| Basic Information | |
|---|---|
| Family ID | F081598 |
| Family Type | Metagenome |
| Number of Sequences | 114 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MESFRELMEIIGTAVDGVGVFIVAAGAVVATARLLVRR |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 26.55 % |
| % of genes near scaffold ends (potentially truncated) | 98.25 % |
| % of genes from short scaffolds (< 2000 bps) | 91.23 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.246 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (21.930 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.719 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.649 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF01648 | ACPS | 41.23 |
| PF03740 | PdxJ | 15.79 |
| PF05050 | Methyltransf_21 | 11.40 |
| PF13383 | Methyltransf_22 | 4.39 |
| PF07784 | DUF1622 | 1.75 |
| PF00654 | Voltage_CLC | 0.88 |
| PF07992 | Pyr_redox_2 | 0.88 |
| PF13432 | TPR_16 | 0.88 |
| PF09335 | SNARE_assoc | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0854 | Pyridoxine 5'-phosphate synthase PdxJ | Coenzyme transport and metabolism [H] | 15.79 |
| COG4828 | Uncharacterized membrane protein | Function unknown [S] | 1.75 |
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.88 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.88 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.25 % |
| Unclassified | root | N/A | 1.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459009|GA8DASG02G1O55 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 505 | Open in IMG/M |
| 2170459012|GOYVCMS02FQYQ8 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 521 | Open in IMG/M |
| 2170459013|GO6OHWN01AT7AO | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 529 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10083816 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 679 | Open in IMG/M |
| 3300000891|JGI10214J12806_10475340 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300000956|JGI10216J12902_102175401 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 826 | Open in IMG/M |
| 3300000956|JGI10216J12902_105667339 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 867 | Open in IMG/M |
| 3300005171|Ga0066677_10014572 | All Organisms → cellular organisms → Bacteria | 3500 | Open in IMG/M |
| 3300005178|Ga0066688_10251918 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300005180|Ga0066685_10180052 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300005187|Ga0066675_10582811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 840 | Open in IMG/M |
| 3300005290|Ga0065712_10671547 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005336|Ga0070680_100688453 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300005445|Ga0070708_101405343 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 651 | Open in IMG/M |
| 3300005451|Ga0066681_10756533 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 589 | Open in IMG/M |
| 3300005467|Ga0070706_101978648 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 528 | Open in IMG/M |
| 3300005540|Ga0066697_10145183 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300005540|Ga0066697_10645578 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005545|Ga0070695_100581407 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300005555|Ga0066692_10489088 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300005557|Ga0066704_10430050 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300005559|Ga0066700_10680112 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005574|Ga0066694_10440039 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 610 | Open in IMG/M |
| 3300005576|Ga0066708_10492280 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300005587|Ga0066654_10818908 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005598|Ga0066706_10739169 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300005764|Ga0066903_100278119 | All Organisms → cellular organisms → Bacteria | 2621 | Open in IMG/M |
| 3300006046|Ga0066652_101332644 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 675 | Open in IMG/M |
| 3300006175|Ga0070712_101265211 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300006800|Ga0066660_10873001 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 733 | Open in IMG/M |
| 3300007258|Ga0099793_10473314 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 621 | Open in IMG/M |
| 3300009012|Ga0066710_102266691 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 791 | Open in IMG/M |
| 3300009012|Ga0066710_102336969 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 777 | Open in IMG/M |
| 3300009137|Ga0066709_103212598 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 596 | Open in IMG/M |
| 3300009147|Ga0114129_11238377 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 928 | Open in IMG/M |
| 3300009162|Ga0075423_11729254 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 674 | Open in IMG/M |
| 3300010038|Ga0126315_10010518 | All Organisms → cellular organisms → Bacteria | 4366 | Open in IMG/M |
| 3300010043|Ga0126380_11861891 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300010323|Ga0134086_10058289 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1319 | Open in IMG/M |
| 3300010358|Ga0126370_12335839 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 530 | Open in IMG/M |
| 3300010360|Ga0126372_10888367 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 892 | Open in IMG/M |
| 3300010360|Ga0126372_12854738 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300010364|Ga0134066_10024451 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1373 | Open in IMG/M |
| 3300010366|Ga0126379_10419812 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1391 | Open in IMG/M |
| 3300011003|Ga0138514_100019620 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300012208|Ga0137376_11051490 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 697 | Open in IMG/M |
| 3300012208|Ga0137376_11407693 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300012209|Ga0137379_11093748 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 703 | Open in IMG/M |
| 3300012210|Ga0137378_10067575 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3240 | Open in IMG/M |
| 3300012351|Ga0137386_11023492 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 587 | Open in IMG/M |
| 3300012354|Ga0137366_10641919 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 759 | Open in IMG/M |
| 3300012354|Ga0137366_11033876 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 569 | Open in IMG/M |
| 3300012356|Ga0137371_11440137 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 3300012359|Ga0137385_11392144 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 565 | Open in IMG/M |
| 3300012361|Ga0137360_10004218 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 8707 | Open in IMG/M |
| 3300012361|Ga0137360_11622177 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 552 | Open in IMG/M |
| 3300012362|Ga0137361_10273180 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1544 | Open in IMG/M |
| 3300012685|Ga0137397_10087712 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2268 | Open in IMG/M |
| 3300012922|Ga0137394_10962460 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 710 | Open in IMG/M |
| 3300012929|Ga0137404_11155082 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 711 | Open in IMG/M |
| 3300012955|Ga0164298_11237227 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 568 | Open in IMG/M |
| 3300012957|Ga0164303_10604752 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 722 | Open in IMG/M |
| 3300012960|Ga0164301_11136729 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 623 | Open in IMG/M |
| 3300012977|Ga0134087_10618349 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 563 | Open in IMG/M |
| 3300012984|Ga0164309_10401261 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1023 | Open in IMG/M |
| 3300014157|Ga0134078_10050209 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1441 | Open in IMG/M |
| 3300015245|Ga0137409_10999407 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 674 | Open in IMG/M |
| 3300015357|Ga0134072_10095235 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 907 | Open in IMG/M |
| 3300015358|Ga0134089_10088178 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1177 | Open in IMG/M |
| 3300015371|Ga0132258_11597099 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1646 | Open in IMG/M |
| 3300015372|Ga0132256_100105049 | All Organisms → cellular organisms → Bacteria | 2758 | Open in IMG/M |
| 3300015372|Ga0132256_102034434 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 680 | Open in IMG/M |
| 3300016387|Ga0182040_10553709 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 926 | Open in IMG/M |
| 3300016404|Ga0182037_10858167 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 785 | Open in IMG/M |
| 3300017654|Ga0134069_1195209 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 689 | Open in IMG/M |
| 3300018027|Ga0184605_10251145 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 804 | Open in IMG/M |
| 3300018028|Ga0184608_10487013 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 528 | Open in IMG/M |
| 3300018051|Ga0184620_10019553 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
| 3300018054|Ga0184621_10298648 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 568 | Open in IMG/M |
| 3300018071|Ga0184618_10400592 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300018076|Ga0184609_10255793 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 819 | Open in IMG/M |
| 3300018076|Ga0184609_10313600 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 733 | Open in IMG/M |
| 3300018433|Ga0066667_10191832 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1492 | Open in IMG/M |
| 3300018433|Ga0066667_10477358 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1023 | Open in IMG/M |
| 3300018433|Ga0066667_11028450 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 711 | Open in IMG/M |
| 3300018433|Ga0066667_11982724 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 534 | Open in IMG/M |
| 3300018482|Ga0066669_10279305 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1341 | Open in IMG/M |
| 3300019789|Ga0137408_1255794 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 726 | Open in IMG/M |
| 3300019881|Ga0193707_1103250 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 849 | Open in IMG/M |
| 3300020002|Ga0193730_1056996 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300020022|Ga0193733_1044132 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300021080|Ga0210382_10076473 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1364 | Open in IMG/M |
| 3300021478|Ga0210402_10980514 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 772 | Open in IMG/M |
| 3300022694|Ga0222623_10184200 | Not Available | 811 | Open in IMG/M |
| 3300022694|Ga0222623_10197703 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 780 | Open in IMG/M |
| 3300025315|Ga0207697_10036019 | All Organisms → cellular organisms → Bacteria | 2026 | Open in IMG/M |
| 3300025931|Ga0207644_11564638 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 553 | Open in IMG/M |
| 3300026308|Ga0209265_1017750 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300026309|Ga0209055_1068842 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1481 | Open in IMG/M |
| 3300026323|Ga0209472_1312635 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 504 | Open in IMG/M |
| 3300026324|Ga0209470_1280921 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 636 | Open in IMG/M |
| 3300026329|Ga0209375_1301717 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 523 | Open in IMG/M |
| 3300026523|Ga0209808_1076547 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1451 | Open in IMG/M |
| 3300026536|Ga0209058_1168679 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 988 | Open in IMG/M |
| 3300026551|Ga0209648_10141933 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1909 | Open in IMG/M |
| 3300028379|Ga0268266_10351566 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300028708|Ga0307295_10015158 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1851 | Open in IMG/M |
| 3300028768|Ga0307280_10230682 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 661 | Open in IMG/M |
| 3300028793|Ga0307299_10135064 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 926 | Open in IMG/M |
| 3300028799|Ga0307284_10262064 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 689 | Open in IMG/M |
| 3300028884|Ga0307308_10549700 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300032261|Ga0306920_101652758 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 909 | Open in IMG/M |
| 3300032261|Ga0306920_102491045 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 712 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.77% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.14% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.51% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 2.63% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.75% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.88% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.88% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.88% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F47_09674840 | 2170459009 | Grass Soil | MEYFRQIMEVVGTSVDGVGVFIVAAGMLVATVRLVSR |
| N56_09044260 | 2170459012 | Grass Soil | MEIVGTAVDGVGVFIVAAGALVATARLLIRLAHKTGNYYSSY |
| N57_08241530 | 2170459013 | Grass Soil | MFMENFRWLMEIVGTAVDGVGVFIVAAGALVATARLLVRRAH |
| AF_2010_repII_A001DRAFT_100838162 | 3300000793 | Forest Soil | MEIIGTAVDGVGVFIVAAGALVATARLLVHRAHNTGNYYASYRQ |
| JGI10214J12806_104753403 | 3300000891 | Soil | MEYFRHIMEVVGTSVDGVGVFIVAAGMVAATIRLVLR |
| JGI10216J12902_1021754012 | 3300000956 | Soil | MNAAMEYFRHMMEVVGTSVDGVGVFIVAAGMVAATI |
| JGI10216J12902_1056673391 | 3300000956 | Soil | MNAAMEYYRHIMDVVGTAVDGVGVFIVVGGALVATGR |
| Ga0066677_100145726 | 3300005171 | Soil | MERFRQVMEIVGTAVDGVGVFIVAAGALVATAHLVVRRAHNAGNYYS |
| Ga0066688_102519181 | 3300005178 | Soil | MESFRWIMDIVGTSVDGVGVFIVVGGALFATVRLAFRHMQ |
| Ga0066685_101800523 | 3300005180 | Soil | MKMTMEYYRQIMDVVGTSVDGIGVFIVVGGALVATLRLAL |
| Ga0066675_105828111 | 3300005187 | Soil | MENFRYLMEIIGTAVDGVGVCIVAAGAIVATARLLVRRAHNIGNY |
| Ga0065712_106715471 | 3300005290 | Miscanthus Rhizosphere | MNAGMEYFRHIMEVVGTSVDGVGVFIVAAGMVVATVRLAS |
| Ga0070680_1006884532 | 3300005336 | Corn Rhizosphere | MEIVGTAVDGVGVFIVAVGALVATARLLIRLAHKTGSYYSSYR |
| Ga0070708_1014053432 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MESFRRIMDIIGTSVDGVGVCIVAGGAIVATARLIVRRMQRTG |
| Ga0066681_107565331 | 3300005451 | Soil | MNAGMEYFRHIMEVVGTSVDGVGVFIVAGGAIVATMRLVVF |
| Ga0070706_1019786481 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MEYFRHIMEIVGTSVDGVGVFIVAGGMLVATARLVSRLRDRAH |
| Ga0066697_101451833 | 3300005540 | Soil | MSLRVTPTDMTMEYYRQIMDVVGTSVDGIGVFIVVGGALV |
| Ga0066697_106455783 | 3300005540 | Soil | MEIVGTAVDGVGVFIVAAGAVVATARLLVRRAHNTGNYYSSY |
| Ga0070695_1005814071 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSMEYYRYIMDVVGTSVDAIGVFIVVGGALVATARLAIHRAQST |
| Ga0066692_104890883 | 3300005555 | Soil | MEVIGTAVDGVGVFIVAAGAIVATARLLVRRAHNTGNYYSS |
| Ga0066704_104300501 | 3300005557 | Soil | MTMEHYRQIMDIVGTSVDGVGVFIVVGGALVATARL |
| Ga0066700_106801122 | 3300005559 | Soil | MENFRQIMDIVGTSVDGVGVLIVVGGALFATVRLAVRR |
| Ga0066694_104400392 | 3300005574 | Soil | MEYYRHIMDVVGTSVDGIGVFIVVGGALVATARLVLH |
| Ga0066708_104922801 | 3300005576 | Soil | MENFRELMEIIGTAVDGVGVFIVAAGAVVATARLLI |
| Ga0066654_108189081 | 3300005587 | Soil | MEHYRQIMDIVGTGVDGVGVFIVVGGALVATARLL |
| Ga0066706_107391691 | 3300005598 | Soil | MERFRQVLEIVGTAVDGVGVFIVAAGALVATAHLVVRRAHN |
| Ga0066903_1002781191 | 3300005764 | Tropical Forest Soil | MEYFRHIMEVVGTSVDGVGVFIVAGGMVVATARLAVRRAHDTGNYY |
| Ga0066652_1013326442 | 3300006046 | Soil | MNAAMEYFRNIMEVVGTSVDGVGVFIVAAGMVAATIRLVLRL |
| Ga0070712_1012652111 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MEIVGTAVDAVGVFIVAAGAVVATARLLIHRAHNIGNYYSSYRQDIGRAILL |
| Ga0066660_108730013 | 3300006800 | Soil | MTMEHYRHIMDIVGTGVDGVGVFIVVGGALVATARL |
| Ga0099793_104733142 | 3300007258 | Vadose Zone Soil | MESFRRIMDIVGTTMDGIGVFVVAGGALIATARLA |
| Ga0066710_1022666913 | 3300009012 | Grasslands Soil | MTMEYYRHIMDIVGTGVDGVGVFIVVGGALVATARLVFHR |
| Ga0066710_1023369693 | 3300009012 | Grasslands Soil | MEYYRHIMDIVGTAVDGVGVFIVVGGALVATARLVLHRA |
| Ga0066709_1032125982 | 3300009137 | Grasslands Soil | MNGGMEYFRHIMEVVGTSVDGVGVFIVAVGMVVATVRLATHRSH |
| Ga0114129_112383771 | 3300009147 | Populus Rhizosphere | MEHFRHIMEVVGTSVDGVGVFIVAGGMVVATARLAVRRAHETGNY |
| Ga0075423_117292541 | 3300009162 | Populus Rhizosphere | MEKFREVMEITGTAVDGVGVFIVAAGALVATARLLVRRAHNAGN |
| Ga0126315_100105188 | 3300010038 | Serpentine Soil | MESFRQIMDIVGTSVDGVGVLIVVGGAIVATVRLVRRL |
| Ga0126380_118618911 | 3300010043 | Tropical Forest Soil | MFMENFRQLMEIIGTAVDGVGVFIVAAGALVATARLLVHRTHNTG |
| Ga0134086_100582893 | 3300010323 | Grasslands Soil | MENFRQIMDIVGTSVDGVGVFIVVGGALFATVRLALRRATRRQLLF |
| Ga0126370_123358391 | 3300010358 | Tropical Forest Soil | MEEFRQVMEIVGTAVDGVGVLIVAAGALVATARLLMR |
| Ga0126372_108883673 | 3300010360 | Tropical Forest Soil | MENFRQLMEIIGTAVDAVGVFIVAAGALVATARLLVHRAHNTGDYY |
| Ga0126372_128547381 | 3300010360 | Tropical Forest Soil | MPGFPATKMFMENFRQLMEIIGTAVDGVGVFIVAAGALVATARLLVHRTHN |
| Ga0134066_100244511 | 3300010364 | Grasslands Soil | MERFRQVMEIVGTAVDGVGVFIVAAGALVATAHLVVRR |
| Ga0126379_104198121 | 3300010366 | Tropical Forest Soil | MEQFRRIMDIVGTSVDGVGVFIVVGGALVATARLAVRRVHNA |
| Ga0138514_1000196201 | 3300011003 | Soil | MTAGMESFRHIMAIIVTSVDGVGVFIVAGGMVVATCNNEY |
| Ga0137376_110514901 | 3300012208 | Vadose Zone Soil | MNGAMEYFRHIMEVVGTSVDGVGVFIVAVGMVVAT |
| Ga0137376_114076932 | 3300012208 | Vadose Zone Soil | MTMEYFRYIMEIVGTGVDGVGVLIVVSGAIVATARLVLHRMHSTG |
| Ga0137379_110937482 | 3300012209 | Vadose Zone Soil | MESFRQIMDIVGTSVDGVGVLIVVRGALFATVRLAVRRVQK |
| Ga0137378_100675755 | 3300012210 | Vadose Zone Soil | MENFRQIMDIVGTSVDGVGVLIVVGGALFATVRLAVRRV |
| Ga0137386_110234921 | 3300012351 | Vadose Zone Soil | MEYYRHIMDVVGTSVDGIGVFIVVGGALVATARLVLHRAQST |
| Ga0137366_106419192 | 3300012354 | Vadose Zone Soil | MENFRELMEIIGTGIDGVGVFIVAAGAVVATARLLVHRAHNTGNY |
| Ga0137366_110338761 | 3300012354 | Vadose Zone Soil | MESFRQIMDIVGTSVDGVGVLIVVGGALFATVRLAV |
| Ga0137371_114401372 | 3300012356 | Vadose Zone Soil | MESFRRIMDIVGTSVDGVGVCIVVGGAFFATVRLAVRRMH |
| Ga0137385_113921442 | 3300012359 | Vadose Zone Soil | MERFRQVMEIVGTAVDGVGEFIVAAGALVATAHLVVRRAHNAGNYYSS |
| Ga0137360_100042181 | 3300012361 | Vadose Zone Soil | MTMEYFRHIMEIVGTSMDGVGVFVVAGGALVATLRLLVW |
| Ga0137360_116221772 | 3300012361 | Vadose Zone Soil | MNAAMEYFRHIMEVVGTSVDGVGVFIVAGGMMVATLRLATR |
| Ga0137361_102731803 | 3300012362 | Vadose Zone Soil | MENFRQLMEVIGTAIDGVGVFIVAAGALVATARLLVRRAHNVGNYYSSYRQDIGRA |
| Ga0137397_100877121 | 3300012685 | Vadose Zone Soil | MENFRELMEIIGTAIDGVGVFIVAAGAVVATARLMVRR |
| Ga0137394_109624603 | 3300012922 | Vadose Zone Soil | MTLEYFRYIMEIVGTGVDGVGVLIVVSGAIVATARL |
| Ga0137404_111550821 | 3300012929 | Vadose Zone Soil | MESFRELMEIIGTAVDGVGVFIVAAGAVVATARLLVRR |
| Ga0164298_112372271 | 3300012955 | Soil | MFMENFRWLMEIVGTAVDGVGVFIVAAGALVATARLLV |
| Ga0164303_106047521 | 3300012957 | Soil | MFMENFRWLMEIVGTAVDGVGVFIVAAGALVATARL |
| Ga0164301_111367291 | 3300012960 | Soil | MFMENFRWLMEIVGTAVDGVGVFIVAAGALVATAR |
| Ga0134087_106183492 | 3300012977 | Grasslands Soil | MEHYRHIMDIVGTGVDGVGVFIVVGGALVATARLLLHRAQS |
| Ga0164309_104012611 | 3300012984 | Soil | MFMENFRWLMEIVGTAVDGVGVFIVAAGALVATARLL |
| Ga0134078_100502091 | 3300014157 | Grasslands Soil | MDRFREVMEIVGTAVDGVGVFIVAAGAVVATARLVV |
| Ga0137409_109994072 | 3300015245 | Vadose Zone Soil | MNAAMEYFRHIMEVVGTSVDGVGVFIVAGGMIVATLR |
| Ga0134072_100952353 | 3300015357 | Grasslands Soil | MEYYRHIMDIVGTAVDGVGVLIVVGGALVATARLVLHRAQST |
| Ga0134089_100881781 | 3300015358 | Grasslands Soil | MESFRRIMDIIGTGVDGIGVCIVVGGALVATARLMVRRMHSTGN |
| Ga0132258_115970991 | 3300015371 | Arabidopsis Rhizosphere | MEIVGTAVDAVGVFIVAAGALVATARLMVHRAHHTGNYYTSYRQDIGRAI |
| Ga0132256_1001050493 | 3300015372 | Arabidopsis Rhizosphere | MFMENFRLLMEIVGTAVDGVGVFIVAAGALVATARLLVRRA |
| Ga0132256_1020344342 | 3300015372 | Arabidopsis Rhizosphere | MFMENFRQLMEIVGTAVDGVGVFIVAAGALVATARLLVRLAHKTG |
| Ga0182040_105537093 | 3300016387 | Soil | MENFRQLMEIIGTAVDGVGVFIVAAGALVATARLL |
| Ga0182037_108581671 | 3300016404 | Soil | MEIIGTAVDGVGVFIVAAGALVATARLLVRRTHKT |
| Ga0134069_11952092 | 3300017654 | Grasslands Soil | MEVIGTAIDGVGVFIVAAGAIVATARLVVRRAHNTGNY |
| Ga0184605_102511452 | 3300018027 | Groundwater Sediment | MEIIGTAVDGVGVFIVAAGALIATARLLVRLRHNIGNY |
| Ga0184608_104870132 | 3300018028 | Groundwater Sediment | MEQFRHIMEIVGTGMDGVGVFIVAGGALVATWRLLLRRAQR |
| Ga0184620_100195531 | 3300018051 | Groundwater Sediment | MNAAMEYFRHIMEVVGTSVDGVGVFIVAAGMVAATIRLVLRLRDRAH |
| Ga0184621_102986482 | 3300018054 | Groundwater Sediment | MDGVGVFIVAGGALVATARLFVRRAHNTGNYYSSYRQD |
| Ga0184618_104005921 | 3300018071 | Groundwater Sediment | MTMEHFRYIMEIVGTGMDGVGVLIVVSGAIVATARLVLHRMHSTGN |
| Ga0184609_102557931 | 3300018076 | Groundwater Sediment | MEIVGTSMDGVGVFIVAGGALVATARLFVRRAHNTGNYYSS |
| Ga0184609_103136001 | 3300018076 | Groundwater Sediment | MTMEYFRYIMEIVGTGMDGVGVFIVAGGALTATWRLLLWRAH |
| Ga0066667_101918321 | 3300018433 | Grasslands Soil | MESFRRIMDIIGTSVDGVGVCIVVGSALFATVTLA |
| Ga0066667_104773582 | 3300018433 | Grasslands Soil | MEIIGTAVDGVGVFIVAAGAIVATARLLVHRAHNSGNYYSLYR |
| Ga0066667_110284502 | 3300018433 | Grasslands Soil | MDIVGTGVDGVGVFIVVGGALFATARLGLRRMHGAGN |
| Ga0066667_110507503 | 3300018433 | Grasslands Soil | MDIIGTAVDGVGGFIVVGGALVATAGLLLHRAQSTGNYYSPYRQ |
| Ga0066667_119827241 | 3300018433 | Grasslands Soil | MNAAMEYFRHVMEIVGTGVDGIGVFIIAGGMVVATARLAVRRS |
| Ga0066669_102793052 | 3300018482 | Grasslands Soil | MESFRRIMDIIGTSVDGVGVCIVAVGAIVATQRLLIHAT |
| Ga0137408_12557942 | 3300019789 | Vadose Zone Soil | MESFRQIMEIVGTTMDGVGVLVVAGGALVATARLLARRV |
| Ga0193707_11032502 | 3300019881 | Soil | MNAVMEYFRHIMEVVGTSVDGVGVFIVAAGMVAATIR |
| Ga0193730_10569961 | 3300020002 | Soil | TPTDMTMEYFRYIMEIVGTGVDGVGVLIVVSGAIVATARLVL |
| Ga0193733_10441321 | 3300020022 | Soil | MNAVMEYFRHIMEVVGTSVDGVGVFIVAAGMVAATIRLV |
| Ga0210382_100764732 | 3300021080 | Groundwater Sediment | MESFRRIMDLVGTTIDGVGVFIVAGGALVATARLAVRRVRNT |
| Ga0210402_109805141 | 3300021478 | Soil | MNAGMEYFRHIMEVVGTSVDGVGVFIVAAGMLAATIRLALR |
| Ga0222623_101842002 | 3300022694 | Groundwater Sediment | MEIIGTAVDCVGVFIVAAGALVATARLLVRRAHNIGNYYSSY |
| Ga0222623_101977031 | 3300022694 | Groundwater Sediment | MEYYRHIMDIVGTGVDGVGVFIVVGGALVATARLVLHRAQSTGNYY |
| Ga0207697_100360191 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MEIIGTAVDGVGVFIVAAGALVATARLLVRRTHKTGNYYSSY |
| Ga0207644_115646382 | 3300025931 | Switchgrass Rhizosphere | MNGDMEYFRHIMEIVGTSVDGVGVFIVAAGMVVATV |
| Ga0209265_10177501 | 3300026308 | Soil | MDIVGTGVDGVGVFIVVGGALVATARLLLHRAQST |
| Ga0209055_10688423 | 3300026309 | Soil | MEYYRHIMDIVGTAVDGVGVFIVVGGALVATARLVLH |
| Ga0209472_13126352 | 3300026323 | Soil | MNGAMEYFRHIMEVVGTTVDGVGVFIVAGGMVVATVRL |
| Ga0209470_12809211 | 3300026324 | Soil | MENFRELMEIIGTGIDGVGVFIVAAGAVVATARLLV |
| Ga0209375_13017171 | 3300026329 | Soil | MNAGMEYFRHIMEVVGTSVDGVGVFIVAGGAIVATMRLVV |
| Ga0209808_10765473 | 3300026523 | Soil | MERFRQVMEIVGTAVDGVGVFIVAAGALVATAHLVVRRAHNA |
| Ga0209058_11686791 | 3300026536 | Soil | MEYYRQIMDVVGTSVDGIGVFIVVGGALVATARLL |
| Ga0209648_101419331 | 3300026551 | Grasslands Soil | MEIVGTAVDAVGVFIVAAGALVATARLLIHRAHNTGNYYSSF |
| Ga0268266_103515661 | 3300028379 | Switchgrass Rhizosphere | MNAGMEYFRHIMEVVGTSVDGVGVFIVAAGMVVATVRLA |
| Ga0307295_100151581 | 3300028708 | Soil | MEIVGTAVDGVGVFIVAAGAIVATARLLVRRSHNTGNYYSS |
| Ga0307280_102306821 | 3300028768 | Soil | MEIVGTAVDGVGVFIVAAGAIVATARLLVRRSHNT |
| Ga0307299_101350642 | 3300028793 | Soil | MNAPMEYFRHIMEVVGTSVDGVGVFIVAAGMVAATIRLV |
| Ga0307284_102620642 | 3300028799 | Soil | MEIVGTAVDGVGVFIVAAGALVATARLLVRRAHNVGNYYSSFR |
| Ga0307308_105497003 | 3300028884 | Soil | MTMEYFRYIMEIVGTGVDGVGVLIVVSGAIVATARLVL |
| Ga0306920_1016527583 | 3300032261 | Soil | MEIIGTAVDGVGVFIVAAGALVATVRLVVDRAHNTG |
| Ga0306920_1024910451 | 3300032261 | Soil | MEIIGTAVDGVGVFIVAAGALVATARLLVHRAHNTGNYYSSY |
| ⦗Top⦘ |