NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F081546

Metagenome / Metatranscriptome Family F081546

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081546
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 123 residues
Representative Sequence MSSTASHQRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSSFDLGAITYTDILQRLLRLGFQIQSSSSGSYTLPKPEKSIIKNEPQQVSAQDTFVLQYTLVRTHVVG
Number of Associated Samples 60
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 7.89 %
% of genes near scaffold ends (potentially truncated) 70.18 %
% of genes from short scaffolds (< 2000 bps) 89.47 %
Associated GOLD sequencing projects 58
AlphaFold2 3D model prediction Yes
3D model pTM-score0.71

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(56.140 % of family members)
Environment Ontology (ENVO) Unclassified
(65.789 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(71.930 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.13%    β-sheet: 30.26%    Coil/Unstructured: 54.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.71
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRPd7acca_7acc0.61952
d.161.1.1: ADC synthased1i7qa_1i7q0.59174
e.29.1.2: RNA-polymerase beta-primed4g7hd_4g7h0.522
d.110.3.2: Heme-binding PAS domaind1d06a_1d060.52016
d.110.3.0: automated matchesd6gg9a16gg90.51393


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF12796Ank_2 5.26
PF05060MGAT2 0.88
PF13637Ank_4 0.88
PF13499EF-hand_7 0.88
PF00069Pkinase 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.51


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002343|JGI24214J29971_1027533All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea2838Open in IMG/M
3300003401|JGI26530J50255_1012616All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea3215Open in IMG/M
3300003401|JGI26530J50255_1055084All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea869Open in IMG/M
3300003489|JGI26540J51217_10013169All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea3819Open in IMG/M
3300004092|Ga0062389_101863642All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea780Open in IMG/M
3300006095|Ga0097679_1126749All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1753Open in IMG/M
3300006184|Ga0097680_1031519All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood11636Open in IMG/M
3300007244|Ga0075167_11023305All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1634Open in IMG/M
3300009112|Ga0115923_10319115All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea581Open in IMG/M
3300009411|Ga0115017_1335774All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1519Open in IMG/M
3300009500|Ga0116229_10098830All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood12638Open in IMG/M
3300009500|Ga0116229_10298643All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood11361Open in IMG/M
3300009500|Ga0116229_10777827All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1778Open in IMG/M
3300009510|Ga0116230_10178951All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea1740Open in IMG/M
3300009510|Ga0116230_10492286All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea942Open in IMG/M
3300009510|Ga0116230_10573341All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1858Open in IMG/M
3300009697|Ga0116231_10019521All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria7548Open in IMG/M
3300009697|Ga0116231_10082808All Organisms → cellular organisms → Eukaryota2056Open in IMG/M
3300009701|Ga0116228_10533114All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea801Open in IMG/M
3300009709|Ga0116227_10115439All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood12157Open in IMG/M
3300009709|Ga0116227_10801209All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1710Open in IMG/M
3300009787|Ga0116226_10009383All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea8922Open in IMG/M
3300009787|Ga0116226_10066008All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea3688Open in IMG/M
3300009787|Ga0116226_10086583All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea3224Open in IMG/M
3300009787|Ga0116226_10171708All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood12256Open in IMG/M
3300009787|Ga0116226_10636544All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood11064Open in IMG/M
3300009787|Ga0116226_12147635All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea502Open in IMG/M
3300010198|Ga0127509_1006885All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1518Open in IMG/M
3300010200|Ga0127507_1076232All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1502Open in IMG/M
3300010373|Ga0134128_12324496All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1591Open in IMG/M
3300024984|Ga0209914_1000195All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea89313Open in IMG/M
3300027860|Ga0209611_10442634All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1738Open in IMG/M
3300030525|Ga0210273_1211176All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1512Open in IMG/M
3300030529|Ga0210284_1519224All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1587Open in IMG/M
3300030531|Ga0210274_1112168All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea523Open in IMG/M
3300030564|Ga0210256_10792855All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1549Open in IMG/M
3300030573|Ga0210272_1315507All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea508Open in IMG/M
3300030575|Ga0210288_1199582All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1562Open in IMG/M
3300030577|Ga0210260_10335094All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1544Open in IMG/M
3300030579|Ga0247633_10302958All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1524Open in IMG/M
3300030582|Ga0210261_1167853All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1560Open in IMG/M
3300030589|Ga0210255_10834046All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1510Open in IMG/M
3300030595|Ga0210276_10543057All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1516Open in IMG/M
3300030595|Ga0210276_10937637All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1630Open in IMG/M
3300030597|Ga0210286_1227168All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea582Open in IMG/M
3300030597|Ga0210286_1234353All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1576Open in IMG/M
3300030602|Ga0210254_10742315All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1526Open in IMG/M
3300030602|Ga0210254_11005361All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1729Open in IMG/M
3300030603|Ga0210253_10003742All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1508Open in IMG/M
3300030603|Ga0210253_10257112All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1639Open in IMG/M
3300030603|Ga0210253_10794650All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1523Open in IMG/M
3300030611|Ga0257182_1089488All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → Rotaria magnacalcarata871Open in IMG/M
3300030611|Ga0257182_1260889All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1557Open in IMG/M
3300030615|Ga0257185_10390683All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1526Open in IMG/M
3300030622|Ga0265391_10237990All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1575Open in IMG/M
3300030622|Ga0265391_10249562All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1566Open in IMG/M
3300030624|Ga0210251_10185955All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea523Open in IMG/M
3300030624|Ga0210251_10957832All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1526Open in IMG/M
3300030625|Ga0210259_10581548All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1575Open in IMG/M
3300030625|Ga0210259_11409679All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea518Open in IMG/M
3300030627|Ga0210269_10264825All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1586Open in IMG/M
3300030631|Ga0210279_10499585All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1503Open in IMG/M
3300030632|Ga0210250_10643929All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1513Open in IMG/M
3300030632|Ga0210250_11629767All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1556Open in IMG/M
3300030738|Ga0265462_11667388All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea604Open in IMG/M
3300030738|Ga0265462_11678881All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea602Open in IMG/M
3300030738|Ga0265462_11824522All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1584Open in IMG/M
3300030738|Ga0265462_11859324All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1579Open in IMG/M
3300030738|Ga0265462_11864639All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1579Open in IMG/M
3300030738|Ga0265462_11869305All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea578Open in IMG/M
3300030738|Ga0265462_12413601All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1522Open in IMG/M
3300030738|Ga0265462_12564925All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea509Open in IMG/M
3300030740|Ga0265460_12139539All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1586Open in IMG/M
3300030740|Ga0265460_12166481All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1583Open in IMG/M
3300030740|Ga0265460_12480067All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea552Open in IMG/M
3300030740|Ga0265460_12734531All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1529Open in IMG/M
3300030740|Ga0265460_12769117All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1526Open in IMG/M
3300030740|Ga0265460_12940209All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1512Open in IMG/M
3300030741|Ga0265459_13222414All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1571Open in IMG/M
3300030741|Ga0265459_13314901All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1564Open in IMG/M
3300030741|Ga0265459_13478823All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1552Open in IMG/M
3300030741|Ga0265459_13848768All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea527Open in IMG/M
3300030741|Ga0265459_13944355All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea521Open in IMG/M
3300030741|Ga0265459_14089297All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1512Open in IMG/M
3300030741|Ga0265459_14129204All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea509Open in IMG/M
3300030743|Ga0265461_10642791All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1935Open in IMG/M
3300030743|Ga0265461_11115035All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea800Open in IMG/M
3300030743|Ga0265461_11683049All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1701Open in IMG/M
3300030743|Ga0265461_12898131All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1574Open in IMG/M
3300030743|Ga0265461_13765406All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1515Open in IMG/M
3300030743|Ga0265461_14028377All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea500Open in IMG/M
3300030782|Ga0102754_1759580All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea539Open in IMG/M
3300030800|Ga0074032_10608154All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1529Open in IMG/M
3300030922|Ga0138300_1466439All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1523Open in IMG/M
3300031029|Ga0074012_10035504All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1535Open in IMG/M
3300031034|Ga0074041_11349432All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1534Open in IMG/M
3300031057|Ga0170834_107657994All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1576Open in IMG/M
3300031057|Ga0170834_108975969All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1525Open in IMG/M
3300031089|Ga0102748_11401407All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1511Open in IMG/M
3300031122|Ga0170822_14793074All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1581Open in IMG/M
3300031122|Ga0170822_15828932All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea563Open in IMG/M
3300031231|Ga0170824_107023417All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1502Open in IMG/M
3300031231|Ga0170824_115766737All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea516Open in IMG/M
3300031231|Ga0170824_124845527All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1512Open in IMG/M
3300031411|Ga0102761_12675610All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1519Open in IMG/M
3300031469|Ga0170819_10945901All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1520Open in IMG/M
3300031469|Ga0170819_16886337All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1517Open in IMG/M
3300032514|Ga0214502_1311682All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea596Open in IMG/M
3300032593|Ga0321338_1304229All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea572Open in IMG/M
3300032756|Ga0315742_10423972All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Tylenchomorpha → Tylenchoidea → Heteroderidae → Heteroderinae → Globodera → Globodera pallida1065Open in IMG/M
3300032756|Ga0315742_13137232All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea533Open in IMG/M
3300032756|Ga0315742_13157238All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea531Open in IMG/M
3300032756|Ga0315742_13332635All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1518Open in IMG/M
3300032756|Ga0315742_13348791All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1517Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil56.14%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated17.54%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil12.28%
Wastewater BioreactorEngineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor5.26%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated2.63%
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere1.75%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.88%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.88%
Wastewater TreatmentEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment0.88%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.88%
Swimming Pool Sandfilter BackwashEngineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002343Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - F_92min_Anaerobic (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300003401Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_500_planEngineeredOpen in IMG/M
3300003489Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_cont_1000_planEngineeredOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300006095Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_cont_500_biof - 1398105538000 (version 2)EngineeredOpen in IMG/M
3300006184Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_cont_750_biof - 1398105538117 (version 2)EngineeredOpen in IMG/M
3300007244Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300009112Microbial communities from sand-filter backwash in Singapore swimming pools - KB-2EngineeredOpen in IMG/M
3300009411Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009510Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300009697Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009701Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300009709Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009787Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300010198Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300010200Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300024984Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_cont_500_plan (SPAdes)EngineeredOpen in IMG/M
3300027860Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)Host-AssociatedOpen in IMG/M
3300030525Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO037SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030529Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030531Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030573Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030575Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030577Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO131-ARE010SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030579Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030582Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE022SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030589Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030595Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030597Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE046SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030602Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030603Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR017SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030611Metatranscriptome of decayed wood fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP1-1 (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030615Metatranscriptome of plant litter fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP1-LITTER (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030622Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030624Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030627Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030631Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030632Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR004SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030782Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 4B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030800Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030922Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031029Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFA (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031034Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031089Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 2B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031411Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300032514Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032593Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24214J29971_102753313300002343Wastewater TreatmentSNKRFEVLSLVVRNVLTSESKYFQIHGDKQIIAQVLPTAPDRAFVNGDCYDSSLDLGSVSYIDILQRLLRVGFQIESSTSGSFNSSKQEKSIIKSDTLSTGSIDTFVLQYTLIRSHSIG*
JGI26530J50255_101261643300003401Wastewater BioreactorMASHQRFDILSLVVQNLLHSNSKIYQIHGDKQFITQILPTAPERAYITNDCYDSSLDLGSIPYTDILQRLLRVGFQIHSTTSGSYASPKSAAENAAPDTFVLQYTLIRTQLID*
JGI26530J50255_105508423300003401Wastewater BioreactorMSNQRFEILSLLVRNVLTTNSKHFQLHGDKQLIVQILPTAPDRAFITSDCYDSSFDLGSITYTDTLQRLLRQGFQIQSSTSGSYILPKPEKSIIKNEPQQVSAQXTYVLQYTLVRTQNVG
JGI26540J51217_1001316923300003489Wastewater BioreactorMSNQRFEILSLLVRNVLTTNSKHFQLHGDKQLIVQILPTAPDRAFITSDCYDSSFDLGSITYTDTLQRLLRQGFQIQSSTSGSYILPKPEKSIIKNEPQQVSAQDTYVLQYTLVRTQNVG
Ga0062389_10186364213300004092Bog Forest SoilMVILHFVCFQMSSGVQHRFEVLSLIVRNVLTTNSKSFQLHGDKQIIAHALPTAPERAYLSNDCYDSSLDLGSISYTDILQRLLRVGFQIQSSTSGSYTSPKQEKSIIKNDPQQGSPQDTFVLQYTLIRTHVVG*
Ga0097679_112674923300006095Wastewater BioreactorMSNQRFEILSLLVRNVLTTNSKHFQLHGDKQLIVQILPTAPDRAFITSDCYDSSFDLGSITYTDTLQRLLRQGFQIQSSTSGSYILPKPEKSIIKNEPQQV
Ga0097680_103151913300006184Wastewater BioreactorIFMSNQRFEILSLLVRNVLTTNSKHFQLHGDKQLIVQILPTAPDRAFITSDCYDSSFDLGSITYTDTLQRLLRQGFQIQSSTSGSYILPKPEKSIIKNEPQQVSAQDTYVLQYTLVRTQNVG*
Ga0075167_1102330513300007244Wastewater EffluentYQEIKFLSAMAVNQRFEILSLLVRNVLSSNSKHFQLHGDKQFITQILPTAPDRAFIGNDCYDSSFDLGSITYIDILQRLLRLGFQIQSSAAGSFALPKPEKSIIKNEPQQISPHDTFVLQYTLVRTHVVG*
Ga0115923_1031911513300009112Swimming Pool Sandfilter BackwashMATSGVQHRYEVLSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITSDCYDSSFDLGSITYTDILQRLLRVGFQIQASTGGSYILPKAEKSIIKNDAQQVSAQDTFVLQYTLVRA
Ga0115017_133577423300009411SoilMSNQRFEILSLFVRNVLTSNSKNFQLHGDKQLIVQILPTAPDRAFITNECYDSSFDLGAITYTDILQRLLRQGFQIQSSSAGSYSLPKPEKSIIKSDPPQVSPQDTFVLQYTLIRTQVVG
Ga0116229_1009883023300009500Host-AssociatedMVLFSFQIQLMSSNASNQRFEVLSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITSDCYDSSFDLGSITYTDILQRLLRLGFHIQSSSSGSYTLPKAEKSIIKNEPQQVSAQDTFVLQYTLVRTHVVG*
Ga0116229_1029864313300009500Host-AssociatedMSSNAPHHRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQIVPTAPDRAFITNDCYDSSYDLGSITYTDILQRLLRQGYQIQSSSAGSYNLPKSEKSIIKNEPQVSGQDTFVLQYTLVRTHVVG*
Ga0116229_1077782723300009500Host-AssociatedMSSGVQHRFEVLSLIVRNVLTTNSKSFQLHGDKQIIAQALPTAPERAYLANDCYDSSLDLGSISYTDILQRLLRVGFQIQSSSSGSYTSPKQEKSIIKNDPQQGSPQDTFVLQYTLIRTHVVG*
Ga0116230_1017895113300009510Host-AssociatedMSVLSSHRFEILSLVVRNIPTTNSKLFQLHGDKQVIAQILPTAPQRAYITNDCYDSSLDLGSISHTDILQRLLRLGFKIERSTSGSYCSPNQEKSVIKNDSLQDTVVLQYTLIRTHVVD*
Ga0116230_1049228613300009510Host-AssociatedLFSDVLPVQHRFEVLSLVVRNVLISNSKSFQLHGDKQIIAQVLPTAPERAYITNDCYDSSLDLGSIPYTDILQRLLRLGFQIQTSSSGSYSAPKQEQSIIKNDPQQGSSQDTFVLQYTLIRTHVVD*
Ga0116230_1057334123300009510Host-AssociatedMSSTASNQRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRLGFQIQSSSSGSYTLPKPEKSIIKNEPQ
Ga0116231_1001952183300009697Host-AssociatedMSSGVQHRFEVLSLIVRNVLTTNSKSFQLHGDKQIIAQALPTAPERAYLTNDCYDSSLDLGSISYTDILQRLLRVGFQIQSSSSGSYTSPKQEKSIIKNDPQQGSPQDTFVLQYTLIRTHVVG*
Ga0116231_1008280833300009697Host-AssociatedMSTNASNQRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQVLPTAPDRAFITNDCYDSSYDLGSITYTDILQRLLRQGYQIQSSSAGSYSLPKSEKSIIKNEPQVSGQDTFVLQYTLVRTHVVG*
Ga0116228_1053311413300009701Host-AssociatedFQMSVLSSHRFEILSLVVRNSPTTNSKLFQLHGDKQVIAHILPTAPERAYVTNDCYDSSLDLGSISYTDILQRLLRLGFKIEISTSGSYCSPNQEKSSIKNDSLQDTFVFNIHSYEHML*
Ga0116227_1011543933300009709Host-AssociatedMSSTASSQRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRLGFQIQSSSSGSYTLPKPEKSIIKNEPQVSAQDTFVLQYTLVRTHAVG*
Ga0116227_1080120913300009709Host-AssociatedMSSNAPHHRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSSYDLGSITYTDILQRLLRLGFHIQSSSSGSYTLPKAEKSIIKNEPQQVSAQDTFVLQYTLVRTHAVG*
Ga0116226_10009383103300009787Host-AssociatedMSATASHHRFEILSLLVRNVLTSNSKNFQLHGDKQVIIQILPTAPERAFITNDCYDSSFDLGSITYTDILQRLLRLGFQIQSSSSGSYSLPKPEKSIIKNEPHQVAAQDTFVLQYTLVRTHVVS*
Ga0116226_1006600823300009787Host-AssociatedMSVLSSHRFEILSLVVRNSPTTNSKLFQLHGDKQVIAQILPTAPQRAYITNDCYDSSLDLGSISHTDILQRLLRLGFKIEISTSGSYCSPTQEKSVIKNDSLQDTVVLQYTLIRTHVVD*
Ga0116226_1008658343300009787Host-AssociatedMSLPVQHRFEVLSLVVRNVLISNSKSFQLHGDKQIIAQVLPTAPERAYITTDCYDSSLDLGSIPYTDILQRLLRLGFQIQTSSSGSYSAPKQEKSIIKNDPQQGSSQDTFVLQYTLIRTHVVD*
Ga0116226_1017170833300009787Host-AssociatedMAVAGSNQRFEILSLLVRNVLTTNSKNFQLHGDKQIIMQVLPTAPDRAFTANECYDSSFDLGSIAYTDILQRLLRLGFQIQSSSAGSYSLPKPEKSIIKNEPQQVSGQDTFVLQYTLVRTHIVG*
Ga0116226_1063654413300009787Host-AssociatedFEVLSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFLTSDCYDSSLDLGSITYTDILQRLLRLGFHIQSSSSGSYTLPKAEKSIIKNEPQQVSAQDTFVLQYTLVRTHVVG*
Ga0116226_1214763513300009787Host-AssociatedNLFGYGCCCCFSFQMSVLSSHRFEILSLVVRNVLTTNSKHFQLHGDKQVIAHILPTAPERAYITNDCYDSSLDLGSISYTDILQRLLRLGFKIEISTSGSYCSPNQEKSIIKNDSLQDTLVLQYTLIRTHAVD*
Ga0127509_100688513300010198Host-AssociatedEIQIMAVAGSNQRFEILSLLVRNVLTTNSKNFQLHGDKQIIMQVLPTAPDRAFTANECYDSSFDLGSIAYTDILQRLLRLGFQIQSSSAGSYSLPKPEKSIIKNEPQQVSGQDTFVLQYTLVRTHIVG*
Ga0127507_107623213300010200Host-AssociatedFQIQLMSSNASNQRFEVLSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITSDCYDSSFDLGSITYTDILQRLLRLGFHIQSSSSGSYTLPKAEKSIIKNEPQQVSAQDTFVLQYTLVRTHVVG*
Ga0134128_1232449613300010373Terrestrial SoilMATTQSNQRFEILSLLVRNVLTSNSKNFQLHGDKQVSVQILPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRLGFQIQSSSSGSYHLPKQEKSIIKNEPQQVSPQDTYV
Ga0209914_10001951013300024984Wastewater BioreactorMASHQRFDILSLVVQNLLHSNSKIYQIHGDKQFITQILPTAPERAYITNDCYDSSLDLGSIPYTDILQRLLRVGFQIHSTTSGSYASPKSAAENAAPDTFVLQYTLIRTQLID
Ga0209611_1044263413300027860Host-AssociatedMVLFSFQIQLMSSNASNQRFEVLSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITSDCYDSSFDLGSITYTDILQRLLRLGFHIQSSSSGSYTLPKAEKSIIKNEPQQVSAQDTFVLQYTLVRTHVVG
Ga0210273_121117613300030525SoilQNHRFDVLSMLVRNVLQTNSKQFQLHGDKQVITQILPTAPERAFLSNDCYDSSMDLGSITYTDILQRLLRLGFEIQSTTSGAYILPKSDKSIIKNDPQQVSPQDTFVLQYTLVRTHVIG
Ga0210284_151922413300030529SoilPRDKNRMASAQTTQRFEILSLLVRNVLISNSKNFQLHGDKQVIVQVLPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRLGYQIQSSSSGSYSLPKPEKSIIKNEPQQVSAQDTFVLQYTLVRTHVVG
Ga0210274_111216813300030531SoilSNQRFEILSLLVRNVLTSNSKIFQLHGDKQVIVQILPTAPDRAFITSDCYDSSYDLGSITYTDILQRLLRVGFQIQSSSGGSYSLPKPEKSIIKNEPPPSAQDTFVLQYTLVRTHAVG
Ga0210256_1079285513300030564SoilSSGTSNQRFEILSLLVRNVLTSNSKIFQLHGDKQVIVQILPTAPDRAFITNDCYDSSYDLGSITYTDILQRLLRVGFQIQSSSGGSYSLPKPEKSIIKNEPPPSAQDTFVLQYTLVRTHAVG
Ga0210272_131550713300030573SoilLITTYQEMSVTSQHRFEVLSLLVRNVLTANSKCFQLHGDRQVIAQILPTAPEKAFITNDCYDSSVDLGAITYTDILQRLLRLGFQIQASSSGSYSSPKQEKSIIKNDPQQFSSQDTFVLQYTLIRMHVIG
Ga0210288_119958213300030575SoilQEIKIMSSGTSNQRFEILSLLVRNVLTSNSKIFQLHGDKQVIVQILPTAPDRAFITNDCYDSSYDLGSITYTDILQRLLRVGFQIQSSSGGSYSLPKPEKSIIKNEPPISTGYIRSSIYSCSNACCGLKKTK
Ga0210260_1033509413300030577SoilSGTSNQRFEILSLLVRNVLTSNSKIFQLHGDKQVIVQILPTAPDRAFITSDCYDSSYDLGSITYTDILQRLLRVGFQIQSSSGGSYSLPKPEKSIIKNEPPPSAQDTFVLQYTLVRTHAV
Ga0247633_1030295813300030579SoilLMAVNAPHQRFEILSLLVRNVLTSNSKNFQLHGDKQVIMQILPTAPDRAFLTNDCYDSSADLGSITYTDILQRLLRLGFAIQSSTGGSFTLPKAEKSIIKTEPQQTSAQDTFVLQYTLVRTHVVG
Ga0210261_116785313300030582SoilGLITTYQEIRFMASTASHQRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRVGFQIQSSSAGSYSLLKQEKSIIKNEPQVSAQDTFVLQYTLVRTHVVG
Ga0210255_1083404613300030589SoilLISNSKNFQLHGDKQVIVQVLPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRLGYQIQSSSSGSYSLPKPEKSIIKNEPQQVSAQDTFVLQYTLVRTHVVG
Ga0210276_1054305713300030595SoilLNRFEILSLLVRNVLTSNSKNFQLHGDKQVIMQILPTAPDRAFIANDCYDSSFDLGSITYTDILQRLLRLGFQIQSSSAGSYSLPKPEKSIIKNEPQQISAQDTFVLQYTLVRTHVVG
Ga0210276_1093763723300030595SoilSSTASNQRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITSDCYDSSYDLGSITYTDILQRLLRLGFQIQSSSAGSYSLPKPEKSIIKNEPQVSAQDTFVLQYTLVRTHVVG
Ga0210286_122716813300030597SoilMICLSPCIWNVFEFVARTFRTTNESTYQEMSSSVQHRFEVLSLVVRNVLATNSKTFQIHGDKQIIAQVLPTAPERAYITNDCYDSSLDLGSIPYTDILQRLLRLGFQIQASSSGSYSSPKQEGSSQDTFVLQYTLIRMQVIS
Ga0210286_123435313300030597SoilMSSTASNQRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITSDCYDSSYDLGSITYTDILQRLLRVGFQIQSSSGGSYNLPKPEKSIIKNEPPPSAQDTFVLQYTLVRTHAVG
Ga0210254_1074231513300030602SoilMSSIASNQRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSGFDLGSITYTDILQRLLRLGFQIQSSSAGSYNLPKPEKSIIKNEPQQVSAQDTFVLQYTLIRTHVVG
Ga0210254_1100536113300030602SoilEIKIMSSGTSNQRFEILSLLVRNVLTSNSKIFQLHGDKQVIVQILPTAPDRAFITNDCYDSSYDLGSITYTDILQRLLRVGFQIQSSSGGSYSLPKPEKSIIKNEPPPSAQDTFVLQYTLVRTHVVG
Ga0210253_1000374223300030603SoilRNVLTSNSKKNFQLHGDKQVIMQILPTAPDRAFIANDCYDSSFDLGSITYTDILQRLLRLGFQIQSSSAGSYSLPKPEKSIIKNEPQQISAQDTFVLQYTLVRTHVVG
Ga0210253_1025711223300030603SoilMSSGTSNQRFEILSLLVRNVLTSNSKIFQLHGDKQVIVQILPTAPDRAFITNDCYDSSYDLGSITYTDILQRLLRVGFQIQSSSGGSYSLPKPEKSIIKNEPPPSAQDTFVLQYTLVRTHAVG
Ga0210253_1079465013300030603SoilASHHRFEILSLLVRNVLTSNSKHFQLHGDKQVIVQILPTAPDRAFITNDCYVSSFDLGSITYTDILQRLLRLGFQIQSSSAGSYSLPKPEKSIIKNEPQQTSAQDTFVLQYTLVRTHVVG
Ga0257182_108948813300030611Host-AssociatedMSLLLQHRFEVLSLVVRNVLTSNSKTFQLHGDKQIIAHVLPTAPERAYITNDCYDSSLDLGSIPYTDILQRLLRLGFQIQTSSSGSYSSPRQEKSIIKNDPQQGSSQ
Ga0257182_126088913300030611Host-AssociatedMSSTASHQRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSSFDLGAITYTDILQRLLRLGFQIQSSSSGSYTLPKPEKSIIKNEPQQVSAQDTFVLQYTLVRTHVVG
Ga0257185_1039068313300030615Host-AssociatedQEIELMATTTSNHRFEILSLLVRNDLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRVGFQIQSSSAGSYSLLKAEKSIIKNEPQVSAQDTFVLQYTLVRTHVVG
Ga0265391_1023799013300030622SoilQEIKIMSSGTSNQRFEILSLLVRNVLTSNSKIFQLHGDKQVIVQILPTAPDRAFITNDCYDSSYDLGSITYTDILQRLLRVGFQIQSSSGGSYSLPKPEKSIIKNEPPPSAQDTFVLQYTLVRTHAVG
Ga0265391_1024956213300030622SoilLIKTYQEIRFMASTASHQRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSGFDLGAITYTDILQRLLRLGFQIQSSSAGSYSLPKPEKSIIKNEPQQVSAQDTFVLQYTLIRTHVVG
Ga0210251_1018595513300030624SoilSNQRFEILSLLVRNVLTSNSKIFQLHGDKQVIVQILPTAPDRAFITNDCYDSSYDLGSITYTDILQRLLRVGFQIQSSSGGSYSLPKPEKSIIKNEPPPSAQDTFVLQYTLVRTHAVG
Ga0210251_1095783213300030624SoilRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITSDCYDSSFDLGSITYTDILQRLLRLGFQIQSSTGGSYHLPKQEKSIIKNEPQQVSAQDTFVLQYTLVRTHVVG
Ga0210259_1058154813300030625SoilLITTYQEIKIMSSGTSNQRFEILSLLVRHVLTSNSKIFQLHGDKQVIVQILPTAPDRAFITNDCYDSSYDLGSITYTDILQRLLRVGFQIQSSSGGSYSLPKPEKSIIKNEPPPSAQDTFVLQYTLVRTHAVG
Ga0210259_1140967913300030625SoilSASSHSQTHRFDVLSLLVRNVLLSNSKHFQLHGDKQVIMQILPTAPDRAFLTNDCYDSSADLGSISYTDILQRLLRLGFQIQATTSGSYSMAKQDKSVLKNDASQSSPQDTFVLQYTLVRTHVIG
Ga0210269_1026482513300030627SoilLITNLPRDKNRMASAQSTQRFEILSLLVRNVLISNSKNFQLHGDKQVIVQVLPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRLGYQIQSSSSGSYSLPKPEKSIIKNEPQQVSAQDTFVLQYTLVRTHVVS
Ga0210279_1049958513300030631SoilMSTASNQRFEILSLLVRNVLISNSKNFQLHGDKQIIVQILPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRVGLQIQSSTGGSYNLPKPEKSIIKSEPQQISPQDTFVLQYTLIRTHVVG
Ga0210250_1064392913300030632SoilRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITSDCYDSSFDLGSITYTDILQRLLRLGFQIQSSSAGSYSLPKPEKSIIKNEPQQISAQDTFVLQYTLVRTHVVG
Ga0210250_1162976723300030632SoilMSSGTSNQRFEILSLLVRNVLTSNSKIFQLHGDKQVIVQILPTAPDRAFITSDCYDSSYDLGSITYTDILQRLLRVGFQIQSSSGGSYSLPKPEKSIIKNEPPPSAQDTFVLQYTLVRTHAVG
Ga0265462_1166738813300030738SoilMICLSPCIWNVFEFVARTFRTTNESTYQEMSSSVQHRFEVLSLVVLNVLATNLKTFQIHGDKQIIAQVLPTAPERAYITNDCYDSSLDLGSIPYTDILQRLLRLGFQIQASSSGSYSSPKQEGSSQDTFVLQYTLIRMQVIS
Ga0265462_1167888113300030738SoilSTASAQPQTHRFDVLSLLVRNVLLTNSKQFQLHGDRQVITQILPTAPDRAFLTNDCYDSSLDLGSITYTDILQRLLRLGFQIQATTSGSYAMPKQDKSIIKGDPIQSSPQDTFVLQYTLVRSHVIG
Ga0265462_1182452213300030738SoilPRDKNRMASAQTTQRFEILSLLVRNVLISNSKNFQLHGDKQVIVQVLPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRLGYQIQSSSSGSYSLPKPEKSIIKNEPQQVSAQDTFVLQYTLVRTHVVS
Ga0265462_1185932413300030738SoilLITTYQEIKIMSSGTSNQRFEILSLLVRNVLTSNSKIFQLHGDKQVIVQILPTAPDRAFITNDCYDSSYDLGSITYTDILQRLLRVGFQIQSSSGGSYSLPKPEKSIIKNEPPPSAQDTFVLQYTLVRTHAVG
Ga0265462_1186463913300030738SoilLMSSLHRFAILSLLVRNVLTSTSKTFQLHGDHQVIMQILPTAPDRAFIANDCYDSSFDLGSITYTDILQRLLRLGFQIQSSSAGSYSLPKPEKSIIKNEPQQISAQDTFVLQYTLVRTHVVG
Ga0265462_1186930513300030738SoilSTFXNTFITCKKMFLHQIQKKNFQLHGDKQIIVQILPTAPDRAFITNDCYDSSSDLGSITYTDILQRLLRVGFQIQSSSAGSYSLLKPEKSIIKNESQPAQDTFVLQYTLVRTQAVG
Ga0265462_1241360113300030738SoilMSSTASNQRFEILSLLVRNVLISNSKNFQLHGDKQVITQILPTAPDRAFITSDCYDSSLDLGSITYTDILQRLLRLGFHIQSSSSGSYTLPKPEKSIIKNEPQQTLGQDTFVLQYTLVRTHVVG
Ga0265462_1256492513300030738SoilEMATAGQNHRFDVLSMLVRNVLQTNSKQFQLHGDKQVITQILPTAPERAFLSSDCYDSSLDLGSITYTDILQRLLRLGFQIQATTSGAYNLPKSDKSVTKGEPSSPDTFVLQYTLVRTHVVG
Ga0265460_1213953913300030740SoilTNYQEIKIMSSGTSNQRFEILSLLVRNVLTSNSKIFQLHGDKQVIVQILPTAPDRAFITNDCYDSSYDLGSITYTDILQRLLRVGFQIQSSSGGSYSLPKPEKSIIKNEPPPSAQDTFVLQYTLVRTHAVG
Ga0265460_1216648123300030740SoilVRNVLTSNSKNFQLHGDKQVIMQILPTAPDRAFIANDCYDSSFDLGSITYTDILQRLLRLGFQIQSSSAGSYSLPKPEKSIIKNEPQQISAQDTFVLQYTLVRTHVVG
Ga0265460_1248006713300030740SoilSTASAQPQTHRFDVFSLLVRNVLLTNSKQFQLHGDRQVITQILPTAPDRAFLTNDCYDSSLDLGSITYTDILQRLLRLGFQIQATTSGSYAMPKQDKSIIKGDPIQSSPQDTFVLQYTLVRSHVIG
Ga0265460_1273453113300030740SoilMSTASNQLFEILSLLVRNVLISNSKNFQLHGDKQVITQILPTAPDRAFITSDCYDSSLDLGSITYTDILQRLLRLGFHIQSSSSGSYTLPKPEKSIIKNEPQQTLGQDTFVLQYTLVRTHVVG
Ga0265460_1276911713300030740SoilRYEILSLLVRNVLTSNSKKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRVGFQIQSSTGGSYNLPKPEKSIIKSEPQQVLPQDTFVLQYTLVRTHVVG
Ga0265460_1294020913300030740SoilNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSGFDLGAITYTDILQRLLRLGFQIQSSSAGSYSLPKPEKSIIKNEPQQVSAQDTFVLQYTLIRTHVVG
Ga0265459_1322241423300030741SoilMASSGSNHRYEILSLLVRNVLTSNSKNFQLHGDKQIIVQILPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRVGFQIQSSTGGSYNLPKPEKSIIKSEPQQISPQDTFVLQYTLIRTHVVG
Ga0265459_1331490113300030741SoilSSNASSNQRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSGFDLGSITYTDILQRLLRLGFQIQSSSAGSYSLPKPEKSIIKNEPQQVSAQDAFVLQYTLIRTHVVG
Ga0265459_1347882323300030741SoilIIMAATTTATNQRFEILSLLVRNVLISNSKHFQLHGDKQIIVQILPTAPDRAFITSDCYDSSFDLGSITYTDILQRLLRVGFQIQSSSSGSYSLPKSEKSIIKNEPQQVLPQDTFVLQYTLVRTHAMG
Ga0265459_1384876813300030741SoilSSTASAQPQTHRFDVLSLLVRNVLLTNSKQFQLHGDRQVITQILPTAPDRAFLTNDCYDSSLDLGSITYTDILQRLLRLGFQIQATTSGSYAMPKQDKSIIKGDPIQSSPQDTFVLQYTLVRSHVIG
Ga0265459_1394435513300030741SoilCFLQTYQEMSQTHRFDVLSLLVRNVLITNSKQFQLHGDKQLITQILPTAPDRAFLSSDCYDSSNDLGSITYTDILQRLLRLGFQIQGTTSGSYFMPKQDKSIIKGDPQQASPQDTFVLQYTLVRSHVIG
Ga0265459_1408929713300030741SoilLITTYQEIQLMSSLHRFEILSLLVRNVLTSNSKNFQLHGDKQVIMQILPTAPDRAFIANDCYDSSFDLGSITYTDILQRLLRLGFQIQASSSGSYSSPKQEKSIIKNDPQQFSSQDTFVLQYTLIRMHVIG
Ga0265459_1412920413300030741SoilSHSQTHRFDVLSLLVRNVLLSNSKHFQLHGDKQVIMQILPTAPDRAFLTNDCYDSSADLGSISYTDILQRLLRLGFQIQATTSGSYSMAKQDKSVLKNDASQSSPQDTFVLQYTLVRTHVIG
Ga0265461_1064279113300030743SoilMIEFESPLLINVVKYQYMLLNQEIKIMSSGTSNQRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSGFDLGAITYTDILQRLLRLGFQIQSSSAGSYSLPKPEKSIIKNEPQQVSAQDTFVLQYTLIRTHVVG
Ga0265461_1111503513300030743SoilLIIVCSGDVFGYGYYFYFQMSLSSQHRFEVLSLIVRNVLTTNSKSFQLHGDKQIIAQVLPTAPERAYTTNDCYDSSLDLGSIPYTDVLQRLLRLGFQIQTSASGSYSSPKQEKSIIKNDPEQGLPQDTFVLQYTLIRTHVVG
Ga0265461_1168304913300030743SoilYNLPRDKNRMASAQSTQRFEILSLLVRNVLISNSKNFQLHGDKQVIVQVLPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRLGYQIQSSSSGSYSLPKPEKSIIKNEPQQVSAQDTFVLQYTLVRTHVVG
Ga0265461_1289813113300030743SoilMSTASNQRFEILSLLVRNVLISNSKNFQLHGDKQVITQILPTAPDRAFITSDCYDSSLDLGSITYTDILQRLLRLGFHIQSSSSGSYTLPKPEKSIIKNEPQQTLGQDTFVLQYTLVRTHVVG
Ga0265461_1376540613300030743SoilTASNHRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITSDCYDSSFDLGSITYTDILQRLLRLGFQIQSSTGGSYHLPKQEKSIIKNEPQQVSAQDTFVLQYTLVRTHVV
Ga0265461_1402837713300030743SoilPQTHRFDVLSLLVRNVLLTNSKQFQLHGDRQVITQILPTAPDRAFLTNDCYDSSLDLGSITYTDILQRLLRLGFQIQATTSGSYAMPKQDKSIIKGDPIQSSPQDTFVLQYTLVRSHVIG
Ga0102754_175958023300030782SoilGPQHRFEILSLLVRNVLTSNSKNYQLHGDKQIIVQILPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRVGFQIQASTGGSYTLPKPEKSIIKNDSQQGVPLDTFILQYTLVRTHVVG
Ga0074032_1060815423300030800SoilTAAHHRYEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRVGFQIQSSSAGSYSLPKPEKSIIKSEPQQVLPQDTFVLQYTLVRTHVV
Ga0138300_146643913300030922SoilCLLQLTKRLYLMAVNASHQRFEILSLLVRNVLTSNSKNFQLHGDKQVIMQILPTAPDRAFLTNDCYDSSADLGSITYTDILQRLLRLGFVIQSSTGGSFTPPKSEKSIIKTEPQQTSAQDTFVLQYTLVRTHVVG
Ga0074012_1003550413300031029SoilGLMASTAAHQRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRVGFHIQSSSAGSYSLPKPEKSIIKSEPQQVSAQDTFVLQYTLVRTHVVG
Ga0074041_1134943213300031034SoilLSLLVRNVLSSNSKNFQLHGDKQLIVQILPTAPDRAFITNECYDSSFDLGSITYTDILQRLLRVGFQIQSSSAGSYILPKPEKSIIKNEPQTSAQDTFVLQYTLVRTHVVG
Ga0170834_10765799423300031057Forest SoilVSTYQEIELMSSSASNQRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSSFDLGSISYTDILQRLLRLGFQIQSSSGGSYSLPKPEKSIIKNEPQLSAQDTFVLQYTLVRTHVVG
Ga0170834_10897596913300031057Forest SoilFEILSLLVRNVLTSNSKNFQLHGDKQIIVQILPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRLGFQIQSSSSGSYNLPKPEKSIIKNEPQQVSAQDSFVLQYTLVRTHVVS
Ga0102748_1140140713300031089SoilASALTNQRFEILSLFVRNVLTTNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRVGFQIQSSSSGSYNLPKPEKSILKSDPQQVSPQDTFVLQYTLIRTHIVG
Ga0170822_1479307413300031122Forest SoilAAQSLQRFEILSLLVRNVLTSNSKNFQLHGDKQIIVQILPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRLGFQIQSSSSGSYNLPKPEKSIIKNEPQQVSAQDSFVLQYTLVRTHVVS
Ga0170822_1582893213300031122Forest SoilPQHRFEILSLLVRNVLTSNSKNYQLHGDKQIIVQILPTSPDRAFITNDCYDSSFDLGSITYTDILQRLLRVGFQIQASTGGSYTLPKPEKSIIKSDSQQGVPLDTFVLQYTLVRTHVVG
Ga0170824_10702341723300031231Forest SoilLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSSFDLGSISYTDILQRLLRLGFQIQSSSGGSYSLPKPEKSIIKNEPQLSAQDTFVLQYTLVRTHVVG
Ga0170824_11576673713300031231Forest SoilGQLTKSFQITRIMAVAAGSSQRFEILSLLVRNVLTSNSKNYQLHGDKQIIVQILPTSPDRAFITNDCYDSSFDLGSITYTDILQRLLRVGFQIQASTGGSYTLPKPEKSIIKSDSQQGVPLDTFVLQYTLVRTHVVG
Ga0170824_12484552713300031231Forest SoilVSTYQEIELMSSSASNQRFEILSLLVRNVLTSNSKNFQLHGDKQVIAQILPTAPERAYIANDCYDSSLDLGAITYTDILQRLLRLGFQIHTSTSGSYSSSKPEKSVIKNDPHQASSHDTFVLQYTLLRMHAVG
Ga0102761_1267561013300031411SoilVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNECYDSSFDLGAITYTDILQRLLRQGFQIQSSSAGSYSLPKPEKSIIKSEPPQVSPQDTFVLQYTLIRTHVVG
Ga0170819_1094590113300031469Forest SoilSATATNQRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRLGFHIQSSTGGSYNLPKPEKSIIKNEPSQVSAQDTFVLQYTLVRTHVVG
Ga0170819_1688633713300031469Forest SoilLITTYQEIELMSSGASNQRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSSFDLGSISYTDILQRLLRLGFQIQSSSGGSYSLPKPEKSIIKNEPQLSAQDTFVLQYTLVRTHVVG
Ga0214502_131168223300032514Switchgrass PhyllosphereLPRDLKTMATTGSHQRFEVLSLLVRNSLTSNSKAFQLHGDKQVVMQVLPTAPDRAFPANDCYDSSSDLGAITYTDILQRLLRLGFHIQSSAAGSYHLPKQEKSIIKNEPQSIAPQDTFVLQYTLVRTHSIG
Ga0321338_130422913300032593Switchgrass PhyllosphereRDLKTMATTGSHQRFEVLSLLVRNSLTSNSKAFQLHGDKQVVMQVLPTAPDRAFPANDCYDSSSDLGAITYTDILQRLLRLGFHIQSSAAGSYHLPKQEKSIIKNEPQSIAPQDTFVLQYTLVRTHSIG
Ga0315742_1042397213300032756Forest SoilMSANASHHRFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRVGFQIQSSSAGSYSLLKAEKSIIKNEPQVSAQDTF
Ga0315742_1313723213300032756Forest SoilSANAGNQRFEILSLLVRNVLTSNSKNFQLHGDKQMIVQVLPTAPDRAFITNDCYDSSFDLGSITYTDILQRLLRLGFEIKSSTGGSYMLPKAEKPIIKNEPQQTTAQDTFVLQYTLVRTHNIG
Ga0315742_1315723813300032756Forest SoilMFLHQIQKNFQLHGDKQIIAQILPTAPERAYITNDCYDSSLDLGSITYTDIMQRLLRLGFEIKATSSGSYSSAKQDKSIIKNDPQESSAQDTFVLQYTLIRTHVVG
Ga0315742_1333263513300032756Forest SoilCQRFEILSLLVRNVLSSNSKNFQLHGDKQLIVQILPTAPDRAFITNECYDSSFDLGSITYTDILQRLLRVGFQIQSSSAGSYSLPKPEKSIIKNDPQQASAQDTFVLQYTLVRTHTVG
Ga0315742_1334879113300032756Forest SoilPHLIIVFEILSLLVRNVLTSNSKNFQLHGDKQVIVQILPTAPDRAFITSDCYDSSFDLGSITYTDILQRLLRLGFQIQSSTGGSYHLPKQEKSIIKNEPQQVSAQDTFVLQYTLVRTHVV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.