Metagenome / Metatranscriptome Family F081680

Basic Information
Family ID	F081680
Family Type	Metagenome / Metatranscriptome
Number of Sequences	114
Average Sequence Length	39 residues
Representative Sequence	GSKVKQGEADLILAREVVKGNDTLVLRDEKGSPVWSWRR
Number of Associated Samples	100
Number of Associated Scaffolds	114

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	92.98 %
% of genes from short scaffolds (< 2000 bps)	85.09 %
Associated GOLD sequencing projects	96
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.60

Most Common Taxonomy
Group	Bacteria (86.842 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.526 % of family members)
Environment Ontology (ENVO)	Unclassified (23.684 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (50.877 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 34.33% Coil/Unstructured: 65.67%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 114 Family Scaffolds
PF02585	PIG-L	5.26
PF02557	VanY	4.39
PF00903	Glyoxalase	3.51
PF00486	Trans_reg_C	3.51
PF01040	UbiA	2.63
PF13456	RVT_3	2.63
PF13539	Peptidase_M15_4	2.63
PF07366	SnoaL	2.63
PF01112	Asparaginase_2	1.75
PF02146	SIR2	1.75
PF08031	BBE	0.88
PF13490	zf-HC2	0.88
PF00464	SHMT	0.88
PF01381	HTH_3	0.88
PF01261	AP_endonuc_2	0.88
PF13649	Methyltransf_25	0.88
PF03979	Sigma70_r1_1	0.88
PF11706	zf-CGNR	0.88
PF00881	Nitroreductase	0.88
PF01663	Phosphodiest	0.88
PF08530	PepX_C	0.88
PF02894	GFO_IDH_MocA_C	0.88
PF00216	Bac_DNA_binding	0.88
PF13524	Glyco_trans_1_2	0.88
PF01566	Nramp	0.88
PF02371	Transposase_20	0.88
PF03544	TonB_C	0.88
PF13180	PDZ_2	0.88
PF00255	GSHPx	0.88
PF13439	Glyco_transf_4	0.88
PF00175	NAD_binding_1	0.88
PF10633	NPCBM_assoc	0.88
PF12680	SnoaL_2	0.88
PF00534	Glycos_transf_1	0.88
PF00583	Acetyltransf_1	0.88
PF02446	Glyco_hydro_77	0.88
PF00293	NUDIX	0.88
PF01668	SmpB	0.88
PF13432	TPR_16	0.88

COG ID	Name	Functional Category	% Frequency in 114 Family Scaffolds
COG2120	N-acetylglucosaminyl deacetylase, LmbE family	Carbohydrate transport and metabolism [G]	5.26
COG2173	D-alanyl-D-alanine dipeptidase	Cell wall/membrane/envelope biogenesis [M]	4.39
COG1876	LD-carboxypeptidase LdcB, LAS superfamily	Cell wall/membrane/envelope biogenesis [M]	4.39
COG1446	Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamily	Amino acid transport and metabolism [E]	1.75
COG0846	NAD-dependent protein deacetylase, SIR2 family	Posttranslational modification, protein turnover, chaperones [O]	1.75
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.88
COG0112	Glycine/serine hydroxymethyltransferase	Amino acid transport and metabolism [E]	0.88
COG2936	Predicted acyl esterase	General function prediction only [R]	0.88
COG1914	Mn2+ or Fe2+ transporter, NRAMP family	Inorganic ion transport and metabolism [P]	0.88
COG1640	4-alpha-glucanotransferase	Carbohydrate transport and metabolism [G]	0.88
COG0810	Periplasmic protein TonB, links inner and outer membranes	Cell wall/membrane/envelope biogenesis [M]	0.88
COG0776	Bacterial nucleoid DNA-binding protein IHF-alpha	Replication, recombination and repair [L]	0.88
COG0691	tmRNA-binding protein	Posttranslational modification, protein turnover, chaperones [O]	0.88
COG0673	Predicted dehydrogenase	General function prediction only [R]	0.88
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.88
COG0386	Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides	Defense mechanisms [V]	0.88
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	0.88
COG0156	7-keto-8-aminopelargonate synthetase or related enzyme	Coenzyme transport and metabolism [H]	0.88

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	86.84 %
Unclassified	root	N/A	13.16 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	86.84 %
Unclassified	root	N/A	13.16 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	86.84 %
Unclassified	root	N/A	13.16 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	49.12 %
Unclassified	root	N/A	13.16 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.75 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.88 %

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	22.81 %
Unclassified	root	N/A	13.16 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	3.51 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.88 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.88 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	22.81 %
Unclassified	root	N/A	13.16 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	3.51 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	0.88 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.88 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	22.81 %
Unclassified	root	N/A	13.16 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3.51 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.88 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.88 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	22.81 %
Unclassified	root	N/A	13.16 %
Edaphobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter	0.88 %
Candidatus Sulfotelmatomonas	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas	0.88 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.88 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.88 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	22.81 %
Unclassified	root	N/A	13.16 %
Edaphobacter aggregans	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans	0.88 %
Candidatus Sulfotelmatomonas gaucii	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii	0.88 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.88 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000891\|JGI10214J12806_12421333	Not Available	503	Open in IMG/M
3300004118\|Ga0058886_1348132	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	591	Open in IMG/M
3300005187\|Ga0066675_11109164	All Organisms → cellular organisms → Bacteria	590	Open in IMG/M
3300005436\|Ga0070713_100089316	All Organisms → cellular organisms → Bacteria → Acidobacteria	2646	Open in IMG/M
3300005445\|Ga0070708_101688683	Not Available	589	Open in IMG/M
3300005456\|Ga0070678_100624933	All Organisms → cellular organisms → Bacteria	964	Open in IMG/M
3300005552\|Ga0066701_10171568	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1317	Open in IMG/M
3300005557\|Ga0066704_10098078	All Organisms → cellular organisms → Bacteria	1921	Open in IMG/M
3300005557\|Ga0066704_10813717	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300005559\|Ga0066700_10345650	All Organisms → cellular organisms → Bacteria	1050	Open in IMG/M
3300005568\|Ga0066703_10133726	All Organisms → cellular organisms → Bacteria	1482	Open in IMG/M
3300005568\|Ga0066703_10491250	All Organisms → cellular organisms → Bacteria	730	Open in IMG/M
3300005610\|Ga0070763_10964867	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300005616\|Ga0068852_100074564	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2989	Open in IMG/M
3300005764\|Ga0066903_104417587	All Organisms → cellular organisms → Bacteria	751	Open in IMG/M
3300006034\|Ga0066656_10135966	All Organisms → cellular organisms → Bacteria	1526	Open in IMG/M
3300006050\|Ga0075028_100384017	All Organisms → cellular organisms → Bacteria	800	Open in IMG/M
3300006059\|Ga0075017_100316133	All Organisms → cellular organisms → Bacteria	1156	Open in IMG/M
3300006162\|Ga0075030_101333567	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300006173\|Ga0070716_100612212	All Organisms → cellular organisms → Bacteria	821	Open in IMG/M
3300006173\|Ga0070716_100881507	All Organisms → cellular organisms → Bacteria → Acidobacteria	699	Open in IMG/M
3300006175\|Ga0070712_100983647	All Organisms → cellular organisms → Bacteria	730	Open in IMG/M
3300006796\|Ga0066665_11182910	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300006800\|Ga0066660_10982183	All Organisms → cellular organisms → Bacteria	680	Open in IMG/M
3300006881\|Ga0068865_100500739	All Organisms → cellular organisms → Bacteria	1013	Open in IMG/M
3300009090\|Ga0099827_11050640	All Organisms → cellular organisms → Bacteria → Acidobacteria	707	Open in IMG/M
3300009177\|Ga0105248_10123283	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2923	Open in IMG/M
3300009523\|Ga0116221_1075120	All Organisms → cellular organisms → Bacteria	1521	Open in IMG/M
3300009551\|Ga0105238_11953983	Not Available	620	Open in IMG/M
3300009639\|Ga0116122_1292262	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	500	Open in IMG/M
3300010043\|Ga0126380_11420019	All Organisms → cellular organisms → Bacteria	611	Open in IMG/M
3300010048\|Ga0126373_11879326	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	662	Open in IMG/M
3300010048\|Ga0126373_12390618	All Organisms → cellular organisms → Bacteria → Acidobacteria	588	Open in IMG/M
3300010336\|Ga0134071_10351299	All Organisms → cellular organisms → Bacteria	745	Open in IMG/M
3300010358\|Ga0126370_12185348	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans	545	Open in IMG/M
3300010366\|Ga0126379_10812893	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii	1034	Open in IMG/M
3300010366\|Ga0126379_11331467	All Organisms → cellular organisms → Bacteria → Acidobacteria	824	Open in IMG/M
3300010379\|Ga0136449_101238661	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1170	Open in IMG/M
3300010379\|Ga0136449_101977987	All Organisms → cellular organisms → Bacteria → Acidobacteria	862	Open in IMG/M
3300010379\|Ga0136449_103152911	All Organisms → cellular organisms → Bacteria → Proteobacteria	639	Open in IMG/M
3300011120\|Ga0150983_11952712	Not Available	504	Open in IMG/M
3300011444\|Ga0137463_1018861	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2458	Open in IMG/M
3300012198\|Ga0137364_10415471	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1007	Open in IMG/M
3300012199\|Ga0137383_10427256	All Organisms → cellular organisms → Bacteria → Acidobacteria	971	Open in IMG/M
3300012356\|Ga0137371_10408430	All Organisms → cellular organisms → Bacteria	1053	Open in IMG/M
3300012359\|Ga0137385_11589602	All Organisms → cellular organisms → Bacteria → Acidobacteria	518	Open in IMG/M
3300012362\|Ga0137361_10395101	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1270	Open in IMG/M
3300012363\|Ga0137390_11517433	All Organisms → cellular organisms → Bacteria	610	Open in IMG/M
3300012929\|Ga0137404_11026974	All Organisms → cellular organisms → Bacteria → Acidobacteria	755	Open in IMG/M
3300012930\|Ga0137407_10302292	All Organisms → cellular organisms → Bacteria → Acidobacteria	1463	Open in IMG/M
3300012944\|Ga0137410_10803266	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	790	Open in IMG/M
3300012960\|Ga0164301_11179983	Not Available	614	Open in IMG/M
3300012971\|Ga0126369_10494294	All Organisms → cellular organisms → Bacteria → Acidobacteria	1280	Open in IMG/M
3300013297\|Ga0157378_10651787	All Organisms → cellular organisms → Bacteria → Acidobacteria	1069	Open in IMG/M
3300015245\|Ga0137409_10745782	All Organisms → cellular organisms → Bacteria → Acidobacteria	814	Open in IMG/M
3300015373\|Ga0132257_101220149	Not Available	952	Open in IMG/M
3300015374\|Ga0132255_100010821	All Organisms → cellular organisms → Bacteria	10671	Open in IMG/M
3300016294\|Ga0182041_10134609	All Organisms → cellular organisms → Bacteria → Acidobacteria	1880	Open in IMG/M
3300016445\|Ga0182038_11506168	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	604	Open in IMG/M
3300017972\|Ga0187781_10825182	All Organisms → cellular organisms → Bacteria → Acidobacteria	674	Open in IMG/M
3300017975\|Ga0187782_10203276	All Organisms → cellular organisms → Bacteria	1482	Open in IMG/M
3300017975\|Ga0187782_10239118	All Organisms → cellular organisms → Bacteria	1363	Open in IMG/M
3300018037\|Ga0187883_10735403	All Organisms → cellular organisms → Bacteria → Acidobacteria	515	Open in IMG/M
3300018062\|Ga0187784_10242030	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1469	Open in IMG/M
3300018062\|Ga0187784_10790201	All Organisms → cellular organisms → Bacteria	758	Open in IMG/M
3300018468\|Ga0066662_10693398	All Organisms → cellular organisms → Bacteria	971	Open in IMG/M
3300018468\|Ga0066662_12414213	All Organisms → cellular organisms → Bacteria → Acidobacteria	553	Open in IMG/M
3300019879\|Ga0193723_1109249	All Organisms → cellular organisms → Bacteria → Acidobacteria	775	Open in IMG/M
3300020004\|Ga0193755_1030200	All Organisms → cellular organisms → Bacteria	1794	Open in IMG/M
3300020581\|Ga0210399_10453897	Not Available	1067	Open in IMG/M
3300020583\|Ga0210401_11629757	Not Available	503	Open in IMG/M
3300021171\|Ga0210405_10301187	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1267	Open in IMG/M
3300021181\|Ga0210388_10105875	All Organisms → cellular organisms → Bacteria	2412	Open in IMG/M
3300021388\|Ga0213875_10498062	All Organisms → cellular organisms → Bacteria → Acidobacteria	585	Open in IMG/M
3300021420\|Ga0210394_11547482	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	560	Open in IMG/M
3300021432\|Ga0210384_11111313	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	694	Open in IMG/M
3300021474\|Ga0210390_11556941	All Organisms → cellular organisms → Bacteria	522	Open in IMG/M
3300021560\|Ga0126371_13084903	All Organisms → cellular organisms → Bacteria	564	Open in IMG/M
3300025406\|Ga0208035_1033460	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	815	Open in IMG/M
3300025899\|Ga0207642_10529242	All Organisms → cellular organisms → Bacteria → Acidobacteria	725	Open in IMG/M
3300025903\|Ga0207680_10549546	All Organisms → cellular organisms → Bacteria → Acidobacteria	824	Open in IMG/M
3300025932\|Ga0207690_10837324	All Organisms → cellular organisms → Bacteria	761	Open in IMG/M
3300025944\|Ga0207661_11362478	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	651	Open in IMG/M
3300026313\|Ga0209761_1338203	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	511	Open in IMG/M
3300026358\|Ga0257166_1062066	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	540	Open in IMG/M
3300027109\|Ga0208603_1004078	All Organisms → cellular organisms → Bacteria	2431	Open in IMG/M
3300027591\|Ga0209733_1006867	All Organisms → cellular organisms → Bacteria	2944	Open in IMG/M
3300027591\|Ga0209733_1040440	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1246	Open in IMG/M
3300027748\|Ga0209689_1144557	All Organisms → cellular organisms → Bacteria	1157	Open in IMG/M
3300027783\|Ga0209448_10291560	All Organisms → cellular organisms → Bacteria → Acidobacteria	535	Open in IMG/M
3300027846\|Ga0209180_10673609	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	565	Open in IMG/M
3300027884\|Ga0209275_10002602	All Organisms → cellular organisms → Bacteria	7491	Open in IMG/M
3300028673\|Ga0257175_1108603	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	547	Open in IMG/M
3300029945\|Ga0311330_10134373	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2389	Open in IMG/M
3300030991\|Ga0073994_12226264	All Organisms → cellular organisms → Bacteria → Acidobacteria	775	Open in IMG/M
3300031057\|Ga0170834_104479248	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	874	Open in IMG/M
3300031128\|Ga0170823_17248323	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	669	Open in IMG/M
3300031708\|Ga0310686_111507309	Not Available	656	Open in IMG/M
3300031939\|Ga0308174_11371223	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	605	Open in IMG/M
3300031962\|Ga0307479_10850538	All Organisms → cellular organisms → Bacteria	886	Open in IMG/M
3300031962\|Ga0307479_11102686	All Organisms → cellular organisms → Bacteria → Acidobacteria	760	Open in IMG/M
3300031962\|Ga0307479_11882452	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	549	Open in IMG/M
3300032160\|Ga0311301_10464934	All Organisms → cellular organisms → Bacteria → Acidobacteria	1897	Open in IMG/M
3300032174\|Ga0307470_10023216	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2834	Open in IMG/M
3300032180\|Ga0307471_103964069	All Organisms → cellular organisms → Bacteria → Acidobacteria	523	Open in IMG/M
3300032828\|Ga0335080_10359525	All Organisms → cellular organisms → Bacteria	1569	Open in IMG/M
3300033289\|Ga0310914_10249253	All Organisms → cellular organisms → Bacteria	1595	Open in IMG/M
3300033808\|Ga0314867_036404	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1157	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	87.72%
Host-Associated	Host-Associated	12.28%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	78.07%
Plants	Host-Associated → Plants	12.28%
Aquatic	Environmental → Aquatic	9.65%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	77.19%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.14%
Sediment	Environmental → Aquatic → Sediment	5.26%
Rhizosphere	Host-Associated → Plants → Rhizosphere	5.26%
Freshwater	Environmental → Aquatic → Freshwater	4.39%
Peat	Environmental → Terrestrial → Peat	0.88%
Roots	Host-Associated → Plants → Roots	0.88%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	58.77%
Loam	Environmental → Terrestrial → Soil → Loam	12.28%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.14%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.26%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	4.39%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.51%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.51%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.75%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.75%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.88%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.88%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.88%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	26.32%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	18.42%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	13.16%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	7.02%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	6.14%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.26%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.26%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.51%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.51%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	1.75%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.75%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.75%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.75%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.88%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.88%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.88%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.88%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	10.53%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	10.53%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	10.53%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	7.02%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	4.39%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	4.39%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	4.39%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	4.39%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	4.39%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.39%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.51%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.63%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	1.75%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.75%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.75%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.75%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.75%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.75%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.75%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.88%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.88%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.88%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.88%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.88%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.88%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.88%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.88%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.88%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.88%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.88%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	0.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.88%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.88%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.88%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.88%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.88%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300004118	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF208 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005610	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental	Open in IMG/M
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental	Open in IMG/M
3300006162	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009523	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG	Environmental	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009639	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017975	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018006	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4	Environmental	Open in IMG/M
3300018037	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10	Environmental	Open in IMG/M
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300019879	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2	Environmental	Open in IMG/M
3300020004	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental	Open in IMG/M
3300021171	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M	Environmental	Open in IMG/M
3300021181	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O	Environmental	Open in IMG/M
3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Host-Associated	Open in IMG/M
3300021420	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021474	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O	Environmental	Open in IMG/M
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025406	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026313	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026358	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B	Environmental	Open in IMG/M
3300027109	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes)	Environmental	Open in IMG/M
3300027591	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)	Environmental	Open in IMG/M
3300027748	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)	Environmental	Open in IMG/M
3300027783	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027884	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)	Environmental	Open in IMG/M
3300028673	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B	Environmental	Open in IMG/M
3300029945	I_Bog_N2 coassembly	Environmental	Open in IMG/M
3300030991	Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031128	Oak Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental	Open in IMG/M
3300033808	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI10214J12806_124213331	3300000891	Soil	SLTGSKIKQGEADLVLVREVVKGNNTFALRDAKGNPVWN*
Ga0058886_13481321	3300004118	Forest Soil	VALTVSKVKHGAADLVLAREVVRGNDTFVLRDEKGNPVWGSQP*
Ga0066675_111091641	3300005187	Soil	GSKVKQGEADLILAREVVKGNDTLVLRDEKGSPVWSWRR*
Ga0070713_1000893165	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	GSKVKQGGADMVLAREVIKGPDTLVLRDDKGKPVWNFGH*
Ga0070708_1016886832	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	ITITGSKVKQGETDLILAREIVKGSNDTFVLRDGKGEPVWSWKH*
Ga0070678_1006249331	3300005456	Miscanthus Rhizosphere	ITGCKVKQEGGDFVLAREVVKGGDTLVLRDDKGKPVWNWHK*
Ga0066701_101715681	3300005552	Soil	QDGADLILAREVVKGNDTLVLRDDKGSPVWNWKRR*
Ga0066704_100980781	3300005557	Soil	KVKQGEADLILAREVVKGTDTLVLRDNKGSPVWSWHR*
Ga0066704_108137171	3300005557	Soil	KQGEADLILAREVVKGNDTLVLRDEKGSPVWSWRR*
Ga0066700_103456503	3300005559	Soil	LTGSKVKHGEAYLILVREVVKGSDTLVLRDEKGSPVWNWHK*
Ga0066703_101337264	3300005568	Soil	IALTGSKVKQGEADLTLAREVVKKEDTFVLRDEKGNPVWNWRR*
Ga0066703_104912501	3300005568	Soil	VKQGEADLILVREVVKGSDTLVLRDEKGSPVWNWHK*
Ga0070763_109648672	3300005610	Soil	VVTGSKVKQDNADLILAREVGKGPDTLVLRDDKGKPVWDWKH*
Ga0068852_1000745646	3300005616	Corn Rhizosphere	ISLTGSKIKQADGELFLAREIVKGNNTFALRDAKGNPVWN*
Ga0066903_1044175872	3300005764	Tropical Forest Soil	KQDGSDLILARELNKGSDTLVLRDDKGKPVWDWGHK*
Ga0066656_101359661	3300006034	Soil	GSKVKQGEADLILVREVVKGSDTLVLRDEKGSPVWNWHK*
Ga0075028_1003840172	3300006050	Watersheds	TVTGSKIKQNGTDLVLAREVVKGADTLMLRDDKGKPVWSWHK*
Ga0075029_1006105152	3300006052	Watersheds	TLTGSKVKQGDADLFLVREIVKGNDSFVLRDAKGEPVWDWRH*
Ga0075017_1000812784	3300006059	Watersheds	TMTGSKVKQADADLFLVREIVKGTDTFALRDAKGEPVWDWRH*
Ga0075017_1003161331	3300006059	Watersheds	AKQGEADLILAREVVKGTDTLVLRDEKGNPVWSSHR*
Ga0075030_1013335672	3300006162	Watersheds	KQGEADLILAREVVKGTDTLVLRDEKGNPVWSSHR*
Ga0070716_1006122121	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	GSKVKQGEADLILAREVVKGTDTLVLRDNKGSPVWSWHR*
Ga0070716_1008815071	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	GSKVKQGEADLVLAREVVKGTDTLVLRDDKGQPIWSWHR*
Ga0070712_1009836471	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	SKVKQGGADMVLAREVIKGPDTLVLRDDKGKPVWNFGH*
Ga0066665_111829102	3300006796	Soil	GSKVKQEGADLMLAREVVKGQDTLVLRDDKGNPVWIWGRR*
Ga0066660_109821831	3300006800	Soil	KQDTADLVLAREVVKGSDTLVLRDDKGNPVWTWRR*
Ga0068865_1005007392	3300006881	Miscanthus Rhizosphere	GSRVKQGEGEWILAREVVRGTDTLVLRDAKGNPVWS*
Ga0099827_110506401	3300009090	Vadose Zone Soil	QGEADLILAREVVKGNDTFVLRDDKGSPVWSWHH*
Ga0105248_101232831	3300009177	Switchgrass Rhizosphere	KIKQADGELFLAREIVKGNKTFALRDAKGNAVWN*
Ga0116221_10751203	3300009523	Peatlands Soil	TGSKVKHDGADLILAREVVKGTDTLLLRDDKGRPIWNAHR*
Ga0105238_119539831	3300009551	Corn Rhizosphere	SKVKQGDADLFLVREIVKGTDTFALRDAKGEPVWDWRH*
Ga0116122_12922621	3300009639	Peatland	TGSKVRQGEADLILAREVVKGTDTLVLRDDKGNPIWSWHR*
Ga0126380_114200191	3300010043	Tropical Forest Soil	VKQENASLVLAREAQKGQDTLVLRDDKGNPVWVWNTKK*
Ga0126373_118793261	3300010048	Tropical Forest Soil	GSKVKAGEADLILAREVVKGNDTLVLRDEKGNPVWSGRH*
Ga0126373_123906181	3300010048	Tropical Forest Soil	ALTGSKVTQEDGELILAREIVKGTYMLVLRDKGGPVWNWH*
Ga0134071_103512991	3300010336	Grasslands Soil	QGEADLILAREVVKGNDTLVLRDEKGSPVWSWRR*
Ga0126370_121853482	3300010358	Tropical Forest Soil	KQGESEIFLAREVMKGNDTFVLRDEKGGPVWNWHR*
Ga0126379_108128931	3300010366	Tropical Forest Soil	ALTGSRVKQGETELILGREVVKGTDTLLLRDDKGNPVWR*
Ga0126379_113314671	3300010366	Tropical Forest Soil	FTASKITLGGSEMMLAREVVKGQDTLVLRDDKGKPVW*
Ga0136449_1012386613	3300010379	Peatlands Soil	KQGEADLILAREVVKGTDTLVLRDEKGNPVWSGHR*
Ga0136449_1019779872	3300010379	Peatlands Soil	VPDLGVQQSEADLILAREVVKGTGAIVLRDEKGNPVWSWRR*
Ga0136449_1031529111	3300010379	Peatlands Soil	KQDGADLILAREVVKGTDTLVLRDDKGRPIWNWHR*
Ga0150983_119527121	3300011120	Forest Soil	LAFTGSKVKYAGVDLILAREVLKGSDTLVLRDEKGNPVWNWKH*
Ga0137463_10188613	3300011444	Soil	KVKEGETDLVLAREVVKGNDTFVLRDAKGDPVWN*
Ga0137364_104154712	3300012198	Vadose Zone Soil	QGEADLTLAREVVKKDDTFVLRDDKGNPVWTWRH*
Ga0137383_104272563	3300012199	Vadose Zone Soil	FTGSKIKQGDAEMILAREVVKGPDTLILRDEKGNPVWSWRR*
Ga0137371_104084301	3300012356	Vadose Zone Soil	QGEADLILVREVVKGSDTLVLRDEKGSPVWNWHK*
Ga0137385_115896022	3300012359	Vadose Zone Soil	AFTGSKINDGEADLILAREVVKGPDTLILRDDKGNPVWSWHK*
Ga0137361_103951011	3300012362	Vadose Zone Soil	GSKVKQDTADLVLAREVVKGNDTLVLRDDKGNPVWAWRR*
Ga0137390_115174332	3300012363	Vadose Zone Soil	KQGEADLILVREVVKGSDTLVLRDEKGSPVWNWHK*
Ga0137404_110269742	3300012929	Vadose Zone Soil	SKVKHDGTDLILAREVVKGADTLVLRDDKGKPVWNWHK*
Ga0137407_103022921	3300012930	Vadose Zone Soil	GSKVKQNGADLLLILAREVVKGDVTLVLRDGKGEPVWSWHR*
Ga0137410_108032661	3300012944	Vadose Zone Soil	KVKQNGTDLILAREVVKGDMTLVLRDGKGDPVWSWHR*
Ga0164301_111799831	3300012960	Soil	EISLTGSKIKQADAELFLAREIVKGNNTFALRDPKGNPVWN*
Ga0126369_104942942	3300012971	Tropical Forest Soil	SKVKQDGSDLVLAREVSKGNDTLVLRDDKGKPVWDWGHK*
Ga0157378_106517873	3300013297	Miscanthus Rhizosphere	DEISLTGSKIKQGEADLVLAREVVKGNNTFALRDAKGNPVWN*
Ga0137409_107457822	3300015245	Vadose Zone Soil	HLVASQKFQDGADLILAREVVKGTDTLVLRDDKGKPVWNWHK*
Ga0182005_12434572	3300015265	Rhizosphere	DELGFTGSRVKQGELEFILVREIVKGTDTFVLRDGKGNPVW*
Ga0132257_1012201491	3300015373	Arabidopsis Rhizosphere	TGSRVKQGEGEWILAREVVRGTDTLVLRDAKGNPVWS*
Ga0132255_1000108211	3300015374	Arabidopsis Rhizosphere	KQDGSDLVLARQVVKGTDTLMLRDDKGKPVWNWHK*
Ga0182041_101346094	3300016294	Soil	ALTGSKVKQDTSDLVLAREVVKGTDALVLRDEKGVPVWNWRH
Ga0182038_115061682	3300016445	Soil	ELSFTGSRVKQDGGDLILAREVVKGNDTFVLRDAKGSPVWK
Ga0187781_108251821	3300017972	Tropical Peatland	ELSFTGSRVKQDGGDLILAREVVKGDDTFVLRDAKGSPVWK
Ga0187782_102032762	3300017975	Tropical Peatland	VKHWEAALILAREVVKGADTLVLCDEKGDPVWTWHR
Ga0187782_102391181	3300017975	Tropical Peatland	GSRIKQGDADLILAREIVKGTDTLVLRDEKGNPVWS
Ga0187804_105274992	3300018006	Freshwater Sediment	DEITLTGSRVKVGEADLILAREIVRATDTLVLRDAKGNPVWG
Ga0187883_107354032	3300018037	Peatland	SRIKQGETELILAREIMKGTDTLVLRDEKGNPVWS
Ga0187784_102420303	3300018062	Tropical Peatland	DELSFTGSRVKQDGADLILAREVVKGNDTFVLRDAKGSPVWK
Ga0187784_107902012	3300018062	Tropical Peatland	LTGSRIKQGDADLILAREIVKGTDTLVLRDEKGNPVWS
Ga0066662_106933982	3300018468	Grasslands Soil	VKQGEADLILVREVVKGSDTLVLRDEKGSPVWNWHK
Ga0066662_124142132	3300018468	Grasslands Soil	GSKIKQGDAEMILAREVVKGPDTLILRDEKGNPVWSWRR
Ga0193723_11092492	3300019879	Soil	VKQGEADLILAREVVKGTDTLVLRDDKGNPVWSWHR
Ga0193755_10302005	3300020004	Soil	KIKQGEADLVLAREVVKGADTLVLRDDKGSPVWTWHP
Ga0210399_104538971	3300020581	Soil	SKVKHGEADLILARKVVRGNDTFVLRDEKGNPFWN
Ga0210401_116297571	3300020583	Soil	GSKVKYGGADLVLAREVVKGSDTLVLRDDKGTPVWNWRH
Ga0210405_103011871	3300021171	Soil	VSKVKHGAADLVLAREVVRGNDTFVLRDEKGNPVWSSQP
Ga0210388_101058755	3300021181	Soil	VKYGGADLILAREVVKGSDTLVLRDDKGNPVWSWKH
Ga0213875_104980622	3300021388	Plant Roots	SKVKQGDGQMILAREVVKGQDTLVLRDNKGNPVWVWGH
Ga0210394_115474822	3300021420	Soil	LTGSKVKHGEADLVLAREVVRGNDTFVLRDEKGNPVWASQR
Ga0210384_111113131	3300021432	Soil	LTGSKVKHGEADLVLAREVVRGNDTFVLRDEKGNPVWTSQR
Ga0210390_115569411	3300021474	Soil	GSKIKQGDADLILAREVVKGNNTFVFRDDKGTPVWSWHR
Ga0210409_102650621	3300021559	Soil	AKEDEISMTGAKAKQGDADVFLVREIAKRTDTFTLRDGKGEPVWDWRH
Ga0126371_130849031	3300021560	Tropical Forest Soil	TGSKIRQDGGDLVLAREVVKGTDTLMLRDDKGKPVWNWHK
Ga0208035_10334601	3300025406	Peatland	GSRIKQGETELILAREVVRGNDTLVLRDEKGNPIWG
Ga0207642_105292422	3300025899	Miscanthus Rhizosphere	ISLTGSKIKQGEADLVLAREVVKGNNTFALRDAKGNPVWN
Ga0207680_105495461	3300025903	Switchgrass Rhizosphere	TASKVKQNGTDLLLAREVVRGNETLVLRDDKGVPVWTPHR
Ga0207690_108373241	3300025932	Corn Rhizosphere	TGSRVKQGEGEWILAREVVRGTDTLVLRDAKGNPVWS
Ga0207661_113624782	3300025944	Corn Rhizosphere	GSRVKQGEGEWILAREVVRGTDTLVLRDAKGNPVWS
Ga0207640_110967803	3300025981	Corn Rhizosphere	AKGDEVSMTGSKIKQGDADLFLVREIVKGTDTFALRDAKGDPVWDWRH
Ga0209761_13382031	3300026313	Grasslands Soil	IVLTGSKVKPDTADLVLAREVVKGNDTLVLRDEKGNPVWTWHH
Ga0257166_10620661	3300026358	Soil	KQGEADLILAREVVKGNDTLVLRDEKGNPIWSWHR
Ga0208603_10040783	3300027109	Forest Soil	DEVALTVSKVKHGAADLVLAREVVRGNDTFVLRDEKGNPVWSSQP
Ga0209733_10068675	3300027591	Forest Soil	KVKQGEVDLTLAREVVKGNETLVLRDEKGTPVWNWRH
Ga0209733_10404401	3300027591	Forest Soil	IKQGEADMILAREVVKGTDTLVLRDNKGNPVWNWKH
Ga0209689_11445572	3300027748	Soil	LTGSKVKHGEAYLILVREVVKGSDTLVLRDEKGSPVWNWHK
Ga0209448_102915601	3300027783	Bog Forest Soil	SKVKQGEAELVLAREVVRGNDTVVLRDDKGSPVWSWRR
Ga0209180_106736092	3300027846	Vadose Zone Soil	SKVKQGEADLTLAREVVKKEDTFVLRDDKGNPVWTWRR
Ga0209275_100026021	3300027884	Soil	TGSKVKHGEADLVLAREVVRGNDTFVLRDEKGNPVWASQR
Ga0257175_11086031	3300028673	Soil	SKVKQDAADLVLAREVVKGSDTLVLRDDKGNPVWTWRR
Ga0311330_101343731	3300029945	Bog	SRIKQGETELILAREVVRGNDTLVLRDEKGNPIWG
Ga0073994_122262641	3300030991	Soil	KAEGADLILARELVKGNDTVVLRDGKGDPVWSWHR
Ga0170834_1044792482	3300031057	Forest Soil	SKVKHGAADLVLAREVVRGNDTFVLRDEKGNPVWGSQP
Ga0170823_172483231	3300031128	Forest Soil	LTGSKVKHGEVELVLAREVVRGNDTFVLRDDKGNPVWGSQR
Ga0310686_1115073091	3300031708	Soil	KYGGTDLILAREVVKGSDTLVLRDDKGNPVWSWKH
Ga0308174_113712231	3300031939	Soil	KVKQGDADMILTRELIKGTDTIVLRDAKGTPVWNWHK
Ga0307479_108505382	3300031962	Hardwood Forest Soil	TLTGSKVKQGETDLVLAREVAKGNNTFVLRDAKGGPVWN
Ga0307479_111026862	3300031962	Hardwood Forest Soil	GSKIKQGDAEMILAREVVKGPDTLILRDEKGNPVWGWRR
Ga0307479_118824521	3300031962	Hardwood Forest Soil	SKVKQGDADMVLAREVVKGTDTLVLRDEKGNPVWNWKH
Ga0311301_104649343	3300032160	Peatlands Soil	VPDLGVQQSEADLILAREVVKGTGAIVLRDEKGNPVWSWRR
Ga0307470_100232163	3300032174	Hardwood Forest Soil	VYLTGSKVMQDGTDLILARDVVKVTDTLVLRDDKGKPVWNWHK
Ga0307471_1039640691	3300032180	Hardwood Forest Soil	QDGTDLVLAREVVKGSDTLVLRDDKGKPVWDWGHK
Ga0335080_103595251	3300032828	Soil	SRVKQDGGDVILAREVVKGNDTFVLRDAKGSPVWK
Ga0310914_102492531	3300033289	Soil	GSRVKQDGGDLILAREVVKGNDTFVLRDAKGSPVWK
Ga0314867_036404_3_125	3300033808	Peatland	TGSKVKQDEADLILAREVVKGSDTLVLRDDKGNPVWNWRH

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.60
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.60
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F081680

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign