| 3300027591|Ga0209733_1040440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1246 | Open in IMG/M |
| 3300027748|Ga0209689_1144557 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300027783|Ga0209448_10291560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300027846|Ga0209180_10673609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300027884|Ga0209275_10002602 | All Organisms → cellular organisms → Bacteria | 7491 | Open in IMG/M |
| 3300028673|Ga0257175_1108603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300029945|Ga0311330_10134373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2389 | Open in IMG/M |
| 3300030991|Ga0073994_12226264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300031057|Ga0170834_104479248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
| 3300031128|Ga0170823_17248323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300031708|Ga0310686_111507309 | Not Available | 656 | Open in IMG/M |
| 3300031939|Ga0308174_11371223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300031962|Ga0307479_10850538 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300031962|Ga0307479_11102686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300031962|Ga0307479_11882452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300032160|Ga0311301_10464934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1897 | Open in IMG/M |
| 3300032174|Ga0307470_10023216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2834 | Open in IMG/M |
| 3300032180|Ga0307471_103964069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300032828|Ga0335080_10359525 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300033289|Ga0310914_10249253 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300033808|Ga0314867_036404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1157 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.02% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.39% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.39% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.39% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.39% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.88% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.88% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.88% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.88% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300004118 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF208 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_124213331 | 3300000891 | Soil | SLTGSKIKQGEADLVLVREVVKGNNTFALRDAKGNPVWN* |
| Ga0058886_13481321 | 3300004118 | Forest Soil | VALTVSKVKHGAADLVLAREVVRGNDTFVLRDEKGNPVWGSQP* |
| Ga0066675_111091641 | 3300005187 | Soil | GSKVKQGEADLILAREVVKGNDTLVLRDEKGSPVWSWRR* |
| Ga0070713_1000893165 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GSKVKQGGADMVLAREVIKGPDTLVLRDDKGKPVWNFGH* |
| Ga0070708_1016886832 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ITITGSKVKQGETDLILAREIVKGSNDTFVLRDGKGEPVWSWKH* |
| Ga0070678_1006249331 | 3300005456 | Miscanthus Rhizosphere | ITGCKVKQEGGDFVLAREVVKGGDTLVLRDDKGKPVWNWHK* |
| Ga0066701_101715681 | 3300005552 | Soil | QDGADLILAREVVKGNDTLVLRDDKGSPVWNWKRR* |
| Ga0066704_100980781 | 3300005557 | Soil | KVKQGEADLILAREVVKGTDTLVLRDNKGSPVWSWHR* |
| Ga0066704_108137171 | 3300005557 | Soil | KQGEADLILAREVVKGNDTLVLRDEKGSPVWSWRR* |
| Ga0066700_103456503 | 3300005559 | Soil | LTGSKVKHGEAYLILVREVVKGSDTLVLRDEKGSPVWNWHK* |
| Ga0066703_101337264 | 3300005568 | Soil | IALTGSKVKQGEADLTLAREVVKKEDTFVLRDEKGNPVWNWRR* |
| Ga0066703_104912501 | 3300005568 | Soil | VKQGEADLILVREVVKGSDTLVLRDEKGSPVWNWHK* |
| Ga0070763_109648672 | 3300005610 | Soil | VVTGSKVKQDNADLILAREVGKGPDTLVLRDDKGKPVWDWKH* |
| Ga0068852_1000745646 | 3300005616 | Corn Rhizosphere | ISLTGSKIKQADGELFLAREIVKGNNTFALRDAKGNPVWN* |
| Ga0066903_1044175872 | 3300005764 | Tropical Forest Soil | KQDGSDLILARELNKGSDTLVLRDDKGKPVWDWGHK* |
| Ga0066656_101359661 | 3300006034 | Soil | GSKVKQGEADLILVREVVKGSDTLVLRDEKGSPVWNWHK* |
| Ga0075028_1003840172 | 3300006050 | Watersheds | TVTGSKIKQNGTDLVLAREVVKGADTLMLRDDKGKPVWSWHK* |
| Ga0075029_1006105152 | 3300006052 | Watersheds | TLTGSKVKQGDADLFLVREIVKGNDSFVLRDAKGEPVWDWRH* |
| Ga0075017_1000812784 | 3300006059 | Watersheds | TMTGSKVKQADADLFLVREIVKGTDTFALRDAKGEPVWDWRH* |
| Ga0075017_1003161331 | 3300006059 | Watersheds | AKQGEADLILAREVVKGTDTLVLRDEKGNPVWSSHR* |
| Ga0075030_1013335672 | 3300006162 | Watersheds | KQGEADLILAREVVKGTDTLVLRDEKGNPVWSSHR* |
| Ga0070716_1006122121 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GSKVKQGEADLILAREVVKGTDTLVLRDNKGSPVWSWHR* |
| Ga0070716_1008815071 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GSKVKQGEADLVLAREVVKGTDTLVLRDDKGQPIWSWHR* |
| Ga0070712_1009836471 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SKVKQGGADMVLAREVIKGPDTLVLRDDKGKPVWNFGH* |
| Ga0066665_111829102 | 3300006796 | Soil | GSKVKQEGADLMLAREVVKGQDTLVLRDDKGNPVWIWGRR* |
| Ga0066660_109821831 | 3300006800 | Soil | KQDTADLVLAREVVKGSDTLVLRDDKGNPVWTWRR* |
| Ga0068865_1005007392 | 3300006881 | Miscanthus Rhizosphere | GSRVKQGEGEWILAREVVRGTDTLVLRDAKGNPVWS* |
| Ga0099827_110506401 | 3300009090 | Vadose Zone Soil | QGEADLILAREVVKGNDTFVLRDDKGSPVWSWHH* |
| Ga0105248_101232831 | 3300009177 | Switchgrass Rhizosphere | KIKQADGELFLAREIVKGNKTFALRDAKGNAVWN* |
| Ga0116221_10751203 | 3300009523 | Peatlands Soil | TGSKVKHDGADLILAREVVKGTDTLLLRDDKGRPIWNAHR* |
| Ga0105238_119539831 | 3300009551 | Corn Rhizosphere | SKVKQGDADLFLVREIVKGTDTFALRDAKGEPVWDWRH* |
| Ga0116122_12922621 | 3300009639 | Peatland | TGSKVRQGEADLILAREVVKGTDTLVLRDDKGNPIWSWHR* |
| Ga0126380_114200191 | 3300010043 | Tropical Forest Soil | VKQENASLVLAREAQKGQDTLVLRDDKGNPVWVWNTKK* |
| Ga0126373_118793261 | 3300010048 | Tropical Forest Soil | GSKVKAGEADLILAREVVKGNDTLVLRDEKGNPVWSGRH* |
| Ga0126373_123906181 | 3300010048 | Tropical Forest Soil | ALTGSKVTQEDGELILAREIVKGTYMLVLRDKGGPVWNWH* |
| Ga0134071_103512991 | 3300010336 | Grasslands Soil | QGEADLILAREVVKGNDTLVLRDEKGSPVWSWRR* |
| Ga0126370_121853482 | 3300010358 | Tropical Forest Soil | KQGESEIFLAREVMKGNDTFVLRDEKGGPVWNWHR* |
| Ga0126379_108128931 | 3300010366 | Tropical Forest Soil | ALTGSRVKQGETELILGREVVKGTDTLLLRDDKGNPVWR* |
| Ga0126379_113314671 | 3300010366 | Tropical Forest Soil | FTASKITLGGSEMMLAREVVKGQDTLVLRDDKGKPVW* |
| Ga0136449_1012386613 | 3300010379 | Peatlands Soil | KQGEADLILAREVVKGTDTLVLRDEKGNPVWSGHR* |
| Ga0136449_1019779872 | 3300010379 | Peatlands Soil | VPDLGVQQSEADLILAREVVKGTGAIVLRDEKGNPVWSWRR* |
| Ga0136449_1031529111 | 3300010379 | Peatlands Soil | KQDGADLILAREVVKGTDTLVLRDDKGRPIWNWHR* |
| Ga0150983_119527121 | 3300011120 | Forest Soil | LAFTGSKVKYAGVDLILAREVLKGSDTLVLRDEKGNPVWNWKH* |
| Ga0137463_10188613 | 3300011444 | Soil | KVKEGETDLVLAREVVKGNDTFVLRDAKGDPVWN* |
| Ga0137364_104154712 | 3300012198 | Vadose Zone Soil | QGEADLTLAREVVKKDDTFVLRDDKGNPVWTWRH* |
| Ga0137383_104272563 | 3300012199 | Vadose Zone Soil | FTGSKIKQGDAEMILAREVVKGPDTLILRDEKGNPVWSWRR* |
| Ga0137371_104084301 | 3300012356 | Vadose Zone Soil | QGEADLILVREVVKGSDTLVLRDEKGSPVWNWHK* |
| Ga0137385_115896022 | 3300012359 | Vadose Zone Soil | AFTGSKINDGEADLILAREVVKGPDTLILRDDKGNPVWSWHK* |
| Ga0137361_103951011 | 3300012362 | Vadose Zone Soil | GSKVKQDTADLVLAREVVKGNDTLVLRDDKGNPVWAWRR* |
| Ga0137390_115174332 | 3300012363 | Vadose Zone Soil | KQGEADLILVREVVKGSDTLVLRDEKGSPVWNWHK* |
| Ga0137404_110269742 | 3300012929 | Vadose Zone Soil | SKVKHDGTDLILAREVVKGADTLVLRDDKGKPVWNWHK* |
| Ga0137407_103022921 | 3300012930 | Vadose Zone Soil | GSKVKQNGADLLLILAREVVKGDVTLVLRDGKGEPVWSWHR* |
| Ga0137410_108032661 | 3300012944 | Vadose Zone Soil | KVKQNGTDLILAREVVKGDMTLVLRDGKGDPVWSWHR* |
| Ga0164301_111799831 | 3300012960 | Soil | EISLTGSKIKQADAELFLAREIVKGNNTFALRDPKGNPVWN* |
| Ga0126369_104942942 | 3300012971 | Tropical Forest Soil | SKVKQDGSDLVLAREVSKGNDTLVLRDDKGKPVWDWGHK* |
| Ga0157378_106517873 | 3300013297 | Miscanthus Rhizosphere | DEISLTGSKIKQGEADLVLAREVVKGNNTFALRDAKGNPVWN* |
| Ga0137409_107457822 | 3300015245 | Vadose Zone Soil | HLVASQKFQDGADLILAREVVKGTDTLVLRDDKGKPVWNWHK* |
| Ga0182005_12434572 | 3300015265 | Rhizosphere | DELGFTGSRVKQGELEFILVREIVKGTDTFVLRDGKGNPVW* |
| Ga0132257_1012201491 | 3300015373 | Arabidopsis Rhizosphere | TGSRVKQGEGEWILAREVVRGTDTLVLRDAKGNPVWS* |
| Ga0132255_1000108211 | 3300015374 | Arabidopsis Rhizosphere | KQDGSDLVLARQVVKGTDTLMLRDDKGKPVWNWHK* |
| Ga0182041_101346094 | 3300016294 | Soil | ALTGSKVKQDTSDLVLAREVVKGTDALVLRDEKGVPVWNWRH |
| Ga0182038_115061682 | 3300016445 | Soil | ELSFTGSRVKQDGGDLILAREVVKGNDTFVLRDAKGSPVWK |
| Ga0187781_108251821 | 3300017972 | Tropical Peatland | ELSFTGSRVKQDGGDLILAREVVKGDDTFVLRDAKGSPVWK |
| Ga0187782_102032762 | 3300017975 | Tropical Peatland | VKHWEAALILAREVVKGADTLVLCDEKGDPVWTWHR |
| Ga0187782_102391181 | 3300017975 | Tropical Peatland | GSRIKQGDADLILAREIVKGTDTLVLRDEKGNPVWS |
| Ga0187804_105274992 | 3300018006 | Freshwater Sediment | DEITLTGSRVKVGEADLILAREIVRATDTLVLRDAKGNPVWG |
| Ga0187883_107354032 | 3300018037 | Peatland | SRIKQGETELILAREIMKGTDTLVLRDEKGNPVWS |
| Ga0187784_102420303 | 3300018062 | Tropical Peatland | DELSFTGSRVKQDGADLILAREVVKGNDTFVLRDAKGSPVWK |
| Ga0187784_107902012 | 3300018062 | Tropical Peatland | LTGSRIKQGDADLILAREIVKGTDTLVLRDEKGNPVWS |
| Ga0066662_106933982 | 3300018468 | Grasslands Soil | VKQGEADLILVREVVKGSDTLVLRDEKGSPVWNWHK |
| Ga0066662_124142132 | 3300018468 | Grasslands Soil | GSKIKQGDAEMILAREVVKGPDTLILRDEKGNPVWSWRR |
| Ga0193723_11092492 | 3300019879 | Soil | VKQGEADLILAREVVKGTDTLVLRDDKGNPVWSWHR |
| Ga0193755_10302005 | 3300020004 | Soil | KIKQGEADLVLAREVVKGADTLVLRDDKGSPVWTWHP |
| Ga0210399_104538971 | 3300020581 | Soil | SKVKHGEADLILARKVVRGNDTFVLRDEKGNPFWN |
| Ga0210401_116297571 | 3300020583 | Soil | GSKVKYGGADLVLAREVVKGSDTLVLRDDKGTPVWNWRH |
| Ga0210405_103011871 | 3300021171 | Soil | VSKVKHGAADLVLAREVVRGNDTFVLRDEKGNPVWSSQP |
| Ga0210388_101058755 | 3300021181 | Soil | VKYGGADLILAREVVKGSDTLVLRDDKGNPVWSWKH |
| Ga0213875_104980622 | 3300021388 | Plant Roots | SKVKQGDGQMILAREVVKGQDTLVLRDNKGNPVWVWGH |
| Ga0210394_115474822 | 3300021420 | Soil | LTGSKVKHGEADLVLAREVVRGNDTFVLRDEKGNPVWASQR |
| Ga0210384_111113131 | 3300021432 | Soil | LTGSKVKHGEADLVLAREVVRGNDTFVLRDEKGNPVWTSQR |
| Ga0210390_115569411 | 3300021474 | Soil | GSKIKQGDADLILAREVVKGNNTFVFRDDKGTPVWSWHR |
| Ga0210409_102650621 | 3300021559 | Soil | AKEDEISMTGAKAKQGDADVFLVREIAKRTDTFTLRDGKGEPVWDWRH |
| Ga0126371_130849031 | 3300021560 | Tropical Forest Soil | TGSKIRQDGGDLVLAREVVKGTDTLMLRDDKGKPVWNWHK |
| Ga0208035_10334601 | 3300025406 | Peatland | GSRIKQGETELILAREVVRGNDTLVLRDEKGNPIWG |
| Ga0207642_105292422 | 3300025899 | Miscanthus Rhizosphere | ISLTGSKIKQGEADLVLAREVVKGNNTFALRDAKGNPVWN |
| Ga0207680_105495461 | 3300025903 | Switchgrass Rhizosphere | TASKVKQNGTDLLLAREVVRGNETLVLRDDKGVPVWTPHR |
| Ga0207690_108373241 | 3300025932 | Corn Rhizosphere | TGSRVKQGEGEWILAREVVRGTDTLVLRDAKGNPVWS |
| Ga0207661_113624782 | 3300025944 | Corn Rhizosphere | GSRVKQGEGEWILAREVVRGTDTLVLRDAKGNPVWS |
| Ga0207640_110967803 | 3300025981 | Corn Rhizosphere | AKGDEVSMTGSKIKQGDADLFLVREIVKGTDTFALRDAKGDPVWDWRH |
| Ga0209761_13382031 | 3300026313 | Grasslands Soil | IVLTGSKVKPDTADLVLAREVVKGNDTLVLRDEKGNPVWTWHH |
| Ga0257166_10620661 | 3300026358 | Soil | KQGEADLILAREVVKGNDTLVLRDEKGNPIWSWHR |
| Ga0208603_10040783 | 3300027109 | Forest Soil | DEVALTVSKVKHGAADLVLAREVVRGNDTFVLRDEKGNPVWSSQP |
| Ga0209733_10068675 | 3300027591 | Forest Soil | KVKQGEVDLTLAREVVKGNETLVLRDEKGTPVWNWRH |
| Ga0209733_10404401 | 3300027591 | Forest Soil | IKQGEADMILAREVVKGTDTLVLRDNKGNPVWNWKH |
| Ga0209689_11445572 | 3300027748 | Soil | LTGSKVKHGEAYLILVREVVKGSDTLVLRDEKGSPVWNWHK |
| Ga0209448_102915601 | 3300027783 | Bog Forest Soil | SKVKQGEAELVLAREVVRGNDTVVLRDDKGSPVWSWRR |
| Ga0209180_106736092 | 3300027846 | Vadose Zone Soil | SKVKQGEADLTLAREVVKKEDTFVLRDDKGNPVWTWRR |
| Ga0209275_100026021 | 3300027884 | Soil | TGSKVKHGEADLVLAREVVRGNDTFVLRDEKGNPVWASQR |
| Ga0257175_11086031 | 3300028673 | Soil | SKVKQDAADLVLAREVVKGSDTLVLRDDKGNPVWTWRR |
| Ga0311330_101343731 | 3300029945 | Bog | SRIKQGETELILAREVVRGNDTLVLRDEKGNPIWG |
| Ga0073994_122262641 | 3300030991 | Soil | KAEGADLILARELVKGNDTVVLRDGKGDPVWSWHR |
| Ga0170834_1044792482 | 3300031057 | Forest Soil | SKVKHGAADLVLAREVVRGNDTFVLRDEKGNPVWGSQP |
| Ga0170823_172483231 | 3300031128 | Forest Soil | LTGSKVKHGEVELVLAREVVRGNDTFVLRDDKGNPVWGSQR |
| Ga0310686_1115073091 | 3300031708 | Soil | KYGGTDLILAREVVKGSDTLVLRDDKGNPVWSWKH |
| Ga0308174_113712231 | 3300031939 | Soil | KVKQGDADMILTRELIKGTDTIVLRDAKGTPVWNWHK |
| Ga0307479_108505382 | 3300031962 | Hardwood Forest Soil | TLTGSKVKQGETDLVLAREVAKGNNTFVLRDAKGGPVWN |
| Ga0307479_111026862 | 3300031962 | Hardwood Forest Soil | GSKIKQGDAEMILAREVVKGPDTLILRDEKGNPVWGWRR |
| Ga0307479_118824521 | 3300031962 | Hardwood Forest Soil | SKVKQGDADMVLAREVVKGTDTLVLRDEKGNPVWNWKH |
| Ga0311301_104649343 | 3300032160 | Peatlands Soil | VPDLGVQQSEADLILAREVVKGTGAIVLRDEKGNPVWSWRR |
| Ga0307470_100232163 | 3300032174 | Hardwood Forest Soil | VYLTGSKVMQDGTDLILARDVVKVTDTLVLRDDKGKPVWNWHK |
| Ga0307471_1039640691 | 3300032180 | Hardwood Forest Soil | QDGTDLVLAREVVKGSDTLVLRDDKGKPVWDWGHK |
| Ga0335080_103595251 | 3300032828 | Soil | SRVKQDGGDVILAREVVKGNDTFVLRDAKGSPVWK |
| Ga0310914_102492531 | 3300033289 | Soil | GSRVKQDGGDLILAREVVKGNDTFVLRDAKGSPVWK |
| Ga0314867_036404_3_125 | 3300033808 | Peatland | TGSKVKQDEADLILAREVVKGSDTLVLRDDKGNPVWNWRH |
| ⦗Top⦘ |