| Basic Information | |
|---|---|
| Family ID | F081516 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VHLALLSTGEDRAKAVVDWTWAGFTHERSGRIQVDASER |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.59 % |
| % of genes near scaffold ends (potentially truncated) | 90.35 % |
| % of genes from short scaffolds (< 2000 bps) | 85.09 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.561 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.035 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.456 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.228 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.30% β-sheet: 0.00% Coil/Unstructured: 59.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF00479 | G6PD_N | 19.30 |
| PF02781 | G6PD_C | 19.30 |
| PF00664 | ABC_membrane | 14.91 |
| PF01654 | Cyt_bd_oxida_I | 9.65 |
| PF01263 | Aldose_epim | 5.26 |
| PF00171 | Aldedh | 4.39 |
| PF07077 | DUF1345 | 2.63 |
| PF00999 | Na_H_Exchanger | 1.75 |
| PF14742 | GDE_N_bis | 0.88 |
| PF00834 | Ribul_P_3_epim | 0.88 |
| PF00732 | GMC_oxred_N | 0.88 |
| PF00571 | CBS | 0.88 |
| PF00312 | Ribosomal_S15 | 0.88 |
| PF01551 | Peptidase_M23 | 0.88 |
| PF00582 | Usp | 0.88 |
| PF00294 | PfkB | 0.88 |
| PF01758 | SBF | 0.88 |
| PF02574 | S-methyl_trans | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 38.60 |
| COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 9.65 |
| COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 5.26 |
| COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 5.26 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 4.39 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 4.39 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 4.39 |
| COG4291 | Uncharacterized membrane protein | Function unknown [S] | 2.63 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 1.75 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 1.75 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 1.75 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 1.75 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 1.75 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.88 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.88 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.88 |
| COG0184 | Ribosomal protein S15P/S13E | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0036 | Pentose-5-phosphate-3-epimerase | Carbohydrate transport and metabolism [G] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.56 % |
| Unclassified | root | N/A | 25.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725002|GPICC_F5MS3JC01EGXYQ | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_10310881 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300000550|F24TB_10000178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum | 3237 | Open in IMG/M |
| 3300000955|JGI1027J12803_101252334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 634 | Open in IMG/M |
| 3300000956|JGI10216J12902_103058282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 930 | Open in IMG/M |
| 3300001431|F14TB_100796511 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1736 | Open in IMG/M |
| 3300004081|Ga0063454_100152885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1225 | Open in IMG/M |
| 3300004114|Ga0062593_101730636 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300004803|Ga0058862_10120549 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
| 3300005332|Ga0066388_107285285 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005345|Ga0070692_11058830 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005577|Ga0068857_100819294 | Not Available | 889 | Open in IMG/M |
| 3300005577|Ga0068857_101740562 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005841|Ga0068863_100136187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum | 2346 | Open in IMG/M |
| 3300005842|Ga0068858_100648654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1026 | Open in IMG/M |
| 3300006038|Ga0075365_10246128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1256 | Open in IMG/M |
| 3300006196|Ga0075422_10188622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 842 | Open in IMG/M |
| 3300006577|Ga0074050_12057709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1032 | Open in IMG/M |
| 3300006845|Ga0075421_102623234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
| 3300006846|Ga0075430_100655663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 865 | Open in IMG/M |
| 3300006846|Ga0075430_101707747 | Not Available | 517 | Open in IMG/M |
| 3300006847|Ga0075431_100162212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. | 2298 | Open in IMG/M |
| 3300006880|Ga0075429_100142732 | All Organisms → cellular organisms → Bacteria | 2096 | Open in IMG/M |
| 3300009098|Ga0105245_11599086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
| 3300009098|Ga0105245_11710893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas hominis | 681 | Open in IMG/M |
| 3300009098|Ga0105245_12105982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
| 3300009100|Ga0075418_13040029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300009137|Ga0066709_102588999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 680 | Open in IMG/M |
| 3300009137|Ga0066709_103058406 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300009147|Ga0114129_13414970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300009148|Ga0105243_13054295 | Not Available | 507 | Open in IMG/M |
| 3300009156|Ga0111538_11050261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1030 | Open in IMG/M |
| 3300009156|Ga0111538_12645371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
| 3300009157|Ga0105092_10455897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 731 | Open in IMG/M |
| 3300009177|Ga0105248_11521100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 758 | Open in IMG/M |
| 3300009817|Ga0105062_1011730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1390 | Open in IMG/M |
| 3300009820|Ga0105085_1063530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300009837|Ga0105058_1120261 | Not Available | 625 | Open in IMG/M |
| 3300010048|Ga0126373_11025269 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300010048|Ga0126373_12903177 | Not Available | 535 | Open in IMG/M |
| 3300010359|Ga0126376_12343554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 580 | Open in IMG/M |
| 3300010359|Ga0126376_13008626 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300010373|Ga0134128_11465759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 751 | Open in IMG/M |
| 3300010399|Ga0134127_11393432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 772 | Open in IMG/M |
| 3300010400|Ga0134122_13401457 | Not Available | 501 | Open in IMG/M |
| 3300011000|Ga0138513_100034411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 745 | Open in IMG/M |
| 3300012198|Ga0137364_10836813 | Not Available | 695 | Open in IMG/M |
| 3300012285|Ga0137370_10816723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300012285|Ga0137370_10870522 | Not Available | 558 | Open in IMG/M |
| 3300012360|Ga0137375_10713332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 817 | Open in IMG/M |
| 3300012901|Ga0157288_10081726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 836 | Open in IMG/M |
| 3300012908|Ga0157286_10471712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rhizocola → Rhizocola hellebori | 503 | Open in IMG/M |
| 3300012915|Ga0157302_10006558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2687 | Open in IMG/M |
| 3300013100|Ga0157373_11420206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300013296|Ga0157374_10624777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1088 | Open in IMG/M |
| 3300013307|Ga0157372_10061670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4200 | Open in IMG/M |
| 3300013308|Ga0157375_10839653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1066 | Open in IMG/M |
| 3300014325|Ga0163163_11771107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
| 3300014968|Ga0157379_10977143 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300015371|Ga0132258_13801231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
| 3300018053|Ga0184626_10275007 | Not Available | 702 | Open in IMG/M |
| 3300018074|Ga0184640_10322658 | Not Available | 701 | Open in IMG/M |
| 3300018076|Ga0184609_10559210 | Not Available | 516 | Open in IMG/M |
| 3300018077|Ga0184633_10170805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1126 | Open in IMG/M |
| 3300018078|Ga0184612_10212652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1003 | Open in IMG/M |
| 3300018081|Ga0184625_10019585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3218 | Open in IMG/M |
| 3300018081|Ga0184625_10644950 | Not Available | 514 | Open in IMG/M |
| 3300018432|Ga0190275_10673688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1089 | Open in IMG/M |
| 3300018466|Ga0190268_10586659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 785 | Open in IMG/M |
| 3300018469|Ga0190270_12370913 | Not Available | 592 | Open in IMG/M |
| 3300018469|Ga0190270_12541832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300018469|Ga0190270_13442641 | Not Available | 502 | Open in IMG/M |
| 3300020020|Ga0193738_1065698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1075 | Open in IMG/M |
| 3300021073|Ga0210378_10032154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2091 | Open in IMG/M |
| 3300021478|Ga0210402_10824868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 853 | Open in IMG/M |
| 3300022756|Ga0222622_10226182 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1255 | Open in IMG/M |
| 3300022880|Ga0247792_1016298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1199 | Open in IMG/M |
| 3300025327|Ga0209751_10818918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
| 3300025913|Ga0207695_10102692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 2852 | Open in IMG/M |
| 3300025924|Ga0207694_11258035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
| 3300025934|Ga0207686_11550350 | Not Available | 547 | Open in IMG/M |
| 3300026118|Ga0207675_101075023 | Not Available | 824 | Open in IMG/M |
| 3300027561|Ga0209887_1004748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3860 | Open in IMG/M |
| 3300027775|Ga0209177_10170266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 754 | Open in IMG/M |
| 3300027909|Ga0209382_10338878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1687 | Open in IMG/M |
| 3300027909|Ga0209382_11596778 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300027909|Ga0209382_11784006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
| 3300028589|Ga0247818_10215294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1264 | Open in IMG/M |
| 3300028592|Ga0247822_10547111 | Not Available | 921 | Open in IMG/M |
| 3300028710|Ga0307322_10151613 | Not Available | 617 | Open in IMG/M |
| 3300028796|Ga0307287_10147929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 892 | Open in IMG/M |
| 3300028803|Ga0307281_10261782 | Not Available | 637 | Open in IMG/M |
| 3300028875|Ga0307289_10034181 | Not Available | 2009 | Open in IMG/M |
| 3300028876|Ga0307286_10180201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → unclassified Hamadaea → Hamadaea sp. | 763 | Open in IMG/M |
| 3300030336|Ga0247826_10710451 | Not Available | 781 | Open in IMG/M |
| 3300030619|Ga0268386_10155635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1739 | Open in IMG/M |
| 3300031681|Ga0318572_10638513 | Not Available | 634 | Open in IMG/M |
| 3300031740|Ga0307468_100887841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 771 | Open in IMG/M |
| 3300031771|Ga0318546_11347245 | Not Available | 501 | Open in IMG/M |
| 3300031852|Ga0307410_10337690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1200 | Open in IMG/M |
| 3300031858|Ga0310892_11282768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Cryobacterium → Cryobacterium arcticum | 524 | Open in IMG/M |
| 3300031860|Ga0318495_10062918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1650 | Open in IMG/M |
| 3300031903|Ga0307407_10799135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
| 3300031908|Ga0310900_10777147 | Not Available | 773 | Open in IMG/M |
| 3300031910|Ga0306923_12247414 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300032205|Ga0307472_101081833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 757 | Open in IMG/M |
| 3300032770|Ga0335085_10314915 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
| 3300033550|Ga0247829_10840559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 764 | Open in IMG/M |
| 3300034176|Ga0364931_0042004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Terracoccus → Terracoccus luteus | 1370 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.04% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.40% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.39% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.51% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.51% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.88% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.88% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.88% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.88% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.88% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.88% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.88% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725002 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031652 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-40 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICC_01140510 | 2067725002 | Soil | ALLSTGEDRAKAVVDWAWAGFTHERFGRISVRTDAD |
| ICChiseqgaiiFebDRAFT_103108811 | 3300000363 | Soil | AWLAWGAVHLALLSTGEDRAKAMLDWTWAGFSQERPGRISVRTDPP* |
| F24TB_100001781 | 3300000550 | Soil | TVHLALLSTGEDRAKAVVDWTWAGFTHERSGRIQVDETER* |
| JGI1027J12803_1012523342 | 3300000955 | Soil | LLSTGEDRAKAMIDWSWAGVTHERPGRISVQTDEK* |
| JGI10216J12902_1030582821 | 3300000956 | Soil | VHLALLSTGEDRAKALVNWTWSGFTHERAARISIDA* |
| F14TB_1007965112 | 3300001431 | Soil | HLALLSTGEDRAKAVVDWTWAGFTHERAARITVET* |
| Ga0063454_1001528852 | 3300004081 | Soil | ALLSTGEDRAKAMLNWTWAGFSHERPGRISVDTRKPEEVIR* |
| Ga0062593_1017306362 | 3300004114 | Soil | VAEPTRQTANGAVHLALLSTGEDRAKALVDWTWAGFSHERPGRITVRTDQD* |
| Ga0063356_1062849302 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AWGAVHLALLSTGEDRAKAMTDWTWEEFTKERPNRIHVQEPIVQSG* |
| Ga0058862_101205491 | 3300004803 | Host-Associated | SAALAWGAVHLALLSTGEDRAKAVVDWTWAGFTHERSARITVPT* |
| Ga0066388_1072852852 | 3300005332 | Tropical Forest Soil | AWLAWGAVHLALLSTGEDRAKAAVDWTWSGFTHERSGRISVRTDPS* |
| Ga0070692_110588301 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | HLALLSTGEDRAKALIDWTWAGFSHDRPARITVRTDERDAG* |
| Ga0068857_1008192941 | 3300005577 | Corn Rhizosphere | VHLALLSTGEDRAKAVVDWTWAGFTHERSGRIRVDASER* |
| Ga0068857_1017405621 | 3300005577 | Corn Rhizosphere | VHLALLSTGEDRAKALIDWTWAGFSHDRPARITVRTDERDAG* |
| Ga0068863_1001361873 | 3300005841 | Switchgrass Rhizosphere | LALLSTGEDRAKAVVDWTWAGFTHERSGRIRVDASER* |
| Ga0068858_1006486542 | 3300005842 | Switchgrass Rhizosphere | STGEDRAKAMIDWTWAGFSHERAGRISVKTEDAQPAAH* |
| Ga0075365_102461281 | 3300006038 | Populus Endosphere | GAVHLALLSTGEDRAKAVVDWTWSGFSHERSGRISVRTDKP* |
| Ga0075422_101886222 | 3300006196 | Populus Rhizosphere | LALLSTGEDRAKALVNWTWSGFTHERAARISVEA* |
| Ga0074050_120577092 | 3300006577 | Soil | AVHLALLSTGEDRAKAVVNWTWAGFSHERAGRITVSADEE* |
| Ga0075421_1026232342 | 3300006845 | Populus Rhizosphere | AVHLALLSTGEDRAKAVVDWTWSGFSHERSGRISVRTDKP* |
| Ga0075430_1006556632 | 3300006846 | Populus Rhizosphere | LLSTGEDRAKAVVDWTWAGFTHERPGRISVRTERDQD* |
| Ga0075430_1017077471 | 3300006846 | Populus Rhizosphere | HLALLSTGEDRAKAVVDWTWAGFTHERSGRIQVDETER* |
| Ga0075431_1001622121 | 3300006847 | Populus Rhizosphere | TLLSTGEDRAKAVVDWTWAGFTHERAGRISVRTDQD* |
| Ga0075429_1001427321 | 3300006880 | Populus Rhizosphere | AVHLALLSTGEDRARAVVDWTWAGFTHDRAGRIVVDESGD* |
| Ga0105245_115990862 | 3300009098 | Miscanthus Rhizosphere | AVHLALLSTGEDRAKALIDWTWAGFSHERPARITVRDERDAG* |
| Ga0105245_117108931 | 3300009098 | Miscanthus Rhizosphere | MTGTTAALAWGAVHLSLLSTGEDRGKAVVDWTWAGFTHERAQRMTVRTDRD* |
| Ga0105245_121059821 | 3300009098 | Miscanthus Rhizosphere | LLSTGEDRAKAVVDWTWAGFSHERPGRISVDTTE* |
| Ga0075418_130400291 | 3300009100 | Populus Rhizosphere | AVHLALLSTGEDRAKAVVDWAWAGFTHERSGRISVRTDAD* |
| Ga0066709_1025889992 | 3300009137 | Grasslands Soil | WLSWGAVHLALLSTGEDRAKAVIDWTWARFTHERSARITVRTVTK* |
| Ga0066709_1030584062 | 3300009137 | Grasslands Soil | GKAAWVAGGAVQLALLSTGEERAKAVIDWTWAVSTHERAGRITVRTDTK* |
| Ga0114129_134149702 | 3300009147 | Populus Rhizosphere | LLSTGEDRAKAVVDWTWAGFTHERAGRISVRTDQP* |
| Ga0105243_130542952 | 3300009148 | Miscanthus Rhizosphere | LSTGEDRAKAMIDWSWAGFTHDRPGRISVQTDEK* |
| Ga0111538_110502611 | 3300009156 | Populus Rhizosphere | WLAWGAVHLTLLSTGEDRSKAMTDWTWGEFTDRRADRISMRGAE* |
| Ga0111538_126453712 | 3300009156 | Populus Rhizosphere | AWGAVHLALLSTGEDRAKAMVDWTWEEFTKERPNRISIQHESIEVG* |
| Ga0105092_104558971 | 3300009157 | Freshwater Sediment | HLALLSTGEDRAKALVDWTWAGFTHDRPGRITVRTDQD* |
| Ga0105248_115211002 | 3300009177 | Switchgrass Rhizosphere | LAWGAVHLALLSTGEDRAKAVIDWTWAGFSHDRSARIDVRTDKP* |
| Ga0105062_10117302 | 3300009817 | Groundwater Sand | AWGTVHLALLSTGEDRARAVVDWTWAGFTHERSGRIQVDATER* |
| Ga0105085_10635302 | 3300009820 | Groundwater Sand | LSTGEDRAKAIVDWTWAGFTHERSARITVSTDDT* |
| Ga0105058_11202612 | 3300009837 | Groundwater Sand | LLSTGEDRAKAVVDWTWAGFTHERAGRIQVDASER* |
| Ga0126373_110252691 | 3300010048 | Tropical Forest Soil | LSTGEDRAKAIVDWTWAVSTHERAGRITVRTDTK* |
| Ga0126373_129031771 | 3300010048 | Tropical Forest Soil | LAWGAVHLALLSTGEDRAKAVIDWSWAGFTHERADRITVRAGAQ* |
| Ga0126376_123435541 | 3300010359 | Tropical Forest Soil | VAFLGWGAVHLALLSTGEDRTKAVIDWVWGGFTHERSARISVRT* |
| Ga0126376_130086262 | 3300010359 | Tropical Forest Soil | VHLALLSTGEDRAKAVIDWSWAGFTHERTARITVRTDAR* |
| Ga0134128_114657592 | 3300010373 | Terrestrial Soil | AALAWGAVHLALLSTGEDRAKAVVDWTWAGFTHERSARITVPT* |
| Ga0134127_113934322 | 3300010399 | Terrestrial Soil | LLSTGEDRAKAMIDWTWAGFSHERPGRISVDTKDSQPAAR* |
| Ga0134122_134014572 | 3300010400 | Terrestrial Soil | AWGAVHLALLSTGEDRAKAVVDWTGAGFTHDRASRISIDA* |
| Ga0138513_1000344112 | 3300011000 | Soil | GTTAWLAWGTVHLALLSTGEDRAKAVVDWTWAGFTHERSGRIQVDETER* |
| Ga0137364_108368132 | 3300012198 | Vadose Zone Soil | LSTGEDRAKAVVDWTWAGFTRDRSARIAVGAAPQDRK* |
| Ga0137370_108167231 | 3300012285 | Vadose Zone Soil | KAASLAWGAVHLSLLSTGEDRAKAVVDWTWAGFTHERPGRITVRSEEE* |
| Ga0137370_108705222 | 3300012285 | Vadose Zone Soil | IHLALLSTGEDRAKAMIDWSWAGFTHDRPGRISVQTDEK* |
| Ga0137375_107133322 | 3300012360 | Vadose Zone Soil | ASLAWGAVRLALLSTGEDRAKAVVDWTWAGFTHERAGRISVRTDDD* |
| Ga0157288_100817262 | 3300012901 | Soil | VHLALLSTGEDRAKALIDWTWAGFSHERPARITVRTDERDAG* |
| Ga0157286_104717121 | 3300012908 | Soil | FLAWGAVHLALLSTGEDRAKALINWTWSGFTHERAARISVEA* |
| Ga0157302_100065581 | 3300012915 | Soil | TVHLALLSTGEDRAKALVDWTWAGFTHERPGRITVRTQEEAD* |
| Ga0157373_114202062 | 3300013100 | Corn Rhizosphere | LLSTGEDRAKALIDWTWAGFSHDRPARITVRTDERDAG* |
| Ga0157374_106247772 | 3300013296 | Miscanthus Rhizosphere | LALLSTGEDRAKAMVDWTWSGFTHERAGRISVPASELAREAHR* |
| Ga0157372_100616705 | 3300013307 | Corn Rhizosphere | GAVHLALLSTGEDRAKAVVDWTWAGFTHERSARITVPT* |
| Ga0157375_108396532 | 3300013308 | Miscanthus Rhizosphere | ALLSTGEDRAKALIDWTWAGFSHDRPARITVRTDERDAG* |
| Ga0163163_117711071 | 3300014325 | Switchgrass Rhizosphere | AFLAWGAVHLALLSTGEDRAKALVNWTWSGFTHERAARISVEA* |
| Ga0157379_109771432 | 3300014968 | Switchgrass Rhizosphere | MKGKAAFLAWGAVHLALLSTGEDRAKALIEWTWAGFSHERSARFTVRTDERASR* |
| Ga0173483_107520672 | 3300015077 | Soil | WLAWGAVHLALLSTGEDRAKAMTDWTWEEFTKERPNRIHVQEPIVQSG* |
| Ga0132258_138012313 | 3300015371 | Arabidopsis Rhizosphere | VHLALLSTGEDRAKAMINWTWSGFTHERAARISVET* |
| Ga0184626_102750071 | 3300018053 | Groundwater Sediment | LLSTGEDRARAVVDWTWAGFTHERAGRIQVDETER |
| Ga0184640_103226581 | 3300018074 | Groundwater Sediment | HLALLSTGEDRAKAMVNWTWAGFTHERSGRITVKT |
| Ga0184609_105592101 | 3300018076 | Groundwater Sediment | HLSLLSTGEDRARAVVDWTWAGFTHERAGRIQVDETER |
| Ga0184633_101708051 | 3300018077 | Groundwater Sediment | TTAWLAWGTVHLALLSTGEDRAKAVVDWTWAGFTHERSGRIQVDETER |
| Ga0184612_102126522 | 3300018078 | Groundwater Sediment | GTTAWLAWGTVHLALLSTGEDRAKAVVDWTWAGFTHERSGRIQVDETER |
| Ga0184625_100195855 | 3300018081 | Groundwater Sediment | WGSVHLALLSTGEDRAKAVVDWTWAGLTHERGARITVET |
| Ga0184625_106449502 | 3300018081 | Groundwater Sediment | GKSAFLAWGAVHLALLSTGEDRSKAVMDWTWAGFTHERSGRITVKT |
| Ga0190275_106736881 | 3300018432 | Soil | LALLSTGEDRAKAVVAWTWAGFTHERPGRITVKADEGR |
| Ga0190268_105866592 | 3300018466 | Soil | AWLAWGAVHLALLSTGEDRAKAIVDWTWAGFTHERGARISVEA |
| Ga0190270_123709132 | 3300018469 | Soil | WLAWGTVHLSLLSTGEDRARAVVDWTWAGFTHERSGRIQVDETER |
| Ga0190270_125418322 | 3300018469 | Soil | LAWGTVHLALLSTGEDRAKAMVEWSWAGFTHERAGRITVRTDT |
| Ga0190270_134426411 | 3300018469 | Soil | TAWLAWGTVHLALLSTGEDRAKAVVDWTWAGFTHERSGRIQVDATER |
| Ga0193738_10656982 | 3300020020 | Soil | LTGTAAWLAWGTVHLTLLSTGEDRARAVVDWTWAGFTHERAGRIQVDETER |
| Ga0210378_100321543 | 3300021073 | Groundwater Sediment | HLALLSTGEDRAKAVVDWTWAGFTHERSGRIQVDETER |
| Ga0210402_108248682 | 3300021478 | Soil | LALLSTGEDRAKAVIDWTWAGFTHERPNRITVHTDVHEQ |
| Ga0222622_102261822 | 3300022756 | Groundwater Sediment | MLAWGSVYLALLSTGEGRAKAVVEWTWAGFTHERSARISVEA |
| Ga0247792_10162981 | 3300022880 | Soil | GTVHLALLSTGEDRAKALVDWTWAGFTHERPGRITVRTQEEAD |
| Ga0209751_108189181 | 3300025327 | Soil | LLATGEDRAKAMVEWTWSGFSHERSARITVKTDEK |
| Ga0207695_101026921 | 3300025913 | Corn Rhizosphere | LAWGAVHLALLSTGEDRAKAVVDWTWAGFTHERSARITVPT |
| Ga0207694_112580351 | 3300025924 | Corn Rhizosphere | TGEDRAKAMIDWTWAGFSHERAGRISVKTEDAQPAAH |
| Ga0207686_115503501 | 3300025934 | Miscanthus Rhizosphere | HLALLSTGEDRAKALLNWTWAGFTHERSGRITVES |
| Ga0207675_1010750231 | 3300026118 | Switchgrass Rhizosphere | LAWGSVHLALLSTGEDRAKTVLNWTWAGFTHERSGRITVES |
| Ga0207683_115263572 | 3300026121 | Miscanthus Rhizosphere | LTLLSAWEDRTKAMVDWTWSGFSHERPGRILVGDKEK |
| Ga0209887_10047484 | 3300027561 | Groundwater Sand | LLSTGEDRAKAVVDWTWAGFTHERSGRIQVDASER |
| Ga0209177_101702662 | 3300027775 | Agricultural Soil | WGAVHLALRSTGEDRAKAVVDWTWAGFTHERSARITVPT |
| Ga0209382_103388781 | 3300027909 | Populus Rhizosphere | LALLSTGEDRAKAVVDWTWAGFTHERGGRISVRTDQP |
| Ga0209382_115967782 | 3300027909 | Populus Rhizosphere | WGAVHLALLSTGEDRTKAVLDWTWAGFTRERGSRIVVGDKED |
| Ga0209382_117840062 | 3300027909 | Populus Rhizosphere | GRTAWLAWGAVHLALLSTGEDRAKAAVDWTWAGFSHERSGRIHVRTDEP |
| Ga0247818_102152941 | 3300028589 | Soil | HLALLSTGEDRAKAMIDWTWAGFSHERPGRISVDTKDSQPAAR |
| Ga0247822_105471111 | 3300028592 | Soil | LAWGAVHLALLSTGEDRAKSIVNWTWAGFTHERAGRMTVATDET |
| Ga0307322_101516132 | 3300028710 | Soil | ALLSTGEDRAKAMIDWSWAGFTHDRPGRISVQTDEK |
| Ga0307287_101479291 | 3300028796 | Soil | AWLAWGTVHLALLSTGEDRAKAVVDWTWAGFTHERSGRIQVDETER |
| Ga0307281_102617821 | 3300028803 | Soil | ALLSTGEDRAKAVVNWTWAGFTHERSGRIRVDASER |
| Ga0307289_100341813 | 3300028875 | Soil | ALLSTGEDRAKAVVDWTWAGFTHERSGRIRVDASER |
| Ga0307286_101802012 | 3300028876 | Soil | MLASGSVYLALLSTGEGRAKAVVEWTWAGFTHERSARISVEA |
| Ga0247826_107104512 | 3300030336 | Soil | VHLALLSTGEDRAKAVVDWTWAGFTHERSGRIQVDASER |
| Ga0268386_101556351 | 3300030619 | Soil | LLSTGEDRAKAVVDWTWAGFTHERAGRISVRTDED |
| Ga0315553_103068402 | 3300031652 | Salt Marsh Sediment | GLTMTGAKASLAWGAVHLVLLSTGEDRAKAVVNWTWAGLTHERPARISVQTEETREREVA |
| Ga0318572_106385132 | 3300031681 | Soil | AWGSVHLALLSTGEDRAKAVIDWAWAVTTHERSTRITVRTSPK |
| Ga0307468_1008878411 | 3300031740 | Hardwood Forest Soil | TVHLALLSTGEDRAKAVVNWTWAGFTHERAGRIRVDTSER |
| Ga0318546_113472453 | 3300031771 | Soil | LTMRGKSAWLAWGAVHLALLSTGEDRAKAVVDWTWAVSTHERAGRITVRTDTK |
| Ga0307410_103376901 | 3300031852 | Rhizosphere | AVHLALLSTGEDRAKAVVDWTWAGFTHERPGRISVRTDQVERD |
| Ga0310892_112827682 | 3300031858 | Soil | VHLALLSTGEDRAKALVNWTWSGFTHERAARISVEA |
| Ga0318495_100629183 | 3300031860 | Soil | LSTGEDRAKAVIDWTWAGFTHERSNRISVQTDDDKRSES |
| Ga0307407_107991352 | 3300031903 | Rhizosphere | LALLSTGEDRAKAVVDWTWAGFTHERPGRISVRTDQVERD |
| Ga0310900_107771471 | 3300031908 | Soil | LALLSTGEDRAKAVVDWTWAGFTHERSGRIRVDASER |
| Ga0306923_122474142 | 3300031910 | Soil | AWGAVHLALLSTGEDRAKAVVDWTWAVSTHQRAGRITVRTDEK |
| Ga0307472_1010818332 | 3300032205 | Hardwood Forest Soil | HLARLSTGEDRAKAVVNWTWAGFSHERAGRITVSADEE |
| Ga0335085_103149151 | 3300032770 | Soil | MRGKLAWLAWGAVHLALLSTGEDRAKAVVDWTWAVSTHERAGRITVRTDEK |
| Ga0335069_114395692 | 3300032893 | Soil | HGRTMRGKSAWLAWGAVHLALLSTGEDRAKAIVDWTWTVSTHERAGRITVRTDKK |
| Ga0247829_108405592 | 3300033550 | Soil | AWGTVHLALLSTGEDRAKAMVEWTWAGFTHERPGRITVRTDT |
| Ga0364931_0042004_16_135 | 3300034176 | Sediment | VHLALLSTGEDRAKAIVDWTWAGFSHERSARITVRTDDT |
| ⦗Top⦘ |