| Basic Information | |
|---|---|
| Family ID | F081679 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHVYLAGLSFNALD |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 57.89 % |
| % of genes near scaffold ends (potentially truncated) | 37.72 % |
| % of genes from short scaffolds (< 2000 bps) | 84.21 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.281 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.403 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.368 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (60.526 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 74.00% β-sheet: 0.00% Coil/Unstructured: 26.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00892 | EamA | 8.18 |
| PF00589 | Phage_integrase | 4.55 |
| PF03176 | MMPL | 3.64 |
| PF07045 | DUF1330 | 1.82 |
| PF07931 | CPT | 1.82 |
| PF03446 | NAD_binding_2 | 1.82 |
| PF00561 | Abhydrolase_1 | 0.91 |
| PF13419 | HAD_2 | 0.91 |
| PF03372 | Exo_endo_phos | 0.91 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.91 |
| PF01850 | PIN | 0.91 |
| PF03235 | DUF262 | 0.91 |
| PF08388 | GIIM | 0.91 |
| PF02371 | Transposase_20 | 0.91 |
| PF16327 | CcmF_C | 0.91 |
| PF02720 | DUF222 | 0.91 |
| PF03729 | DUF308 | 0.91 |
| PF07228 | SpoIIE | 0.91 |
| PF00400 | WD40 | 0.91 |
| PF01925 | TauE | 0.91 |
| PF04149 | DUF397 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 3.64 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 3.64 |
| COG3896 | Chloramphenicol 3-O-phosphotransferase | Defense mechanisms [V] | 1.82 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 1.82 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.91 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.91 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.91 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.28 % |
| Unclassified | root | N/A | 37.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005093|Ga0062594_101449207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 700 | Open in IMG/M |
| 3300005332|Ga0066388_103019486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 860 | Open in IMG/M |
| 3300005334|Ga0068869_101430275 | Not Available | 613 | Open in IMG/M |
| 3300005341|Ga0070691_10222035 | Not Available | 1002 | Open in IMG/M |
| 3300005341|Ga0070691_10222035 | Not Available | 1002 | Open in IMG/M |
| 3300005354|Ga0070675_100803685 | Not Available | 860 | Open in IMG/M |
| 3300005366|Ga0070659_100269715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1414 | Open in IMG/M |
| 3300005434|Ga0070709_10313901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1148 | Open in IMG/M |
| 3300005439|Ga0070711_101944723 | Not Available | 517 | Open in IMG/M |
| 3300005544|Ga0070686_101058204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
| 3300005545|Ga0070695_100053790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2590 | Open in IMG/M |
| 3300005563|Ga0068855_101773627 | Not Available | 628 | Open in IMG/M |
| 3300005842|Ga0068858_100036408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4563 | Open in IMG/M |
| 3300006034|Ga0066656_10918597 | Not Available | 561 | Open in IMG/M |
| 3300006173|Ga0070716_100637003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Leekyejoonella → Leekyejoonella antrihumi | 807 | Open in IMG/M |
| 3300006173|Ga0070716_100821144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
| 3300006237|Ga0097621_101788687 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006576|Ga0074047_12055367 | Not Available | 697 | Open in IMG/M |
| 3300006581|Ga0074048_10002465 | Not Available | 666 | Open in IMG/M |
| 3300006755|Ga0079222_11754845 | Not Available | 598 | Open in IMG/M |
| 3300006796|Ga0066665_11256597 | Not Available | 567 | Open in IMG/M |
| 3300006797|Ga0066659_11042156 | Not Available | 683 | Open in IMG/M |
| 3300006800|Ga0066660_10840759 | Not Available | 748 | Open in IMG/M |
| 3300006871|Ga0075434_101266658 | Not Available | 749 | Open in IMG/M |
| 3300006904|Ga0075424_101546996 | Not Available | 704 | Open in IMG/M |
| 3300009012|Ga0066710_103276556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300009012|Ga0066710_103910613 | Not Available | 558 | Open in IMG/M |
| 3300009093|Ga0105240_10835844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 995 | Open in IMG/M |
| 3300009098|Ga0105245_10135927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2310 | Open in IMG/M |
| 3300009101|Ga0105247_10444124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter cremeus | 934 | Open in IMG/M |
| 3300009176|Ga0105242_11415325 | Not Available | 723 | Open in IMG/M |
| 3300009545|Ga0105237_12246403 | Not Available | 555 | Open in IMG/M |
| 3300009551|Ga0105238_11154430 | Not Available | 798 | Open in IMG/M |
| 3300010043|Ga0126380_10952792 | Not Available | 718 | Open in IMG/M |
| 3300010046|Ga0126384_10195431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1597 | Open in IMG/M |
| 3300010358|Ga0126370_11117722 | Not Available | 727 | Open in IMG/M |
| 3300010360|Ga0126372_10959446 | Not Available | 863 | Open in IMG/M |
| 3300010360|Ga0126372_13222027 | Not Available | 507 | Open in IMG/M |
| 3300010361|Ga0126378_10192047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → Microbacterium rhizomatis | 2114 | Open in IMG/M |
| 3300010361|Ga0126378_10579986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1236 | Open in IMG/M |
| 3300010362|Ga0126377_12561340 | Not Available | 586 | Open in IMG/M |
| 3300010371|Ga0134125_10351937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1634 | Open in IMG/M |
| 3300010373|Ga0134128_10545469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1292 | Open in IMG/M |
| 3300010373|Ga0134128_11956147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 645 | Open in IMG/M |
| 3300010375|Ga0105239_11495915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 780 | Open in IMG/M |
| 3300010375|Ga0105239_12725582 | Not Available | 577 | Open in IMG/M |
| 3300010396|Ga0134126_11339880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 792 | Open in IMG/M |
| 3300010397|Ga0134124_10133238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2199 | Open in IMG/M |
| 3300010397|Ga0134124_11724459 | Not Available | 659 | Open in IMG/M |
| 3300010399|Ga0134127_10743860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1024 | Open in IMG/M |
| 3300010401|Ga0134121_10304436 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300012198|Ga0137364_11427489 | Not Available | 512 | Open in IMG/M |
| 3300012199|Ga0137383_10008040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6944 | Open in IMG/M |
| 3300012199|Ga0137383_10008040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6944 | Open in IMG/M |
| 3300012201|Ga0137365_10009014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7924 | Open in IMG/M |
| 3300012207|Ga0137381_10169645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1884 | Open in IMG/M |
| 3300012210|Ga0137378_11312425 | Not Available | 639 | Open in IMG/M |
| 3300012351|Ga0137386_10646585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 761 | Open in IMG/M |
| 3300012354|Ga0137366_10009502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 7664 | Open in IMG/M |
| 3300012356|Ga0137371_11338064 | Not Available | 528 | Open in IMG/M |
| 3300012929|Ga0137404_10078221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2616 | Open in IMG/M |
| 3300012929|Ga0137404_10078221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2616 | Open in IMG/M |
| 3300012930|Ga0137407_10235682 | Not Available | 1654 | Open in IMG/M |
| 3300012960|Ga0164301_10006663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4354 | Open in IMG/M |
| 3300013102|Ga0157371_10481541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 915 | Open in IMG/M |
| 3300013102|Ga0157371_11143031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300013104|Ga0157370_10131554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 2334 | Open in IMG/M |
| 3300013104|Ga0157370_11042019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 740 | Open in IMG/M |
| 3300013105|Ga0157369_10500710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1257 | Open in IMG/M |
| 3300013296|Ga0157374_10059508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3572 | Open in IMG/M |
| 3300013296|Ga0157374_10319266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1539 | Open in IMG/M |
| 3300013297|Ga0157378_10260702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1663 | Open in IMG/M |
| 3300013307|Ga0157372_10625952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1254 | Open in IMG/M |
| 3300014968|Ga0157379_10284310 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300014968|Ga0157379_10284310 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300014968|Ga0157379_11634681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| 3300014969|Ga0157376_10030958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4279 | Open in IMG/M |
| 3300014969|Ga0157376_11934685 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300015264|Ga0137403_10138751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2407 | Open in IMG/M |
| 3300016357|Ga0182032_10857814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 770 | Open in IMG/M |
| 3300017659|Ga0134083_10398373 | Not Available | 600 | Open in IMG/M |
| 3300017792|Ga0163161_10701343 | Not Available | 843 | Open in IMG/M |
| 3300019361|Ga0173482_10462349 | Not Available | 606 | Open in IMG/M |
| 3300021560|Ga0126371_12412081 | Not Available | 636 | Open in IMG/M |
| 3300024290|Ga0247667_1110987 | Not Available | 505 | Open in IMG/M |
| 3300025898|Ga0207692_10302817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 973 | Open in IMG/M |
| 3300025898|Ga0207692_10727482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 645 | Open in IMG/M |
| 3300025901|Ga0207688_10267582 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300025912|Ga0207707_10382799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1209 | Open in IMG/M |
| 3300025912|Ga0207707_10653491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 886 | Open in IMG/M |
| 3300025913|Ga0207695_11036280 | Not Available | 700 | Open in IMG/M |
| 3300025924|Ga0207694_10536724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 981 | Open in IMG/M |
| 3300025924|Ga0207694_10876681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 759 | Open in IMG/M |
| 3300025924|Ga0207694_11130985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
| 3300025927|Ga0207687_10495001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1020 | Open in IMG/M |
| 3300025927|Ga0207687_11391591 | Not Available | 603 | Open in IMG/M |
| 3300025932|Ga0207690_10479581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1004 | Open in IMG/M |
| 3300025935|Ga0207709_11816045 | Not Available | 507 | Open in IMG/M |
| 3300025936|Ga0207670_10810487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 780 | Open in IMG/M |
| 3300025939|Ga0207665_10517889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 923 | Open in IMG/M |
| 3300025961|Ga0207712_10085147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2312 | Open in IMG/M |
| 3300026121|Ga0207683_10229877 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
| 3300028718|Ga0307307_10196505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 638 | Open in IMG/M |
| 3300028784|Ga0307282_10009189 | All Organisms → cellular organisms → Bacteria | 3935 | Open in IMG/M |
| 3300028807|Ga0307305_10494875 | Not Available | 548 | Open in IMG/M |
| 3300028819|Ga0307296_10825271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 505 | Open in IMG/M |
| 3300028828|Ga0307312_10230242 | Not Available | 1195 | Open in IMG/M |
| 3300028828|Ga0307312_10328599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 998 | Open in IMG/M |
| 3300028828|Ga0307312_11003206 | Not Available | 553 | Open in IMG/M |
| 3300031545|Ga0318541_10123665 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300032063|Ga0318504_10084083 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300032174|Ga0307470_10693134 | Not Available | 775 | Open in IMG/M |
| 3300032174|Ga0307470_11164758 | Not Available | 624 | Open in IMG/M |
| 3300032180|Ga0307471_101356586 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 7.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 7.02% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.75% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062594_1014492072 | 3300005093 | Soil | RAKEVAMTRRIRLWAAAVLIAAASGLMAAVAVTATTGVNHTPAHAYLAGIVFNAID* |
| Ga0066388_1030194862 | 3300005332 | Tropical Forest Soil | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHPPAHAYLAGIVFNALD* |
| Ga0068869_1014302751 | 3300005334 | Miscanthus Rhizosphere | MTRRLRLWVAAVLIAAASGLMAAAAVTATTGVTHTPAHVYLAGITFNGLD* |
| Ga0070691_102220351 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | KEVAMTRRLRLWVAAVLIAAASGLMAAAAVTATTGVTHTPAHVYLAGITFNGLD* |
| Ga0070691_102220352 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRLRLWVAAVLIAAASGLMAALAVTATTGVTHTPAHVYLAGLSFNALD* |
| Ga0070675_1008036852 | 3300005354 | Miscanthus Rhizosphere | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHVYLAGIVFNAID* |
| Ga0070659_1002697152 | 3300005366 | Corn Rhizosphere | MTRRLRLWVAAVLIAAASGLMAAAAVTATTGVTHTPAHVYLAGLSFNALD* |
| Ga0070709_103139011 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRIRLWAAAVLIAAASGLMAAVAVTATTGVNHTPAHAYLAGIVFNAID* |
| Ga0070711_1019447231 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRLRLWVAAVLIAAASGLMAAVAATATTGVTHTPAHVYLAGITFNG |
| Ga0070686_1010582041 | 3300005544 | Switchgrass Rhizosphere | AAVLIAAASGLMAAVAVTATTGVNHTPAHAYLAGLSFNALD* |
| Ga0070695_1000537901 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | TRRVRLWVAAVLIAAASGLTAAMAVTATTGVNHTPAHVHLAGIILNALD* |
| Ga0068855_1017736271 | 3300005563 | Corn Rhizosphere | MTRRLRLWVAAVLIAAASGLMAAAAVTATTGVNHTPAHVYLAGISLNAID* |
| Ga0068858_1000364085 | 3300005842 | Switchgrass Rhizosphere | MTRRLRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHVHLAGIILNALD* |
| Ga0066656_109185971 | 3300006034 | Soil | MTRRVRLWMAAVLIAAASGLMAAVAVTATTGVNHTPAHAYLAGLSFNGLD* |
| Ga0070716_1006370031 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRLRLWVAAVLIAAASGLMAAAAVTATTGVTHTPAHVYLAGLSFNGLD* |
| Ga0070716_1008211443 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AAASGLMAAVAVTATTGVNHTPAHAYLAGIVFNAID* |
| Ga0097621_1017886872 | 3300006237 | Miscanthus Rhizosphere | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHAYLAGIVFNAID* |
| Ga0074047_120553672 | 3300006576 | Soil | VLGLMAAVAVTATTGVNHTPAYADLAGISFNAID* |
| Ga0074048_100024651 | 3300006581 | Soil | AASGLMAAVAVTATTGVNHTPAYADLAGISFNAID* |
| Ga0079222_117548451 | 3300006755 | Agricultural Soil | MTRRVRLWVAAVLIAAASGLMAAVAITATTGVDHTPAHVYLAGLSFNALD* |
| Ga0066665_112565971 | 3300006796 | Soil | MTRRVRLWVAAVLIAAASGLMAAVAVTATTSVNHTPAHVYLAGIALNGLD* |
| Ga0066659_110421561 | 3300006797 | Soil | MTRRLRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHVYLAGIAFNALD* |
| Ga0066660_108407592 | 3300006800 | Soil | MTRRLRLWVAAVLIAAASGLMAAVAITATTGVNHTPAHVYLAGIAFNALD* |
| Ga0075434_1012666582 | 3300006871 | Populus Rhizosphere | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHAPAHVYLAGIVFNAID* |
| Ga0075424_1015469961 | 3300006904 | Populus Rhizosphere | CTGDRAKEVAMTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHAPAHVYLAGIVFNAID |
| Ga0066710_1032765561 | 3300009012 | Grasslands Soil | MTRRLRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHGYLAG |
| Ga0066710_1039106131 | 3300009012 | Grasslands Soil | MTRRVRLWMAAVLIAAASGLMAAVAVTATTSVNHTPAHVYLAGIALNGLN |
| Ga0105240_108358441 | 3300009093 | Corn Rhizosphere | VVAAVLIAAASGLMAAVAVTATTGVNHTPAHAYLAGLSFNALD* |
| Ga0105245_101359271 | 3300009098 | Miscanthus Rhizosphere | ASGLMAALAVTATTGVTHTPAHVYLAGLSFNALD* |
| Ga0105247_104441242 | 3300009101 | Switchgrass Rhizosphere | MTRRLRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHVYLAGIVFNAID* |
| Ga0105242_114153252 | 3300009176 | Miscanthus Rhizosphere | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHVHLAGIILNALD* |
| Ga0105237_122464031 | 3300009545 | Corn Rhizosphere | SHRAKEVAMTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHAYLAGLSFNALD* |
| Ga0105238_111544301 | 3300009551 | Corn Rhizosphere | MTRRLRLWVAAVLIAAASGLMAAVAVTATTGVTHTPAHVYLAGVSFNGID* |
| Ga0126380_109527921 | 3300010043 | Tropical Forest Soil | MTRRVQLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHAYLAGIAFNALD* |
| Ga0126384_101954312 | 3300010046 | Tropical Forest Soil | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHVYLAGISLNGLD* |
| Ga0126370_111177221 | 3300010358 | Tropical Forest Soil | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHAYLAGIAFNA |
| Ga0126372_109594461 | 3300010360 | Tropical Forest Soil | MTRRVRLWVAAVLIAAASGLMAAVVVTATTGVNHTPAHVYLAGISLNGL |
| Ga0126372_132220271 | 3300010360 | Tropical Forest Soil | MTRRVRLWVAAVLAIAATGLMAALAVTATTGVNHTPAHVYLAGIALNALD* |
| Ga0126378_101920471 | 3300010361 | Tropical Forest Soil | MSVAAVLAIAATGLMVALAVTATTGVNHTPAHVYLAGIALNALD* |
| Ga0126378_105799861 | 3300010361 | Tropical Forest Soil | APEVVMNKGGAMTRRVRLWVATVLAIAATGLMAALAVTATTGVNYTFANVHLAGITFNALD* |
| Ga0126377_125613401 | 3300010362 | Tropical Forest Soil | MTRRVRLWVAAVLIAAASGLMAAAAVTATTGVTHTPAHVYLAGLSFNALD* |
| Ga0134125_103519371 | 3300010371 | Terrestrial Soil | RRSHRAKEVAMTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHVYLAGIVFNAID |
| Ga0134128_105454692 | 3300010373 | Terrestrial Soil | MTRRVRLWVAAVLIAAASGLTAAVAVTATTGVNHTPAHVHLAGIILNALD* |
| Ga0134128_119561471 | 3300010373 | Terrestrial Soil | AAASGLMATLAVTATTGVTHTPAHVYLAGIILNGID* |
| Ga0105239_114959152 | 3300010375 | Corn Rhizosphere | MTRRIRLWAAAVLIAAASGLMAAVAVTATTGVNHTPAHVHLAGIILNALD* |
| Ga0105239_127255821 | 3300010375 | Corn Rhizosphere | MTRRLRLWVAAVLIAAASGLMAAAAVTATTGVNHTPAHVYLAGITFNAID* |
| Ga0134126_113398802 | 3300010396 | Terrestrial Soil | MTRRLRLWVAAVLIAAASGLMATLAVTATTGVTHTPAHVYLAGIILNGID* |
| Ga0134124_101332381 | 3300010397 | Terrestrial Soil | VVAAVLIAAASGLMAAVAVTATTGVNHTRAHAYLAGLSFNALD* |
| Ga0134124_117244592 | 3300010397 | Terrestrial Soil | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHVYLAGIVLNAID* |
| Ga0134127_107438602 | 3300010399 | Terrestrial Soil | VAAVLIAAASGLMAAVAVTATTGVNHTPAHVYLAGIVFNAID* |
| Ga0134121_103044362 | 3300010401 | Terrestrial Soil | MTRRVRLWVAAVLIAAASGLTAAVAITATTGVNHAPAHVHLAGIILNALD* |
| Ga0137364_114274891 | 3300012198 | Vadose Zone Soil | MAAVLIAAASGLMAAVAVTATTGVNHTPAHVYLAGIALNGLD* |
| Ga0137383_100080402 | 3300012199 | Vadose Zone Soil | MTGRVRLWVAAVLIAAASGLMAAVAVTATTGVTHTPAHVYLAGIAFNGID* |
| Ga0137383_100080403 | 3300012199 | Vadose Zone Soil | MRLWVAAVLIAAASGLMAVVAVTATTGVTHTPAHVYVAGISFNAID* |
| Ga0137365_100090147 | 3300012201 | Vadose Zone Soil | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHVYLAGIIFNSID* |
| Ga0137381_101696452 | 3300012207 | Vadose Zone Soil | MTRRLRLWVAAVLIAAASGLMAALAVTATTGVNHTPAHVYLAGIIFNGLD* |
| Ga0137378_113124251 | 3300012210 | Vadose Zone Soil | PDRAKEVAMTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHVYLAGIIFNSID* |
| Ga0137386_106465851 | 3300012351 | Vadose Zone Soil | RKEVAMTRRMRLWVAAVLIAAASGLMAVVAVTATTGVTHTPAHVYVAGISFNAID* |
| Ga0137366_100095021 | 3300012354 | Vadose Zone Soil | AASGLMAAVAVTATTGVNHTPAHVYLAGIIFNSID* |
| Ga0137371_113380641 | 3300012356 | Vadose Zone Soil | AVLFAAASGLMAAGAVTATTGVNHTPAHVYLAGIIFNSID* |
| Ga0137404_100782213 | 3300012929 | Vadose Zone Soil | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHVYLAGLSFNALD* |
| Ga0137404_100782214 | 3300012929 | Vadose Zone Soil | MTRRVRLWVAAVLIAAASGLMAAVAITATTGVNHTPAHVYLAGISFNAID* |
| Ga0137407_102356823 | 3300012930 | Vadose Zone Soil | VAAVLIAAASGLMAAVAVTATTGVNHAPAHVYLAGISLNAID* |
| Ga0164301_100066634 | 3300012960 | Soil | VVAAVLIAAASGLMAAVAITATTGVNYTPAHAYLAGLSFNALD* |
| Ga0157371_104815411 | 3300013102 | Corn Rhizosphere | PACTTVVAAVLIAAASGLMAAVAVTATTGVNHTPAHAYLAGLSFNALD* |
| Ga0157371_111430312 | 3300013102 | Corn Rhizosphere | RAKEVAMTRRIRLWAAAVPIAAASGLMAAVAVTATTGVNHTPAHAYLAGIVFNAID* |
| Ga0157370_101315543 | 3300013104 | Corn Rhizosphere | VVAAVLIAAASGLMAAVAVTATTGVNDTPAHAYLAGVAFNGID* |
| Ga0157370_110420191 | 3300013104 | Corn Rhizosphere | MTRRLRLWVAAVLIAAASGLMAALAVTATTGVTHTPAHVYLAGLSFNGLD* |
| Ga0157369_105007103 | 3300013105 | Corn Rhizosphere | ASGLMAAVAVTATTGVNHTPAHAYLAGLSFNALD* |
| Ga0157374_100595085 | 3300013296 | Miscanthus Rhizosphere | MTRRVRLWVAAVLIAAASGLMAVVAVTATTGVNHTPAHV |
| Ga0157374_103192662 | 3300013296 | Miscanthus Rhizosphere | MTRRLRLWVAAVLIAAASGLMAALAVTATTGVTHTPAPAYLAGLSFNALD* |
| Ga0157378_102607022 | 3300013297 | Miscanthus Rhizosphere | VVAAVLIAAASGLLAAVAVTATTGVNHTPAHAYLAGLSFNALD* |
| Ga0157372_106259521 | 3300013307 | Corn Rhizosphere | MTRRLRLWVAAVLIAAASGLMAAVAVTATTGVTHTPAHVYLAGLSFNALD* |
| Ga0157379_102843102 | 3300014968 | Switchgrass Rhizosphere | VAAVLIAAASGLMAAAAVTATTGVTHTPAHVYLAGITFNGLD* |
| Ga0157379_102843103 | 3300014968 | Switchgrass Rhizosphere | VAAVLIAAASGLMAALAVTATTGVTHTPAHVYLAGLSFNALD* |
| Ga0157379_116346812 | 3300014968 | Switchgrass Rhizosphere | MTRRVRLWAAAVLIAAASGLMAAVAVTATTGVNHTPAHAYLAGIVFNAID* |
| Ga0157376_100309583 | 3300014969 | Miscanthus Rhizosphere | VVAAVLIAAASGLMAAVAVTATTGVNHTLAHAYLAGLSFNALD* |
| Ga0157376_119346851 | 3300014969 | Miscanthus Rhizosphere | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVTHTPAHVYLAGIAFNAID* |
| Ga0137403_101387512 | 3300015264 | Vadose Zone Soil | VAAVLIAAASGLMAAVAVTATTGVNHTPAHVYLAGLSFNALD* |
| Ga0182032_108578142 | 3300016357 | Soil | MTRRVRLWVAAVLAIAATGLMAALAVTATTGVNYTPANAHL |
| Ga0134083_103983732 | 3300017659 | Grasslands Soil | MTRRVRLWAAAVLIAAASGLMAAVAVTATTGVNHTPAHAYLAGISFNGLD |
| Ga0163161_107013431 | 3300017792 | Switchgrass Rhizosphere | MTRRLRLWVAAVLIAAASGLMAAVAVTATTGVTHTPAHVYLAGLSFNALD |
| Ga0173482_104623491 | 3300019361 | Soil | MTRRIRLWAAEVLVIAASGLMAAVAVTATTGVNHTPAHVYLAGISFNGLD |
| Ga0126371_124120812 | 3300021560 | Tropical Forest Soil | MTRRIRLWVAAVLIAAASELIAALAVTATTGVNHTPAHAYLAGIAFNALD |
| Ga0247667_11109871 | 3300024290 | Soil | LIAAASGLMAAVAITATTGVNYTPAHAYLAGLSFNALD |
| Ga0207692_103028173 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VVAAVLIAAASGLMAAVAVTATTGVNHTLAHAYLA |
| Ga0207692_107274822 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RIRLWAAAVLIAAASGLMAAVAVTATTGVNHTPAHAYLAGIVFNAID |
| Ga0207688_102675821 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRLRLWVAAVLIAAASGLMAALAVTATTGVTHTPAHVYLAGLSFNGLD |
| Ga0207707_103827991 | 3300025912 | Corn Rhizosphere | ACTTVVAAVLIAAASGLMAAVAVTATTGVNHTPAHAYLAGLSFNALD |
| Ga0207707_106534912 | 3300025912 | Corn Rhizosphere | MTRRLRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHAYLAGLSFNAL |
| Ga0207695_110362801 | 3300025913 | Corn Rhizosphere | MTRRLRLWVAAVLIAAASGLMAAAAVTATTGVNHTPAHVYLAGITFNAID |
| Ga0207694_105367241 | 3300025924 | Corn Rhizosphere | AASGLMAAVAVTATTGVNHTPAHAYLAGLSFNALD |
| Ga0207694_108766812 | 3300025924 | Corn Rhizosphere | RLRLWVAAVLIAAASGLMAALAVTATTGVTHTPAHVYLAGLSFNALD |
| Ga0207694_111309851 | 3300025924 | Corn Rhizosphere | EVAMTRRIRLWAAAVLIAAASGLMAAVAVTATTGVNHTPAHAYLAGIVFNAID |
| Ga0207687_104950011 | 3300025927 | Miscanthus Rhizosphere | LIEKEAAMTRRLRLWVAAVLIAAASGLMAALAVTATTGVTHTPAHVYLAGLSFNALD |
| Ga0207687_113915911 | 3300025927 | Miscanthus Rhizosphere | MTRRVRLWVAAVLIAAASGLTAAVAVTATTGVNHTPAHVHLAGIILNALD |
| Ga0207690_104795811 | 3300025932 | Corn Rhizosphere | MTRRLRLWVAAVLIAAASGLMAALAVTATTGVTHTPAHVYLAGLSFNALD |
| Ga0207709_118160452 | 3300025935 | Miscanthus Rhizosphere | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHVYLAGIVFNAID |
| Ga0207670_108104872 | 3300025936 | Switchgrass Rhizosphere | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHAYLAGIVFNAID |
| Ga0207665_105178891 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRVRLWVAAVLIAAASGLTAAVAVTATTGVNHTPAHVYLAGIVFNAID |
| Ga0207712_100851471 | 3300025961 | Switchgrass Rhizosphere | WVAAVLIAAASGLMAAVAVTATTGVTHTPAHVYLAGITFNAID |
| Ga0207683_102298772 | 3300026121 | Miscanthus Rhizosphere | MTRRVRLWAAAVLIAAASGLMAAVAVTATTGVNHTPAHVYLAGIVFNAID |
| Ga0307307_101965051 | 3300028718 | Soil | MTRRIRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHVHLAGITFNGID |
| Ga0307282_100091895 | 3300028784 | Soil | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHVHLAGITFNAID |
| Ga0307305_104948751 | 3300028807 | Soil | AASGLMAAVAVTATTGVNHAPAHVYLAGIIFNGLD |
| Ga0307296_108252712 | 3300028819 | Soil | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHVHLAGITFNALD |
| Ga0307312_102302423 | 3300028828 | Soil | MTRRIRLWVAAVLIAAASGLMAAVAVTATTGVNHAPAHAYL |
| Ga0307312_103285993 | 3300028828 | Soil | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHAPAHVYLAGIIFNGLD |
| Ga0307312_110032062 | 3300028828 | Soil | AMTRRIRLWVAAVLIAAASGLMAAVAVTATTGVNHAPAHAYLAGLSFNALD |
| Ga0318541_101236652 | 3300031545 | Soil | MTRRVRLWVAAVLAIAATGLMAALAVTATTGVNYTPANAHLAGITFNAID |
| Ga0318504_100840833 | 3300032063 | Soil | WVAAVLAIAATGLMAALAVTATTGVNYTPANAHLAGITFNAID |
| Ga0307470_106931341 | 3300032174 | Hardwood Forest Soil | LIAAASGLMAAVAVTATTGVNHTPAHVYLAGIVFNAID |
| Ga0307470_111647581 | 3300032174 | Hardwood Forest Soil | MTRRLRLWVPAVLIAAASGLMAAAAVTATTGVTHTPAHVYLAGLSFNGLD |
| Ga0307471_1013565861 | 3300032180 | Hardwood Forest Soil | MTRRVRLWVAAVLIAAASGLMAAVAVTATTGVNHTPAHVHLA |
| ⦗Top⦘ |