| Basic Information | |
|---|---|
| Family ID | F081637 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MKFKLDRIISIATLVASLVAIFLVLKKPAPVAPPQAPA |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 5.26 % |
| % of genes from short scaffolds (< 2000 bps) | 5.26 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (93.860 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.912 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.930 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.404 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.36% β-sheet: 0.00% Coil/Unstructured: 63.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF02637 | GatB_Yqey | 48.25 |
| PF02934 | GatB_N | 17.54 |
| PF01797 | Y1_Tnp | 2.63 |
| PF05163 | DinB | 2.63 |
| PF04413 | Glycos_transf_N | 1.75 |
| PF06026 | Rib_5-P_isom_A | 1.75 |
| PF00069 | Pkinase | 0.88 |
| PF00515 | TPR_1 | 0.88 |
| PF02472 | ExbD | 0.88 |
| PF00005 | ABC_tran | 0.88 |
| PF13103 | TonB_2 | 0.88 |
| PF12867 | DinB_2 | 0.88 |
| PF14534 | DUF4440 | 0.88 |
| PF04191 | PEMT | 0.88 |
| PF01555 | N6_N4_Mtase | 0.88 |
| PF01381 | HTH_3 | 0.88 |
| PF08240 | ADH_N | 0.88 |
| PF02606 | LpxK | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0064 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit | Translation, ribosomal structure and biogenesis [J] | 65.79 |
| COG2511 | Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain | Translation, ribosomal structure and biogenesis [J] | 65.79 |
| COG1610 | Uncharacterized conserved protein YqeY, may have tRNA amino acid amidase activity | General function prediction only [R] | 48.25 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.51 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 2.63 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.63 |
| COG0120 | Ribose 5-phosphate isomerase | Carbohydrate transport and metabolism [G] | 1.75 |
| COG1519 | 3-deoxy-D-manno-octulosonic-acid transferase | Cell wall/membrane/envelope biogenesis [M] | 1.75 |
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.88 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.88 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG1663 | Tetraacyldisaccharide-1-P 4'-kinase (Lipid A 4'-kinase) | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 93.86 % |
| All Organisms | root | All Organisms | 6.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0738231 | All Organisms → cellular organisms → Bacteria | 11349 | Open in IMG/M |
| 3300010398|Ga0126383_10412264 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300012961|Ga0164302_11096083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300020006|Ga0193735_1178125 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300020581|Ga0210399_11223045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300021406|Ga0210386_11258491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300021420|Ga0210394_10721232 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.91% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.02% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.14% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.26% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.39% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.51% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.51% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.51% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.63% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.63% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.75% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.75% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.75% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.88% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.88% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.88% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.88% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.88% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.88% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_07382313 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MKKLKIDRIISIATLLASLVAIILVVKRPAPVAPPQTPT |
| JGI1027J12803_1029161463 | 3300000955 | Soil | PGLVMKLKLDRIISIATLVAALVAIILVLKKPAPVAQPQ |
| JGI12659J15293_100625532 | 3300001546 | Forest Soil | MKKLKLDRIISILTLVASLVAIILVLKKPTPVAQPQA |
| JGI12635J15846_100112379 | 3300001593 | Forest Soil | MKFKLDRIISVATLAASVVAIILVLKKPAPVAQTQAPAAVAA |
| JGI12635J15846_104083991 | 3300001593 | Forest Soil | MKLDRIISIATLAALLVAIVLLVKRTAPVAQAPAAPGTQ |
| JGIcombinedJ26739_1007640091 | 3300002245 | Forest Soil | MKFKLDRIISVATLAASVVAIILVLKKPAPVAQTQAPAAVAAHAQS |
| Ga0062590_1020709091 | 3300004157 | Soil | MKKLKIDRMISVATLLASVVAIFLVLKKPAPVAVAQPPAAIAAHAQ |
| Ga0066388_1022647363 | 3300005332 | Tropical Forest Soil | MKLKMDRIISIATLVASVVAIVLVLKKPAPVTQPQAPTVIVQQAA |
| Ga0066388_1026287762 | 3300005332 | Tropical Forest Soil | MKKWKLDRIISLVTLASSLVAILLVLKKPSPVSQPIPLAV |
| Ga0070731_102158933 | 3300005538 | Surface Soil | MKIKFDRIVSIATLVAALVAIILVLKKPAPVAAPAQAP |
| Ga0075017_1013593531 | 3300006059 | Watersheds | MKLKLDRIISIATLVASLVAIVLVLKKPAPVAHPQPPAAIAE |
| Ga0075014_1005347332 | 3300006174 | Watersheds | MKFKMDRIISIATLVASVVAIVLVLKKPTPVPPPAPTVIVQQAA |
| Ga0070712_1002404151 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFKLDRVISIATLVASLVAVVLVLKKPAPVAHPQA |
| Ga0079219_117809502 | 3300006954 | Agricultural Soil | MKIKLDRIISVATLTASVAALLLVVKRPAPVAEPLPAPAMA |
| Ga0102924_12574861 | 3300007982 | Iron-Sulfur Acid Spring | MKKYKIDRIISIATLLASLVAIVLVLKKPVPVAHPQAPAAIAEHAQ |
| Ga0066710_1005205771 | 3300009012 | Grasslands Soil | VKIKLDRIISIATLCASLIAVFLVLKKPAPVATPQPAAAVAANAQTF |
| Ga0099828_105369851 | 3300009089 | Vadose Zone Soil | MKFKLDRIISIVTLLASLLAIFLVLKKPAPVAQPQA |
| Ga0105247_114388442 | 3300009101 | Switchgrass Rhizosphere | MLKKWKIDRIISIATLLSSVVAIYLVIKRPQPVAQP |
| Ga0116220_105136001 | 3300009525 | Peatlands Soil | MKIKLDRIISIATLVASLGAIVLVLKKPAPVAQPQTPAAIAAN |
| Ga0105237_110134641 | 3300009545 | Corn Rhizosphere | MKKLKIDRMISVATLLASVVAIFLVLKKPAPVAVAQPPA |
| Ga0074044_107255062 | 3300010343 | Bog Forest Soil | MKLKLDRIISIATLFAALVAIILVLKKPAQVAQPQAPATAAPA |
| Ga0136449_1038689201 | 3300010379 | Peatlands Soil | MKKLKLDRIISITTLVASLVAIFLVLKKPAPVAQPLPAAAIAQHAQ |
| Ga0126383_104122644 | 3300010398 | Tropical Forest Soil | MRMKWKIDRIISVTTLVSSVVAIVLVLKKPQPVAVPQSPAAAA |
| Ga0126361_111237082 | 3300010876 | Boreal Forest Soil | MKKFKIDRIISITTLVASLIAIILVLKKPAPVAQSQ |
| Ga0137387_104564732 | 3300012349 | Vadose Zone Soil | MKLGLNRIISILTLLTSLVAIVLLLKKPAPVAQAQAPAAIA |
| Ga0137396_104475184 | 3300012918 | Vadose Zone Soil | MKIKLDRVISIATLTVSVAALVLVLGKPQPVAPPLPPAVM |
| Ga0137410_111716412 | 3300012944 | Vadose Zone Soil | MKLRLDRIISITTLVAALVAIILVLKKPAPVAQPQAPAVI |
| Ga0164302_110960832 | 3300012961 | Soil | MKMKLDRIISIATLLAAVVAIFLGLKKPAPVPAPQAPATAAER |
| Ga0164306_105854812 | 3300012988 | Soil | MKMKLDRIISIATLLAAVVAIFLVLKKPAPVPAPQAPATAAE |
| Ga0181537_100460291 | 3300014201 | Bog | MKLKLDRIISIATLFAALLAIFLVLKRPTPVVVQAPAAIAAPAPAQSS |
| Ga0181519_110511182 | 3300014658 | Bog | MKKLKLDRIISILTLGASLVAIILVLRKPTPVAQPQAPAA |
| Ga0132258_102933895 | 3300015371 | Arabidopsis Rhizosphere | MKIKIDRVISIATLTVSVAALVLVLRKPQSVAPALPPAE |
| Ga0132257_1007603851 | 3300015373 | Arabidopsis Rhizosphere | MAMKIKIDRVISIATLTVSVVAVVLVLRKPQPVVSA |
| Ga0182034_117763011 | 3300016371 | Soil | MKLKLDRVISIATLVASVTALLLVLRKPQPVAPPMPPAAV |
| Ga0187802_104448361 | 3300017822 | Freshwater Sediment | MNLDLKKWKIDRIISIATLLSSVIAIVLVLKKPAPVA |
| Ga0187818_100041211 | 3300017823 | Freshwater Sediment | MEGMKLKVDRIIGVATLLASLIALVLVLKKPAPVGHPQAPAAI |
| Ga0187814_102421992 | 3300017932 | Freshwater Sediment | MKFKLDRIISIATLVSSLVAIVLVLKRPAPVAQRQAPAAIAQHA |
| Ga0187848_102343071 | 3300017935 | Peatland | MKLKLDRIISIATLFAAVAAIVLVLKKPATVVQPQGPASAGHA |
| Ga0187821_100198921 | 3300017936 | Freshwater Sediment | MNLDLKKWKIDRIISIATLLSSVIAIVLVLKKPAP |
| Ga0187808_101297601 | 3300017942 | Freshwater Sediment | MKSKLDRIISIATLVAALMAIILVLKRPAPVAQPQAPAAIV |
| Ga0187776_112702412 | 3300017966 | Tropical Peatland | MKKWKLDRIISIATLVSSLVAIYLVLKKPQPVAAPMPAAVAAA |
| Ga0187783_101006911 | 3300017970 | Tropical Peatland | MKVKLDRIISLATLLASVVAILLVVKRPAPVAQPPG |
| Ga0187780_103070141 | 3300017973 | Tropical Peatland | MELKPKRIISIITLVASLAGLFLVLKKPTPVAQHQAPA |
| Ga0187804_101894281 | 3300018006 | Freshwater Sediment | MKFKLDRIISIATLVASLVAIFLVLKKPAPVAPPQAPA |
| Ga0187810_102491922 | 3300018012 | Freshwater Sediment | MKLKMDRIISIATLAASLVAIFLVLKKPAPVAQPQTSPAVA |
| Ga0187871_107336752 | 3300018042 | Peatland | MKITLDRIISMATLVASLVAIFLVLKKPAPVAQPQTPSAIAANLAHTTS |
| Ga0187871_108748831 | 3300018042 | Peatland | MKLKLDRIISIATLFAAVVAIVLVLKKPATVVQPQGPASAGHAQSLD |
| Ga0187859_103016591 | 3300018047 | Peatland | MKIKLDRVISIATLVASLGAIVLVLKKPTPVAQPQTPA |
| Ga0187784_109864671 | 3300018062 | Tropical Peatland | MKLDRIISIATLLAATAAIFLVLRKPAPVAAPTAAA |
| Ga0187773_102743181 | 3300018064 | Tropical Peatland | MKIKLDRVISVATLAASLTAIVLVMKRPSPVAPPMPPAAVAANAQS |
| Ga0187772_110793122 | 3300018085 | Tropical Peatland | MKLKLDRIISIATLIALGVAIALVLKRPATVAQPQPQVVVVDRS |
| Ga0187769_112717941 | 3300018086 | Tropical Peatland | MKKLRLDRIISIATLVASLVAIVLVLKRPAPVAQPQTPAAIAEH |
| Ga0187771_112557371 | 3300018088 | Tropical Peatland | MKKLKIDRIISIATLVASLVAIVLVLKKPAPVAQP |
| Ga0187770_114779421 | 3300018090 | Tropical Peatland | MKFKWDRIISLATLVTSVVALILVLKKPQPIAAPQSPAAV |
| Ga0193735_11781251 | 3300020006 | Soil | MKIKLDRIISVATLAASVTAIVLVLKRPQSVAPATPPPAAVAANAQ |
| Ga0210407_106617062 | 3300020579 | Soil | MKFKLDRMISLATLVASLLAILLVLKKPAPVAHSQPP |
| Ga0210403_107024381 | 3300020580 | Soil | MKWKIDRIISVATLAASLIAIFLVLKKPQPVAPVQ |
| Ga0210399_112230451 | 3300020581 | Soil | MKWKWDRIISVATLVTSLLALCLVLKKPAPVAQPQAPA |
| Ga0210395_111020502 | 3300020582 | Soil | MKLKIDRIISIATLLLSLVAVVLVLKKPAPVAHPQAA |
| Ga0210406_113854681 | 3300021168 | Soil | MKKFKIDRIISIATLVASLIAIILVLKKPAPVAQSQAP |
| Ga0210397_113165111 | 3300021403 | Soil | MKLKLDRIISIATLIAALVAIFLVLKKPAPVAQPQAPAAVAEHAQSF |
| Ga0210389_110076361 | 3300021404 | Soil | MKLKLDRVISIATLLTSLTALFLVMKKPSPVAPQPRVP |
| Ga0210386_112584912 | 3300021406 | Soil | MKIGNVKVDRIISIATLLTSVVALVLVLKKPAPVAQPMPAAAAAQKAQ |
| Ga0210383_107294961 | 3300021407 | Soil | MKKFKIDRIISIATLVASLVAIFLVLKKPAPVARPQAPAAI |
| Ga0210383_108743711 | 3300021407 | Soil | MKLKLDRIISIATLLASVIAIVLVLKKPAPVGPPQTPAAIAA |
| Ga0210383_113345291 | 3300021407 | Soil | MKKLKLDRIISILTLVASLVAIILVLKKPTPVAQPQAPAA |
| Ga0210394_107212322 | 3300021420 | Soil | MKIKIDRIISIATLTTAVVALILVLKKPTPVAAPLPAPAV |
| Ga0210410_103154491 | 3300021479 | Soil | MKLKLDRIISIATLVASLIAIYLVLKKPAPVAQPQAAAKVEANA |
| Ga0210409_102097381 | 3300021559 | Soil | MTLKLDRIISIATLVVLVVAVVLLVKRPAPVAQEAK |
| Ga0212123_101649902 | 3300022557 | Iron-Sulfur Acid Spring | MKKYKIDRIISIATLLASLVAIVLVLKKPVPVAHPQAPAAI |
| Ga0242671_10934781 | 3300022714 | Soil | MKWKLDRIISVATLVTSVAALVLVLKKPAPVAPAQ |
| Ga0224544_10378242 | 3300023250 | Soil | MKLKLDRIISIATLVALLVAIVLLLKKPAPVAQPPQAPAAAN |
| Ga0224572_10245621 | 3300024225 | Rhizosphere | MKFKLDRVISVATLTASVIAIILVLRKPAPVAPTQAPAAV |
| Ga0224572_11092542 | 3300024225 | Rhizosphere | MKIKLDRIISIATLVAAVVAIVLVLKKPTPVAQSPQVPAGIAA |
| Ga0207416_10859511 | 3300025134 | Iron-Sulfur Acid Spring | MKKYKIDRIISIATLLASLVAIVLVLKKPVPVAHPQAPA |
| Ga0208194_10002881 | 3300025412 | Peatland | MKFKLDRIISIATLVVALLALVLVLKKPAPVAQPQTPAA |
| Ga0207700_118130242 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKKLKIDRIISIATLIASLIAIVLVLKKPAPVAQPQPAAAIAHRF |
| Ga0208415_10264701 | 3300025993 | Rice Paddy Soil | MKKLKIDRIISIATLLASVLAIVLVLKKPAPVTVPQPPAAIAAHAQ |
| Ga0209056_105580482 | 3300026538 | Soil | MKKFKLDRVISIATLVASVIAIFLVLKKPAPVSVPHAPAAVA |
| Ga0209732_10891462 | 3300027117 | Forest Soil | MKPKLDRIISIATLLAAVTAIVLVLKRPAPVVVHQAPTAVPA |
| Ga0209529_10842161 | 3300027334 | Forest Soil | MKIRLDRIISIATLVASLGAVVLVLKKPAPVAQPQTPAAIAA |
| Ga0209219_11011741 | 3300027565 | Forest Soil | MKFKLDRIISIATLVASLVAIILVLKKPAPVAQSQPPAAIAQ |
| Ga0208827_11893042 | 3300027641 | Peatlands Soil | MKWKIDRIISVATLAASLIAIFLVLKKPQPVAPVQSPA |
| Ga0209009_11799301 | 3300027667 | Forest Soil | MKIKLDRIISIATLAASLVAIILVLKKPAPVAQPQPP |
| Ga0209448_101981061 | 3300027783 | Bog Forest Soil | MKFKLDRILSIATLVASLVAIILVLKKPAPVAQPQAPAVIAEHAQ |
| Ga0209167_100087384 | 3300027867 | Surface Soil | MKLKLDRIISVATLGASLVAVILVLKKPTPVAQPQAPA |
| Ga0209579_101407351 | 3300027869 | Surface Soil | MKIKFDRIVSIATLVAALVAIILVLKKPAPVAAPAQAPAA |
| Ga0209169_103468551 | 3300027879 | Soil | MKWKIDRIISVATLAASLIAIFLVLKKPQPVAPVQS |
| Ga0265353_10217271 | 3300028015 | Soil | MKIKLDRIISIATLVASLGAIVLVLKKPAPVAPPQTPSAIAAHA |
| Ga0302147_103191932 | 3300028566 | Bog | MKLDRIISIATLAALLVAIVLLVKKPAAVVPLPQATTGNAANA |
| Ga0302218_100065671 | 3300028863 | Palsa | MKIKLDRIISIATLAAALVAIVLVLKKPAPVAELPRPSPG |
| Ga0302218_101093612 | 3300028863 | Palsa | MKIKLDRIISIATLVASLGAVVLVLRKPAPVAHPQTP |
| Ga0308309_109290572 | 3300028906 | Soil | MKKFKIDRIISIATLIASLAAIILVMKKPAPVAPRQAPAAIEQ |
| Ga0222749_104988572 | 3300029636 | Soil | MKKLKLDRIISIATLVASLVAIVLVLKKPAPVAHPLAPAAI |
| Ga0311368_105735401 | 3300029882 | Palsa | MKIKLDRIISIATLVASLGAVVLVLRKPAPVAHPQTPAAVA |
| Ga0311368_107986071 | 3300029882 | Palsa | MKFKLDRIISVATLVASLIAIILVLKKPAPVAQPQAPAAVAAHAQSF |
| Ga0302304_101899261 | 3300029993 | Palsa | MKIKLDRIISIATLAAALVAIVLVLKKPAPVAELPRPSPGIAANGQSSNG |
| Ga0302275_102535811 | 3300030518 | Bog | MKPTLDRIISVATLVALLVAIGLMLKKQPPVAQPAQVPAGVA |
| Ga0311357_101757961 | 3300030524 | Palsa | MKIKLDRIISIATLAAALVAIVLVLKKPAPVAELPRPSPGTAANGQSS |
| Ga0316363_100364655 | 3300030659 | Peatlands Soil | MKWKIDRIISVATLAASLIAIFLVLKKPQPVAPVQSP |
| Ga0307497_105332562 | 3300031226 | Soil | MKIKLDRVISIATLTASVAALVLVLRKPQPVAPALPPAAI |
| Ga0310686_1052389461 | 3300031708 | Soil | MKLKLDRIISIATLFAALLAIVLVLKRPTPMVQVQAPAATADHA |
| Ga0310686_1099827982 | 3300031708 | Soil | MKLKLDRIISLATLVASVLAIVLVLKRPAPVAQPQTP |
| Ga0307477_107837551 | 3300031753 | Hardwood Forest Soil | MKLKLDRVISIATLLASLTALFLVMKKPSSVAPPR |
| Ga0307475_102390281 | 3300031754 | Hardwood Forest Soil | MKFKLDRIISIATLVASLVAIILVLKKPAPVAQPHTPAAIAE |
| Ga0307478_111495941 | 3300031823 | Hardwood Forest Soil | MKLKLDRIISVATLAASLVAIILVLKKPAPVAQAQPAA |
| Ga0310917_104286311 | 3300031833 | Soil | MKLKLDRVISIATLVASVTALLLVLRKPQPVAPPMPP |
| Ga0307479_100466391 | 3300031962 | Hardwood Forest Soil | MKFKLDRIISLATLVASLVAIVLVLKRPAPVAQRQA |
| Ga0307479_111753632 | 3300031962 | Hardwood Forest Soil | MKFKLDRIISIATLVASLVAIVLVLKRPAPVAQRQAP |
| Ga0306924_104587223 | 3300032076 | Soil | MKKWKLDRIISLATLVSSIIAIILVLKKPQPVSQPM |
| Ga0306920_1024816221 | 3300032261 | Soil | MKLKLNRIISIGTLLASLIAVVLVLKKPAPVGRSLAPASIAVDA |
| Ga0335076_108670912 | 3300032955 | Soil | MKKYHIDRIISITTLIASLVAIVLVLKRPSQVAQPQAPA |
| Ga0371490_10952661 | 3300033561 | Peat Soil | MKLTLDRIISIATLVAAVAAIVLVLKKPAPLAQAPQAPAGIAANAQSS |
| Ga0370514_031721_1_129 | 3300034199 | Untreated Peat Soil | MLEIFMKLDRVISIATLAALIVAIVLLLKKPAAVVQLPQATTG |
| ⦗Top⦘ |