| Basic Information | |
|---|---|
| Family ID | F081419 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MIAALAAIEYLGRITDKFFEAQMKRAAIRIKVRSQYFPHQ |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 73.68 % |
| % of genes near scaffold ends (potentially truncated) | 23.68 % |
| % of genes from short scaffolds (< 2000 bps) | 85.09 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.526 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.053 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.930 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.912 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF13419 | HAD_2 | 28.07 |
| PF00724 | Oxidored_FMN | 20.18 |
| PF13242 | Hydrolase_like | 14.04 |
| PF00702 | Hydrolase | 7.89 |
| PF04314 | PCuAC | 5.26 |
| PF13683 | rve_3 | 1.75 |
| PF08241 | Methyltransf_11 | 0.88 |
| PF01734 | Patatin | 0.88 |
| PF13649 | Methyltransf_25 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 20.18 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 20.18 |
| COG2847 | Copper(I)-binding protein | Inorganic ion transport and metabolism [P] | 5.26 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.88 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.88 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.53 % |
| All Organisms | root | All Organisms | 39.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.28% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.77% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.02% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.14% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.39% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.63% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.75% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.88% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.88% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022502 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1000055088 | 3300002245 | Forest Soil | MIAVLAAVEYIGRITDRFFEAQMERAAIRIGTRSQRFHSQ* |
| JGIcombinedJ26739_1006431232 | 3300002245 | Forest Soil | MIVAIAAIKYLGQITDRFFEAQMQRAAIRIRVGSQRFPH* |
| Ga0062384_1003586132 | 3300004082 | Bog Forest Soil | MIVAIGAFKYLGQITDRLFEAQMQRAAVRIGVGSQRFPR* |
| Ga0062386_1013132922 | 3300004152 | Bog Forest Soil | LGMGTREPPMIAVLAAIENLGRITDKFFEAQMKRAAIRIKVRSQYFPQE* |
| Ga0066395_107637721 | 3300004633 | Tropical Forest Soil | MIATVAAIKYLGRITDKLFEAQIQRAAIRIRARTQGLPRQ* |
| Ga0066388_1004292413 | 3300005332 | Tropical Forest Soil | MIAAIAAIEYLGRITDKFFEAQMKRAAIRIKVRSQYFPHQ* |
| Ga0066388_1008994972 | 3300005332 | Tropical Forest Soil | MIATVAAIKYLGRITDKLFEAQMQRAEIRIRARTQGLPRQ* |
| Ga0066388_1087986822 | 3300005332 | Tropical Forest Soil | MIAALAAIEYLGRITDKFFEAQMKRAAIRIKVCSQYFPHQIAVSCPT* |
| Ga0070660_1011379712 | 3300005339 | Corn Rhizosphere | MIAALAAIEYLGRITDKFFEAQMKRAAVRISARSHYFPHQ* |
| Ga0008090_154257582 | 3300005363 | Tropical Rainforest Soil | MIAALAAIEYLGRITDKFFEAQMKRAAIRIKVRSQYFPHQ* |
| Ga0070714_1014062391 | 3300005435 | Agricultural Soil | MIAALAAIEYLGRITDKFFEAQMKRAAVRISARSHYSPHQ* |
| Ga0066903_1017454173 | 3300005764 | Tropical Forest Soil | MLAALAAMEYLRRITDKFFEARMQRAAIRIRARSQYFPHR* |
| Ga0066903_1081507591 | 3300005764 | Tropical Forest Soil | MIAALAAIEHLAGIMEFFEAQMQRAAICIRARTQGLPRQ* |
| Ga0070717_106501972 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAALAAFEYLGRITDRFFEAQMQRAAIRTRARTPGVSPE* |
| Ga0075028_1003539972 | 3300006050 | Watersheds | MIAALAAIEYLGRITDKFFEAQMKRAAVRIKVRSQYFPHE* |
| Ga0075029_1001087252 | 3300006052 | Watersheds | MIAVLAAIENLGRITDKFFEAQMKRAAIRIKVRSQYFPQE* |
| Ga0075029_1008131853 | 3300006052 | Watersheds | MIAAFAAIEYLGRITDKFFEAQIKRAAVRIKVRWQYFPHQ* |
| Ga0075017_1008753022 | 3300006059 | Watersheds | MIAVLAAIENLGRITDKFFEAKMKRAAIRIKVRSQYFPQE* |
| Ga0075021_100309223 | 3300006354 | Watersheds | MIAAFAAIEYLGRITDKFFEAQMKRAAVRIKVRSQYFPHQ* |
| Ga0073928_101839691 | 3300006893 | Iron-Sulfur Acid Spring | MIVAIAAVKYLGQITDRFFEAQMQRAAVRIRARSERFPRQEF* |
| Ga0079219_112894431 | 3300006954 | Agricultural Soil | MIAALAAFEYLGRITDRFFEAQMQRAAIRIRARTPGVSPE* |
| Ga0105245_116445062 | 3300009098 | Miscanthus Rhizosphere | MIAALAAIEYLGRITDRFFEAQMQRAAIRIRGRTQSFPRQ* |
| Ga0105245_132848052 | 3300009098 | Miscanthus Rhizosphere | AALAAIEYLGRITDKFFEAQMKRAAVRISARSHYFPHQ* |
| Ga0116222_12576272 | 3300009521 | Peatlands Soil | MIAALAAIEYLGQIADRVFETQMNRAAVRIRARSQAFTHQ* |
| Ga0116218_10430892 | 3300009522 | Peatlands Soil | MIAALAAIEYLGRITDKFFEAQMKRAAIRIKVRSQYFPQE* |
| Ga0116220_102991361 | 3300009525 | Peatlands Soil | SMIAALAAIEYLGRITDKFFEAQMKRAAIRIKVRSQYFPQE* |
| Ga0126379_108240032 | 3300010366 | Tropical Forest Soil | MIAALAAIEYLGRITDKFFEAQMKRAAIQIKVRSQYFPHQ* |
| Ga0134125_101395993 | 3300010371 | Terrestrial Soil | MIAALTAIEYLGRITDKFFEAQMKRAAVRISARSHYFPHQ* |
| Ga0134125_122613262 | 3300010371 | Terrestrial Soil | MIAALAAFEYLGRITDRFFEAQMQRAAIRIRVRTPGVSPE* |
| Ga0136449_1037507081 | 3300010379 | Peatlands Soil | MIAALAAIEYLGQITDKFFEAQMQRAAVRISSRWQYFPHQ* |
| Ga0126350_124183691 | 3300010880 | Boreal Forest Soil | MIVAIAAIKYLGQITDRFFEAQMQRAAVRIRARSERFPRQEF* |
| Ga0150983_110286681 | 3300011120 | Forest Soil | SELKTRSGTMIAVLAAIEYIGRLSDRFFEAQLKRAAIRIEARSLCFPY* |
| Ga0164300_105524532 | 3300012951 | Soil | MIAALAAIEYLGRITDKFFEAQMQRAAIRIRVRSQYFPHQ* |
| Ga0132258_112897821 | 3300015371 | Arabidopsis Rhizosphere | MIAALAASEYLGRITDKFFEAQMQRAAIRIRARTPGVSPE* |
| Ga0132257_1001967161 | 3300015373 | Arabidopsis Rhizosphere | MIAALAAIEYLGRITNKFFEAQMQRAAIRIRARTPGVSPE* |
| Ga0182035_114141752 | 3300016341 | Soil | MIAVLAAMEYVGRLSDKFFEAQLKRAAIRIEARWQCFPY |
| Ga0182032_102162713 | 3300016357 | Soil | MIAALAAIEYLGPITDKFFEAQMKRAAIRIKVRSQYFPHQ |
| Ga0182032_106470202 | 3300016357 | Soil | MIAALAAIEHLGGITEFFEAQMQRAAICIRARTQGLPRQ |
| Ga0187802_100223803 | 3300017822 | Freshwater Sediment | MIAVLAAIENLGRITDKFFEAQMKRAAIRIKVRSQYFPQE |
| Ga0187802_104096622 | 3300017822 | Freshwater Sediment | MIAALAAIEYLGQIADRVFEAQMNRAAVRIRARSQAFTHQ |
| Ga0187818_100805382 | 3300017823 | Freshwater Sediment | MIAALAAIEYLGRITDKFFEAQMQRAAVRIGARSQYFPHQ |
| Ga0187820_12021832 | 3300017924 | Freshwater Sediment | MIAALAAIEYLGRITDKFFEAQMKRAAIRIKVRSQYFPQE |
| Ga0187814_102764201 | 3300017932 | Freshwater Sediment | MIAALAAIEYLGRITDKFFEAQMKRAAVRIKVRSQYFPHQ |
| Ga0187801_100873142 | 3300017933 | Freshwater Sediment | MIAALAAIEYLGRITDKFFEAQMQRAAVRIGSRSQYFPLQ |
| Ga0187819_101173783 | 3300017943 | Freshwater Sediment | MIAALAAIEYLGQIADRVFESQMSRAAVRIRGCSEAFTRQ |
| Ga0187785_103537681 | 3300017947 | Tropical Peatland | MIAALAAFEYLGRITDRFFEAQMQRAAIRIRARTPGVSPE |
| Ga0187779_109077252 | 3300017959 | Tropical Peatland | MIAALAAIEYLGRITDKLFEAQMQRAAIRIRARSQRFPHQ |
| Ga0187783_100643501 | 3300017970 | Tropical Peatland | MIAPLAAFEFLGRITDKFFEAQMQRAAIRIQARSQHFPHQ |
| Ga0187783_101343702 | 3300017970 | Tropical Peatland | MIAALAAIEYLGQITDKFFEAQMKRAGIRIQARSQRFPHQ |
| Ga0187783_113196511 | 3300017970 | Tropical Peatland | MIAVLAVIEYLGRITDKFFEAQLQRAAIRIEARSQCFPY |
| Ga0187781_100032399 | 3300017972 | Tropical Peatland | MIAALAAIEYIGRITDRFFEAQMQRAAIRIKARSQYFHHQ |
| Ga0187781_100318284 | 3300017972 | Tropical Peatland | MIAVLAAIEYLGRLTDKFFEAQLKRAAIRIEARSQCFPY |
| Ga0187780_113240431 | 3300017973 | Tropical Peatland | MIAALAAIEYLGRITDKLFEAQMQRAAIRIRARSQRFPRQ |
| Ga0187765_106355482 | 3300018060 | Tropical Peatland | MIAVLATIEYLGRLSDKFFEAQLKRAAIRIEARWQCFPY |
| Ga0187784_114512252 | 3300018062 | Tropical Peatland | MIAALAAIEYIGRITDKFFEAQMRRAAIRIKARSQYFHHQ |
| Ga0210395_100841833 | 3300020582 | Soil | MIAVFAAIEYLGRVTDSFFEAQMQRAAIRIGSRSGHFHAQ |
| Ga0210395_101581721 | 3300020582 | Soil | IAALAAIEYLGRITDKFFEAQMQRAAIRIRVRSQYFPHQ |
| Ga0210401_108562151 | 3300020583 | Soil | MIAVLAAIEYIGRLSDRFFEAQLKRAAIRIEARSQCFPY |
| Ga0210406_104161991 | 3300021168 | Soil | MIAAFAAIEYLGRITDKFFEAEMKRAAVRIKVRSQYFPHH |
| Ga0210396_103344572 | 3300021180 | Soil | MISVFAAIEYLGRVTDSFFEAQMQRAAIRIGSRSGHFHAQ |
| Ga0210387_100882261 | 3300021405 | Soil | MIAVFAAIEYLGRVTDSFFEAQMQRAAIRIGSRSGHF |
| Ga0210387_108301171 | 3300021405 | Soil | AVLAAVEYIGRITDRFFEAQMERAAIRIGTRSQRFHSQ |
| Ga0210386_104682891 | 3300021406 | Soil | MIAVLAAVEYIGRITDRFFEAQMERAAIRIGTRSQRFHSQ |
| Ga0210383_104412761 | 3300021407 | Soil | MIAALAAIEYLGRITDKFFEAQMQRAAIRVRVRSQYFPHQ |
| Ga0210390_102084172 | 3300021474 | Soil | MIAALAAVEYLGRITDKFFEAQMRRAAIRIGVRSQYFPRQ |
| Ga0210409_101272491 | 3300021559 | Soil | MGTREPPMIAALAAIEYLGRITDKFFEAQMQRAAIRIRVRSHYFPHQ |
| Ga0126371_113877671 | 3300021560 | Tropical Forest Soil | RIKTRSPTMIATVAAIKYLGRITDKLFEAQMQRAEIRIRARTQGLPRQ |
| Ga0126371_129816492 | 3300021560 | Tropical Forest Soil | MIAALAAIEYLGRITDKFFEAQMKRAAIRIKVGSQYFPHQ |
| Ga0242646_10145921 | 3300022502 | Soil | ELKTRSGTMIAVLAAIEYIGRLSDRFFEAQLKRAAIRIEARSQCFPY |
| Ga0242648_10643782 | 3300022506 | Soil | EPPMIAALAAMEYLGRITDKFFEAQMKRAAIRIRVRSQYFPHQ |
| Ga0222729_10726361 | 3300022507 | Soil | LAAIEYLGRITDKFFEAQMKRAAVRIKVRSQYFPHQ |
| Ga0242656_10802761 | 3300022525 | Soil | MIAALAAIEYLGRITDKFFEAQMRRAAIRIKVRSQYFPHQ |
| Ga0242669_11398331 | 3300022528 | Soil | TRSGTMIAVLAAIEYIGRLSDRFFEAQLKRAAIRIEARSQCFPY |
| Ga0242655_101284631 | 3300022532 | Soil | TREPPMIAALAAMEYLGRITDKFFEAQMKRAAIRIRVRSQYFPHH |
| Ga0212123_105264112 | 3300022557 | Iron-Sulfur Acid Spring | MIAAIAAFKYLGQITDRFFEAQMQRAAIRIGARSQRFPH |
| Ga0207687_119513321 | 3300025927 | Miscanthus Rhizosphere | AALAAIEYLGRITDKFFEAQMKRAAVRISARSHYFPHQ |
| Ga0207690_106212922 | 3300025932 | Corn Rhizosphere | MIAALAAIEYLGRITDKFFEAQMKRAAVRISARSHYFPHQ |
| Ga0208042_11453621 | 3300027568 | Peatlands Soil | PSMIAALAAIEYLGRITDKFFEAQMKRAAIRIKVRSQYFPQE |
| Ga0209068_102330302 | 3300027894 | Watersheds | MIAAFAAIEYLGRITDKFFEAQMKRAAVRIKVRSQYFPHQ |
| Ga0209624_101269321 | 3300027895 | Forest Soil | MIVAIAAIKYLGQITDRFFEAQMQRAAIRIRVGSQRFPH |
| Ga0209526_109018841 | 3300028047 | Forest Soil | MIAALAAMEYLGRITDKFFEAQMQRAAIRIKVRSQYFPHQ |
| Ga0308309_100799201 | 3300028906 | Soil | MIAALAAIEYLGRITDKFFEAQMKRAAVRIKVRSQYFPQE |
| Ga0222749_103611343 | 3300029636 | Soil | MIAALAAIEYLGRITDKFFEAQMQRAAIRIRVRSHYFPHQ |
| Ga0310037_100133753 | 3300030494 | Peatlands Soil | MIAALAAIEYLGQIADRVFETQMNRAAVRIRARSQAFTHQ |
| Ga0170834_1037353982 | 3300031057 | Forest Soil | MTAGFAAIEYLGRITDKFFEAQMKRAAVRIKVRSQYFPHQ |
| Ga0170824_1026176832 | 3300031231 | Forest Soil | MIAALAAIDYLGRITDKFFEAQMKRAAVRIKVRSQYFPHQ |
| Ga0170824_1201294571 | 3300031231 | Forest Soil | AAIEYLGGITDKFFEAQMKRAAVRIKVRSQYFPHQ |
| Ga0170820_128658282 | 3300031446 | Forest Soil | MIAALAAIEYLGRITDKFFEALMKRAAVRIKVRSQYFPHQ |
| Ga0170818_1099262962 | 3300031474 | Forest Soil | GMGTREPPMIAAFAAIEYLGGITDKFFEAQMKRAAVRIKVRSQYFPHQ |
| Ga0318528_102940322 | 3300031561 | Soil | MIAALAAIEYLGRITDKFFEAQMKRAAIRIKVRSQYFPHQ |
| Ga0310686_1004443702 | 3300031708 | Soil | MIAVLATINYLGRITDRFFESQMQRAAVRIRTNSQRFHQQ |
| Ga0306917_108228472 | 3300031719 | Soil | MIAVLAAMEYVGRLSDKFFEAQLKRAAIRIEACSQCFPY |
| Ga0306918_109629002 | 3300031744 | Soil | GVTPMIAALAAIEYLGRITDKFFEAQMKRAAIRIKVRSQYFPYQ |
| Ga0307475_109978941 | 3300031754 | Hardwood Forest Soil | GTREPPMIAAFAPIEYLGRITDKFFEAQMKRAAVRIKVRSQYFPHQ |
| Ga0307478_110057182 | 3300031823 | Hardwood Forest Soil | MIAAFAPIEYLGRITDKFFEEQMKRAAVRIKVRSQYFPHQ |
| Ga0307478_110728641 | 3300031823 | Hardwood Forest Soil | MIAALAAIKFLSQLTDRFFEAQMQRAAIKIDARSQRFRR |
| Ga0306919_107740812 | 3300031879 | Soil | TRSHSVIAALAAIEYLGRITDKFFEAQMKRAAIRIKVRSQYFPHQ |
| Ga0306925_110442281 | 3300031890 | Soil | TMIAALAAIEHLGGITEFFEAQMQRAAICIRARTQGLPRQ |
| Ga0306923_104822672 | 3300031910 | Soil | VIAALAAIEYLGRITDKFFEAQMKRAAIRIKVRSQYFPYQ |
| Ga0306923_113104872 | 3300031910 | Soil | PTMIAALAAIEHLGGITEFFEAQMQRAAICIRARTQGLPRQ |
| Ga0310916_104091622 | 3300031942 | Soil | VIAALAAIEYLGPITDKFFEAQMKRAAIRIKVRSQYFPHQ |
| Ga0310913_102275232 | 3300031945 | Soil | MIAALAAIEYLGRITDKFFEGQMKRAAIRIKVRSQYFPYQ |
| Ga0310910_108346381 | 3300031946 | Soil | DGKKELTMIAALAATEYLGRITDKFFEAPMKRAAIRIKVRSQYFPHQ |
| Ga0310909_111545291 | 3300031947 | Soil | MIAALAAIEYLGRITDKFFEARMKCAAIRIKVRSQYFPYQ |
| Ga0306926_110043312 | 3300031954 | Soil | MIAALAAIEHLSGITEFFDAQMQRAAICIRARTQGLPRQ |
| Ga0307479_103975761 | 3300031962 | Hardwood Forest Soil | MGTREPPTVAAFAAIEYLGRITDKFFEAQMKRAAVRIKVRSQYFPHQ |
| Ga0318556_105370772 | 3300032043 | Soil | MIAALAAIEYLGRITDKFFEGQMKRAAIRIKVRSQYFPCQ |
| Ga0306924_113936712 | 3300032076 | Soil | MIAALAAIEYLGRITDKFFEAQMKRAAIRIKVRSQYFPYQ |
| Ga0311301_100869469 | 3300032160 | Peatlands Soil | TREPSMIAALAAIEYLGRITDKFFEAQMKRAAIRIKVRSQYFPQE |
| Ga0311301_104671492 | 3300032160 | Peatlands Soil | MIAALAAMEYLGRITDKFFEAQMKRAAIRIKVRSQYFPQE |
| Ga0306920_1016058162 | 3300032261 | Soil | ERTQTRSGTMIAVLAAMEYVGRLSDKFFEAQLKRAAIRIEACSQCFPY |
| Ga0306920_1018294732 | 3300032261 | Soil | MIAALAATEYLGRITDKFFEAPMKRAAIRIKVRSQYFPHQ |
| Ga0306920_1033959862 | 3300032261 | Soil | MIATVAAIKYLGRITDKLFEAQMQRAAIRIRARTQGLPRQ |
| Ga0335072_101484365 | 3300032898 | Soil | MIAVLAAVEYLGRITDSFFEAQMQRAAIRIGTRSQRFHAR |
| ⦗Top⦘ |