NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F081412

Metagenome / Metatranscriptome Family F081412

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081412
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 106 residues
Representative Sequence MEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMTVSDYNKGRSVSDLKLKTWEHGKAGNLRSDSVWEDDRYNPTKYSHPHRYDNVNFPDQEYKDIFGGTMGTAEANE
Number of Associated Samples 100
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 21.05 %
% of genes near scaffold ends (potentially truncated) 51.75 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.368 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(14.035 % of family members)
Environment Ontology (ENVO) Unclassified
(29.825 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(42.982 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.76%    β-sheet: 1.47%    Coil/Unstructured: 61.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF01221Dynein_light 1.75
PF07626PSD3 0.88



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005417|Ga0068884_1445355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella520Open in IMG/M
3300005758|Ga0078117_1042337All Organisms → Viruses → Predicted Viral1077Open in IMG/M
3300005988|Ga0075160_10081648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1778Open in IMG/M
3300006102|Ga0075015_100377734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella795Open in IMG/M
3300006355|Ga0075501_1022323All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella738Open in IMG/M
3300006415|Ga0099654_10760857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella607Open in IMG/M
3300006917|Ga0075472_10634504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella536Open in IMG/M
3300007863|Ga0105744_1107447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani690Open in IMG/M
3300007957|Ga0105742_1021565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani750Open in IMG/M
3300008021|Ga0102922_1226049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella588Open in IMG/M
3300008113|Ga0114346_1165007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella928Open in IMG/M
3300008113|Ga0114346_1296151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella561Open in IMG/M
3300008120|Ga0114355_1134888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella904Open in IMG/M
3300008958|Ga0104259_1016437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella718Open in IMG/M
3300008998|Ga0103502_10276371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani618Open in IMG/M
3300009159|Ga0114978_10257046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1083Open in IMG/M
3300009161|Ga0114966_10239911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1125Open in IMG/M
3300009193|Ga0115551_1511815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila511Open in IMG/M
3300009233|Ga0103856_10113491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella520Open in IMG/M
3300009269|Ga0103876_1042728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia627Open in IMG/M
3300009436|Ga0115008_10511844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani858Open in IMG/M
3300009436|Ga0115008_10539756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella835Open in IMG/M
3300009497|Ga0115569_10127163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1248Open in IMG/M
3300009526|Ga0115004_10192278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1224Open in IMG/M
3300009592|Ga0115101_1703340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea858Open in IMG/M
3300009606|Ga0115102_10077145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300009679|Ga0115105_11275642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella588Open in IMG/M
3300010305|Ga0129320_154200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella671Open in IMG/M
3300012212|Ga0150985_100086040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella664Open in IMG/M
3300012413|Ga0138258_1612941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila611Open in IMG/M
3300012469|Ga0150984_117484900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella636Open in IMG/M
3300012724|Ga0157611_1292218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella509Open in IMG/M
3300012757|Ga0157628_1067030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella532Open in IMG/M
3300013087|Ga0163212_1087980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1006Open in IMG/M
3300017783|Ga0181379_1130536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella905Open in IMG/M
3300018426|Ga0181566_10348483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1062Open in IMG/M
3300018684|Ga0192983_1020520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea877Open in IMG/M
3300018710|Ga0192984_1039284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella962Open in IMG/M
3300018982|Ga0192947_10101850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella951Open in IMG/M
3300018996|Ga0192916_10099685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella868Open in IMG/M
3300018997|Ga0193257_10083305All Organisms → Viruses → Predicted Viral1017Open in IMG/M
3300019007|Ga0193196_10178532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella909Open in IMG/M
3300019019|Ga0193555_10248165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea574Open in IMG/M
3300019033|Ga0193037_10117532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella836Open in IMG/M
3300019045|Ga0193336_10281649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani721Open in IMG/M
3300019053|Ga0193356_10354039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella513Open in IMG/M
3300019151|Ga0192888_10110658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella912Open in IMG/M
3300019151|Ga0192888_10125725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella841Open in IMG/M
3300019201|Ga0180032_1039244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea880Open in IMG/M
3300019282|Ga0182075_1811522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea520Open in IMG/M
3300020221|Ga0194127_10379885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea937Open in IMG/M
3300020578|Ga0194129_10404599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella714Open in IMG/M
3300021108|Ga0214162_1023338All Organisms → Viruses → Predicted Viral1090Open in IMG/M
3300021340|Ga0194041_10277453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella509Open in IMG/M
3300021359|Ga0206689_11039720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella942Open in IMG/M
3300021910|Ga0063100_1066878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1008Open in IMG/M
3300021910|Ga0063100_1079675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella655Open in IMG/M
3300024343|Ga0244777_10797032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella558Open in IMG/M
3300024343|Ga0244777_10854267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella534Open in IMG/M
3300024346|Ga0244775_11248333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila577Open in IMG/M
3300024542|Ga0256350_1103749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea510Open in IMG/M
3300025283|Ga0208048_1059011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella896Open in IMG/M
3300025451|Ga0208426_1057877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella598Open in IMG/M
3300025690|Ga0209505_1056250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1247Open in IMG/M
3300026448|Ga0247594_1077895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300026448|Ga0247594_1083333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella559Open in IMG/M
3300026495|Ga0247571_1164834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300026573|Ga0255269_1150528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella624Open in IMG/M
3300027159|Ga0208020_1087091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila550Open in IMG/M
3300027712|Ga0209499_1105049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1068Open in IMG/M
3300027781|Ga0209175_10070680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1493Open in IMG/M
3300027781|Ga0209175_10480648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella513Open in IMG/M
3300027805|Ga0209229_10157285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1023Open in IMG/M
3300027816|Ga0209990_10332773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella673Open in IMG/M
3300027899|Ga0209668_10568398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella756Open in IMG/M
3300028137|Ga0256412_1397043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300028282|Ga0256413_1193322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea731Open in IMG/M
3300030572|Ga0210258_10733240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella572Open in IMG/M
3300030591|Ga0247626_1195841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella576Open in IMG/M
3300030599|Ga0247630_1074973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella718Open in IMG/M
3300030599|Ga0247630_1141414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella595Open in IMG/M
3300030609|Ga0247634_10155562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella780Open in IMG/M
3300030609|Ga0247634_10453203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella551Open in IMG/M
3300030626|Ga0210291_10860731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella770Open in IMG/M
3300030635|Ga0247627_10228099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella589Open in IMG/M
3300030715|Ga0308127_1042365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea561Open in IMG/M
3300030738|Ga0265462_11819000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella584Open in IMG/M
3300030741|Ga0265459_11136856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella843Open in IMG/M
3300030741|Ga0265459_13872881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella525Open in IMG/M
3300030743|Ga0265461_12597531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella600Open in IMG/M
3300030778|Ga0075398_11459444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea739Open in IMG/M
3300030847|Ga0075405_11421526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella667Open in IMG/M
3300030958|Ga0073971_10735393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella676Open in IMG/M
3300030971|Ga0075375_11665800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella659Open in IMG/M
3300031231|Ga0170824_113711615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella508Open in IMG/M
3300031231|Ga0170824_119735089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella535Open in IMG/M
3300031231|Ga0170824_120222050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1126Open in IMG/M
3300031446|Ga0170820_17841785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella687Open in IMG/M
3300031524|Ga0302320_10942311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella927Open in IMG/M
3300031540|Ga0308143_112419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella860Open in IMG/M
3300031569|Ga0307489_10265856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1094Open in IMG/M
3300031569|Ga0307489_10996781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300031626|Ga0302121_10189319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea585Open in IMG/M
3300031710|Ga0307386_10629901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella570Open in IMG/M
3300031734|Ga0307397_10484136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella577Open in IMG/M
3300031750|Ga0307389_11147622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300031758|Ga0315907_10436575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1048Open in IMG/M
3300031758|Ga0315907_11152469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella547Open in IMG/M
3300031784|Ga0315899_11456546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella576Open in IMG/M
3300032092|Ga0315905_11544142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300032589|Ga0214500_1103533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella810Open in IMG/M
3300032756|Ga0315742_12477141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella591Open in IMG/M
3300033984|Ga0334989_0507996All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella597Open in IMG/M
3300034118|Ga0335053_0680781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella581Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine14.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.16%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine10.53%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.26%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.39%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.39%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil4.39%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.51%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.51%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.63%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.63%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.63%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent2.63%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.75%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.75%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.75%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.75%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.75%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.88%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.88%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.88%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.88%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.88%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.88%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.88%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.88%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.88%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.88%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.88%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.88%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.88%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.88%
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere0.88%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.88%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.88%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005417Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007957Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_3.0umEnvironmentalOpen in IMG/M
3300008021Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3EnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009233Microbial communities of water from Amazon river, Brazil - RCM9EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010305Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012724Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012757Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018710Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809766-ERR1740136)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019019Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300019201Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019282Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020578Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35mEnvironmentalOpen in IMG/M
3300021108Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300021340Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-9mEnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024542Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025283Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes)EnvironmentalOpen in IMG/M
3300025451Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027712Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030572Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030591Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030599Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030609Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030626Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030635Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030715Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1295_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030778Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030847Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030958Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030971Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031540Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_544_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032589Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0068884_144535513300005417Freshwater LakeGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPE*
Ga0078117_104233723300005758Lake WaterMCAAKNSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKFSHPHRYDNVNFEE*
Ga0075160_1008164833300005988Wastewater EffluentMEVCPEHVLEGLREKKKWHLRAEVIDNDTYKRAMQVSDYNRGRSVTDLKLKTWEHGKAGYLRSDTYWQDDRYDPVKYPHNHRYDNVNFPDQEYRDIFGGTLGQYEQKE*
Ga0075015_10037773413300006102WatershedsMEVCPDHVLEGLREKKKWYLRAEVIDNETYKRAMIVGPYNKNRSVSELKLKTWEHGKGGNLRSDSLWQDDRYNPTKYSHPHRYDNVNFPD*
Ga0075501_102232313300006355AqueousMEVCPEHVLEGLRERRKFYLRAEAIDNATYKRAMTVSDYNKGRSVSDLHIKDWSFGHPSKLRSDSTWQDDRYDVRKYPHPHRYDNINFPEQEY
Ga0099654_1076085723300006415LakeMEVCPDHVLEGLREKRKWYLRAELIDNQTYKRAMKVGDYNKNRSVSDLVIKDWSYGHPKNLRSESVWQDDRYNPATYPHAHRYDNENKLFKD*
Ga0075472_1063450413300006917AqueousMEVCPEHVLEGLRERRKFYLRAEAIDNATYKRAMTVSDYNKGRSVSDLHIKDWSFGHPSKLRSDSTWQDDRYDVRKYPHPHRYDNINFPEQEYKDVFGGTLGEGAKAERDKHAIG
Ga0105744_110744713300007863Estuary WaterMEVCPDHILEALREKRKWMLRAQTIDNETYKRAMVVGDYNKGKSVSDLNIKDWSYGTAKNMRSDSTWEDDRYDPTKFPHPHRYDNVNFKE*
Ga0105742_102156513300007957Estuary WaterMEVCPDHILEALREKRKWMLRAQTIDNETYKRAMVVGDYNKGKSVSDLNIKDWSYGTAKNMRSDSTWEDDRYDPTKFSHPHRYDNVNFKE*
Ga0102922_122604913300008021EstuarineAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMTVSDYNQGRSVSDLTLKTWEHGKQLRSDSVWQDDRYNPTQYSHPHRYDNTNFKD*
Ga0114346_116500723300008113Freshwater, PlanktonMEVCPDHVLEGLREKKKHLLRAEAIDNEAYKRAMTVSDYNKGRSVSDLQLKTWDYGKKLRTDSWYADDRWNPTKYSHPHRYDNVNFPEQEYKDFFGGTLGEADAAEQQRYKLDLSGASS*
Ga0114346_129615113300008113Freshwater, PlanktonDKISIMEVCPDHILEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRNRSVSDLKLKTWDWGKTANLRSDGLWQDDRWDPTAYSHPHRYDNVNFPEQEYKDFFGGTIGTAEAEEYERHRLDSSGNSQAIRQH*
Ga0114355_113488823300008120Freshwater, PlanktonLRAEAIDNEAYKRAMTVSDYNKGRSVSDLQLKTWDYGKKLRTDSWYADDRWNPTKYSHPHRYDNVNFPEQEYKDFFGGTLGEADAAEQQRYKLDLSGASS*
Ga0104259_101643713300008958Ocean WaterMEVCPEHVLEGLREKRKWMLRAQAIDNETYKRAMTVSDFNKGKSVSDLHIKDWSYGHAKNLRSDSTWEDDRYDPLKYSHPHRNDNVNFPEQ
Ga0103502_1027637113300008998MarineTYRRAMQVSDFNRGRSVSDLKLKTWEYGTMKNLRSDTLYQDDRYDPTKFSHPHRYDNVNFPEQEYKDFFGGTMGTKTPSPSQATPKMNMSER*
Ga0114978_1025704623300009159Freshwater LakeMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSHLKLKTWDYGKTANLRSDSIWQDDRYDPTKFSHPHRYDNVNFEE*
Ga0114966_1023991123300009161Freshwater LakeMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDFNKGRSVTDLQLKTWEHGKGGHLRSDSLWEDDRYNPVKHSHPHRYDNVNFPEQEYKDIFGGTLGTAEAKEQEYFAVHIAGKSKATQDWSRQ*
Ga0115551_151181513300009193Pelagic MarineVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNKGKSVSDLEIKDWSYGHPKNLRTDTTWEDDRYNPRKYPHPHRYDNVNFPEQEYKDVFGGTLGTAMGEELKKN*
Ga0103856_1011349113300009233River WaterMEVCPDHVLEGLREKKKHMLRAESIDNETYKRAMTVSDFNRGRSVSDLHLKTWDYGKHLRGDSWYQDDRWNPVKYSHPHRYDNVNFPEQEFTDIFGGTRGEGETAEREKYKLNFSGSTQKVIQDF*
Ga0103876_104272813300009269Surface Ocean WaterMEVCPDHILELLREKKKWLLRAEVIDNETYRRAMEVSDFNRGRSVSDLTLKTWEDGMAHKLRSDSMYQDDRWVPTKYSHAHRRDNVNFKEQEYSDFFGGTVGTAAKAEQDRHEIKMGSDQS*
Ga0115008_1051184423300009436MarineMEVCPDHVLESLREKRKWYLRAQAIDNETYKRAMKVSDFNKGKSVSDLSIKDWSYGCAKNMRSDSTWEDDRYDPLKYSHPHRYDNVNFPEQEYTDVFGGTK
Ga0115008_1053975623300009436MarineMCAAKENKEACLADKISIMEVCPDHVLEGLREKKKWYLRAESIDNETYKRAMTVGDYNRGRSVSNLNMKTWAHGKTLRSDSTWEDDRWNPTVYKHPHRNDGQNNPEQEYSDFFGGTHGTQEAKDYED
Ga0115569_1012716323300009497Pelagic MarineMEVCPDHILQALREKRKWMLRAQTIDNETYKRAMVVGDYNKGKSVSDLNIKDWSYGTAKNMRSDSTWEDDRYDPTKFPHPHRYDNVNFKE*
Ga0115004_1019227813300009526MarineMEVCPDHILEALREKRKWMLRAQTIDNETYKRAMVVGDYNKGKSVSDLNIKDWSYGTAKNMRSDSTWEDDRYDPTKFPHPHRYDSVNFKE*
Ga0115101_170334023300009592MarineMEVCPDHILEALREKRKWMLRAQAIDNETYKRAMVVGDYNKGKSVTDLTIRDWTYGSAKNMRSDSTWEDDRYDPTKFPHPHRYDSVNFAE*
Ga0115102_1007714513300009606MarineVSIMEVCPAHVLEGLREKKKHMLRAEVIDNETYKRAMQVSDFNRGRSVSDLQLKTWEYGTMKNLRSDTLYQDDRYDPTQFSHPHRYDNVNFPE*
Ga0115105_1127564213300009679MarineMEVCPDHVLEGLREKKKWYLRAESIDNETYKRAMNVGDYNRGRSVSDLKLKTWAHGKTLRTDSLWEDDRYNPTKFSHPHRYDNVNYPEQEFTDFFGGTKGTAEAEDYKKNELSLRSGQSQAMS
Ga0129320_15420013300010305AqueousMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSHLKLKTWDYGKTANLRSDSIWQDDRYDPTKF
Ga0150985_10008604023300012212Avena Fatua RhizosphereMREKLDIMEVCPDHVLEGLREKKKWYLRAEVIDNETYKRAMTVGDYNKGKSVSDLKLKNWEYGKNGNLRSDSVWQDDRYNPTIYSHPHRFDNVNFPEQEYKDIFGGTIGQAEKKKKKNYDLRFNVKTKAIKKKQ
Ga0138258_161294113300012413Polar MarineMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMLISDYNKGRSVQDLSIKNWAYGHPKNLRSGTTWEDDRYDPKKYPHPHRYDNVNFPDQ*
Ga0150984_11748490013300012469Avena Fatua RhizosphereMCANKNSADACITDKLSIMEVCPDHVLKVSEKKKWYLRAEVIDNETYKRAMTVSDYNRGRSVSELSLKTWEYGKGGRLRSDSIWQDDRYNPTKYSHPHRYDNINFPDQEYKDIFGG
Ga0157611_129221823300012724FreshwaterVAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKFSHPHRYDNVNFPE*
Ga0157628_106703013300012757FreshwaterVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPE*
Ga0163212_108798023300013087FreshwaterMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDYNKGKSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPTKFSHPHRNDNTNFPEQEYKDIFGGTKGTAE*
Ga0181379_113053613300017783SeawaterMEVCPDHVLEGLREKRKWYLRAQAIDNETYKRAMSVSDYNKNRSVSDLTVKDWTYGMPKNLRPDGTFVDDRFDPMKHTGHPHRYDSVNFPDMEYKDVFGGTMGTKA
Ga0181566_1034848313300018426Salt MarshMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNKGKSVSDLEIKDWSYGHPKNLRTDTTWEDDRYNPRKYPHPHRYDNVNFPEQEYKDVFGGTLGTAMGEELKKH
Ga0192983_102052023300018684MarineMEVCPDHVLEELREKKKWHARAEVIDNETYRRAMQVSDYNRGRSVTELKLKTWEYGSTLRTDTLYQDDRYNPTKFSHPHRNDNVNFPEQEYKDFFGGTIGAAKAKEMEKYRMDTFSD
Ga0192984_103928423300018710MarineMEVCPDHVLEGLREKKKWYLRAESIDNETYRRAMEVSDYNRGRSVSELKLKTWDFGTTLRTESTWEDDRYNPTKFSHPHRNDNVNFPD
Ga0192947_1010185023300018982MarineMEVCPDHVLEGLREKKKWYLRAESIDNETYRRAMEVSDYNRGRSVSELKLKTWDYGTTLRTESTWEDDRYNPTKFSHPHRNDNVNFPDQEFTDFFGGTKGTAEAEEYERHRLDMNGRS
Ga0192916_1009968513300018996MarineMEVCPDHVLELLREKKKHMLRSEVIDNETYRRAMQVSDYNRGRSVSQLQLKTWDHGTAANLRSDSLYQDDRYDPTKFSHPHRYDNVNFPEQEFKDFFGGTEGTADREEREKYRLSMTDGSSKAIKDH
Ga0193257_1008330523300018997MarineMSIMEVCPDHVLELLREKKKWMLRAEVIDNDTYRRAMSVSDFNRGRSVSDLKLKTWEYGMAHNLRSDSLYQDDRYLPQKFSHPHRRDNVNFPEQEYSDFFGGTMGTAAAADYEKNRIDVFSDQS
Ga0193196_1017853213300019007MarineMEVCPDHILELLREKKKWFARAEVIDNETYRRAMQVSDYNRGRSVSDLKLKNWTYGDTLRSDSLYQDDRYNPTKYAHPHRYDNVNFPEQEYADFFGGTKGAAVAAER
Ga0193555_1024816523300019019MarineMEVCPDHVLELLREKKKHMLRSEVIDNETYRRAMQVSDYNRGRSVSQLQLKTWDHGTAANLRSDSLYQDDRYDPTKFSHPHRYDNVNFPE
Ga0193037_1011753233300019033MarineMEVCPDHVLEGLREKKKHMLRAEVIDNETYRRAMQVSDFNRGRSVSELQLKTWDYGTMKNLRSETLYQDDRYEPTKFSHPHRYDNVNFPE
Ga0193336_1028164913300019045MarineMEVCPDHVLEGLREKRKWYLRAETIDNQTYKRAMQVSDDNKGRSVADLEIKNWAYGHPKNLRSGTTWEDDRYDPRKYPHPHRYDNVNFPDQEYKDVFGGTMGTAKAAELDK
Ga0193356_1035403923300019053MarineLSIMEVCPNHILEGLAEKKKWYARAEVIDNETYRRAMEVSDFNRGRSISDLKLKTWDYGATLRSDSLYEDDRYVPTKFSHPHRNDNVNFPEQEYKDIFGGTVG
Ga0192888_1011065823300019151MarineMEVCPDHVLELLREKKKHMLRAEVIDNETYKRAMQVSDYNRGRSVSQLQLKTWDHGTAANLRSDSLYQDDRYDPVKFPHPHRYDNVNFPD
Ga0192888_1012572513300019151MarineDKISIMEVCPDHVLEALREKKKWYLRAEVIDNETYKRAMKVGDYNRGRSVSDLNLKTWDHGKAANMRSDSLYQDNRYDPTKFSHPHRYDNVNFPEQEYKDFFGGTMGTA
Ga0180032_103924423300019201EstuarineMCVAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKFSHPHRYDNVNFPE
Ga0182075_181152213300019282Salt MarshMEVCPDHYLEMLREKRKHYLRAEAIDNETYKRAMTVSDFNKGRSVSDLTLKTWDYGNNLRSDSYFQDDRWDATKYSHPHRYDNVNFPEQEYTQASGGTWGEAEEAERERN
Ga0194127_1037988523300020221Freshwater LakeMEVCPDHVLEGLREKKKHLLRAEAIDNEAYKRAMTVSDYNKGRSVSDLQLKTWDYGKKLRTDSWYADDRWNPTKYSHPHRYDNVNFPEQEYKDFFGGNIGEAATAEQERHRLDFSGASS
Ga0194129_1040459913300020578Freshwater LakeMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNSGRSVNDLVLKTWDHGKTANMRSDSFWQDDRYNPIQYSHPHRNDNVNFP
Ga0214162_102333823300021108FreshwaterMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKYSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE
Ga0194041_1027745313300021340Anoxic Zone FreshwaterQMCKSKASEDACFADKISIMEVCPDHVLDALREKKKWYLRAEMIDNDTYKRAMSVSDFNKDRSVSDLKLKTWDYGKTANLRSDSLWQDDRWDPTKFSHPHRNDNVNFPD
Ga0206689_1103972023300021359SeawaterMEVCPDHVLEGLREKKKWYLRAESIDNETYRRAMEVSDYNRGRSVSDLKLKTWDYGTTLRTESTWEDDRYNPTKFSHPHRNDNVNFPD
Ga0063100_106687823300021910MarineMEVCPDHVLEELREKKKWHARAEVIDNETYRRAMQVSDYNRGRSVTELKLKTWDHGATLRSDSFFQDDRYVPTKFSHPHRNDNVNFPE
Ga0063100_107967523300021910MarineMEVCPDHVLEGLREKKKWFARAETIDNETYRRAMQVSDFNRGRSVTDLKLKTWEYGNTLRSDSLYQDDRFDPTKFSHPHRNDNVNFPEQEYKDIFGGTTG
Ga0244777_1079703213300024343EstuarineSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSIWQDDRYDPTKFSHPHRYDNVNFPE
Ga0244777_1085426713300024343EstuarineARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMTVSDYNQGRSVSDLTLKTWEHGKQLRSDSVWQDDRYNPTQYSHPHRYDNTNFKD
Ga0244775_1124833313300024346EstuarineCSQASGKDACFNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMSVSDYNKGKSVSDLEIKDWSYGHPKNLRTDTTWEDDRYNPRKYPHPHRYDNVNFPEQEYKDVFGGTLGTAMGEELKKH
Ga0256350_110374913300024542FreshwaterMEVFPDHVLEGLREKKKHMLRAESIDNETYKRAMTVSDFNRGRSVSDLHLKTWDYGKHLRGDSWYQDDRWNPVKYSHPHRYDNVNFPEQEYSNMIGGTVGEAAAAERERHTLDFTQTT
Ga0208048_105901113300025283FreshwaterLCASKKGTDHCLNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDYNKGKSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPTKFSHPHRNDNTNFPEQEYKDIFGGTKGTAE
Ga0208426_105787713300025451AqueousKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKYSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE
Ga0209505_105625013300025690Pelagic MarineMEVCPDHILEALREKRKWMLRAQTIDNETYKRAMVVGDYNKGKSVSDLNIKDWSYGTAKNMRSDSTWEDDRYDPTKFPHPHRYDNVNFKE
Ga0247594_107789513300026448SeawaterELSKGKGNCLNEKISIMEVCPDHILEGMRENRKWFLIAQAIDNETYKRAMTISDYNKGKSVSDLTIRNWSYGHPSNMRSDSTWEDDRYDPTKFPHPHRYDMVNFPEQEYTDVFGGTKG
Ga0247594_108333313300026448SeawaterTAAAEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAETIDNQTYKRAMQVSEYNKGRSVSELDIKNWAYGHPRNLRTGTTWEDDRYNPRKYPHPHRYDNVNFPDQEYKDVFGGTMGT
Ga0247571_116483413300026495SeawaterILEGMREKRKWFLRAQAIDNETYKRAMTISDYNKGKSVSDLTIRNWSYGHPSNMRSDSTWEDDRYDPTKFPHPHRYDMVNFPEQEYTDVFGGTKG
Ga0255269_115052813300026573FreshwaterMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMTVSDYNKGRSVSDLKLKTWEHGKAGNLRSDSVWEDDRYNPTKYSHPHRYDNVNFPDQEYKDIFGGTMGTAEANE
Ga0208020_108709113300027159EstuarineCFNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMGVSDYNKGKSVSDLEIKDWSYGHPKNLRTDTTWEDDRYNPRKYPHPHRYDNVNFPEQEYKDVFGGTLGTAMGEELKKH
Ga0209499_110504923300027712Freshwater LakeMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSHLKLKTWDYGKTANLRSDSIWQDDRYDPTKFSHPHRYDNVNFEE
Ga0209175_1007068023300027781Wastewater EffluentMEVCPEHVLEGLREKKKWHLRAEVIDNDTYKRAMQVSDYNRGRSVTDLKLKTWEHGKAGYLRSDTYWQDDRYDPVKYPHNHRYDNVNFPDQEYRDIFGGTLGQYEQKE
Ga0209175_1048064813300027781Wastewater EffluentYLRAEVIDNDTYRRAMSVSDYNKGRSVSDLKLKTWAHGKAGALRSDSVWEDDRYSPTSYSHPHRYDSVNFPEMEYKDVFGGTVGEAAKKELDYYKIGLTSGTSKAINEEQLK
Ga0209229_1015728513300027805Freshwater And SedimentNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDYNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPEQEYKDIFGGTKGTAE
Ga0209990_1033277313300027816Freshwater LakeCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPEQEYKDIFGGTKGTAE
Ga0209668_1056839813300027899Freshwater Lake SedimentPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKGRSVSDLQLKTWEHGKGGKLRSDTIWQDDRYNPTKYSHPHRYDNVNFPDQEYKDIFGGTMGTAEQKE
Ga0256412_139704313300028137SeawaterILETMREKRKWMLRAQAIDNETYKRAMSVSDYNAGKSVSDLNIKNWSYGHPSNMRSDSTWEDDRYDPTKFPHPHRYDAINFPEQEYTDVFGGTKGQAA
Ga0256413_119332213300028282SeawaterMEVCPDHILEGMREKRKWFLRAQAIDNETYKRAMTISDYNKGKSVSDLTIRNWSYGHPSNMRSDSTWEDDRYDPTKFPHPHRYDMVNFPEQEYTDVFGGTKG
Ga0210258_1073324023300030572SoilMEICPEHVLEALREKKKWFLRAEMIDNDTYRRAMSVSDYNKGRSVSDLKLKTWAYGSSGALKSDSTWEDDRYDPVKYPHAHRYD
Ga0247626_119584113300030591SoilLREKKKWFLREEVIDNETYKRAMVVGDYNKNRSVSDLKLKSWDYGRSLRSDSLWQDDRYNPTKYSHPHRYDNVNFPEQEYKDVFGGTIGTAEEKEY
Ga0247630_107497313300030599SoilMEVCPDHILENLKEKKKWALRAEVIDNETYKRAMTVGDYNKGRSVSDLKLKTWEYGKGGNLKSDSLWQDDRYNPTKYSHPHRYDNVNFRDQEYRDIFGGTIGHAEKKDFEYYAIGLTTG
Ga0247630_114141413300030599SoilLNDKISIMEVCPDHVLEGLREKKKWYLRAEVIDNETYKRAMSVGVYNKGRSVSDLKLKTWEYGKGGQLRSDSIWQDDRYNPTKFSHPHRYDNVNFPDQEYKDIFGGTIGMQ
Ga0247634_1015556223300030609SoilMEVCPDHVLEGLREKKKWYLRAEVIDNETYKRAMSVGVYNKSRSVSDLKLKTWEYGKGGRLRSDSLWQDDRYNPTKFSHPHRYDNVNFPDQEYKDIFGGTIGMQE
Ga0247634_1045320323300030609SoilMEVCPDHVLEGLREKKKWYLRAEMIDNETYKRAMQVGDYNKGRSVSELKLKTWEYGKGGVMWSDSVWQDDRYNPTKYSHPHRYDNVNFPQQEYKDIFGGTIGTEDQKEMEYY
Ga0210291_1086073113300030626SoilMEVCPEHVLEGLREKKKWYLRAELIDNDTYRRAMQVSDYNKGRSVSELKLKTWAYGKTGALRGDSTWEDDRWSPEKYPHNHRYDSVNFPDMEYRDIIGGTIGDAEKKELEHY
Ga0247627_1022809913300030635SoilAASAGAAKDEVCFNDKINIMEVCPDHVLEGLREKKKWFLRAEVIDNETYKRAMVVGDYNRNRSVSDLQLKSWDYGRSLRSDSLWQDDRYNPTKYSHPHRYDNVNFPEQEYKDVFGGTIGTAEEKEYKEN
Ga0308127_104236513300030715MarineLSIMEVCPDHVLEELREKKKWHARAEVIDNETYRRAMQVSDYNRGRSVTELKLKTWDHGATLRSDSFFQDDRYVPTKFSHPHRNDNVNFPE
Ga0265462_1181900013300030738SoilMCSNKHGADSCFKDKISIMEVCPEHVLEGLREKKKWYLRAELIDNDTYRRAMQVSDYNKGRSVSELKLKTWAYGKTGALRGDSTWEDDRWSPEKYPHNHRYDSVNFPDMEYRDIIGGTIGDAEKKELE
Ga0265459_1113685623300030741SoilMCSSKNGAESCLKDKISIMEICPEHVLEALREKKKWFLRAEMIDNDTYRRAMSVSDYNKGRSVSDLKLKTWAYGSSGALKSDSTWEDDRYDPVKYPHAHRYDSVNFPEMEYKDVFGGTMGEAEKKDIEYH
Ga0265459_1387288113300030741SoilLKERKKWYLRAETIDNETYKRAMSVSSYNQGRSVSDLKLKTWEYGKGGNLRSDSIWQDDRYNPTKYSHPHRYDNVNFPDQEYKDIFGGTIGDAERKEQAHY
Ga0265461_1259753123300030743SoilMEVCPDHVLEGLREKKKWYLRAEVIDNQTYKRAMQVSDYNRGRSVSDLTLKTWEYGKGENLRSDSYWQDDRYNPTKYSHPHRYDNVNFPEQEYRDIFGGTLGHQEEKEK
Ga0075398_1145944423300030778SoilVLEGLREKKKWYLRAEVLDNETYKRAMTVSDYNKGRSVSELKLKTWDYGKAGHLKSDSTWQDDRYNPVKYSHPHRYDSVN
Ga0075405_1142152613300030847SoilMEVCPDHVLEGLREKKKWYLRAEVIDNETYKRAMSVGVYNKGRSVSDLKLKTWEYGKGGRLKSDSLWEDDRYNPTKFSHPHRYDNVNFPDQEYKDIFGGTIGIQE
Ga0073971_1073539313300030958MarineMNEKLSIMEVCPDHILEALREKRKWYLRAQAIDNETYKRAMTVSSYNRGRSVSDLDIKDWTAGHPRNLRPDSAWVDDRYDPKKFSHPHRKDSVNFP
Ga0075375_1166580023300030971SoilCFNDKISIMEVCPEHVLEGLREKKKWYLRAEVLDNETYKRAMTVSDYNKGRSVSELKLKTWDYGKAGHLKSDSTWQDDRYNPVKYSHPHRYDSVNFPE
Ga0170824_11371161523300031231Forest SoilREKKKWYLRAEVIDNETYKRAMKVADYNKNRSVSDLKLKTWEYGKNGFLRSDTVWEDDRYNPSKYSHPHRYDNINFPEQEYKDMLGGTLGDANRKDMEYHRLGLFSGKS
Ga0170824_11973508923300031231Forest SoilMEVCPDHVLEGLREKKKWFLRAELIDNETYKRAMSVSNYNRGRSVTDLKLKTWEHGKGGNLRSDSTWQDDRYNPTKYSHPHRYDSVNFPE
Ga0170824_12022205033300031231Forest SoilMCTSKASAEQCFNDKISIMEVCPEHVLEGLREKKKWYLRAEVLDNETYKRAMTVSDYNKGRSVSELKLKTWDYGKAGHLKSDSTWQDDRYNPVKYSHPHRYDSVNFPE
Ga0170820_1784178523300031446Forest SoilCTSKASAEQCFNDKISIMEVCPEHVLEGLREKKKWYLRAEVLDNETYKRAMTVSDYNKGRSVSELKLKTWDYGKAGHLKSDSTWQDDRYNPVKYSHPHRYDSVNFPE
Ga0302320_1094231113300031524BogMEVCPEHVLEGLREKKKWYLRAEMIDNDTYKRAMSVSDYNKGRSVSELKLKTWAYGKTLRSDSTWEDDRYSPVKYPHPHRYDSVNFPGMEYKDMFGGTVGEADKKDAAYH
Ga0308143_11241923300031540MarineMEVCPEHVLEGLREKRKWMLRAQAIDNETYKRAMTVSDFNKGKSVSDLHIKDWSYGHAKNMRSDSTWEDDRYDPLKYSHPHRYDNVNFPE
Ga0307489_1026585633300031569Sackhole BrineMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMSVSDFNKGKSVSDLEIKDWSYGHPKNLRTDTLWEDDRYNPRKFPHPHRYDNVNFPEQEYKDVFGGTLGTAMGEELKHN
Ga0307489_1099678113300031569Sackhole BrineQSAGQEECFNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMSVSDFNKGKSVSDLEIKDWSYGHPKNLRADTLWEDDRYNPRKFPHPHRYDNVNFPEQEFKDVFGGTLGTGMGEELKHN
Ga0302121_1018931913300031626MarineREKKKWHARAEVIDNETYRRAMQVSDYNRGRSVTELKLKTWDHGATLRSDSFFQDDRYVPTKFSHPHRNDNVNFPE
Ga0307386_1062990113300031710MarineMEVCPDHVLEELREKKKWHARAEVIDNETYRRAMQVSDYNRGRSVTELKLKTWEYGATLRTDTLYQDDRYNPTKFSHPHRNDNVNFPEQEFKDFFGGTIGTAKAKE
Ga0307397_1048413613300031734MarineMEVCPDHVLEGLREKKKWFARAETIDNETYRRAMQVSDYNRGRSVSDLSLKTWTFGENLRSDSYYEDNRYDPMKFSHPHRNDNVNFPEQEYKDFFGGTIGTAAAKDYAKHQMDIMSD
Ga0307389_1114762223300031750MarineMEVCPDHVLESLREKRKWYLRAQAIDNETYKRAMKVSDFNKGKSVTDLQIKNWSYGCAKNMRSDSTWEDDRYDPLKYPHPHRYDNVNYPEQ
Ga0315907_1043657523300031758FreshwaterMEVCPDHVLEGLREKKKHLLRAEAIDNEAYKRAMTVSDYNKGRSVSDLQLKTWDYGKKLRTDSWYADDRWNPTKYSHPHRYDNVNFPEQEYKDFFGGTLGEADAAEQQRYKLDLSGASS
Ga0315907_1115246923300031758FreshwaterKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPE
Ga0315899_1145654613300031784FreshwaterKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPEQEYKDIFGGTKGTAE
Ga0315905_1154414213300032092FreshwaterVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSIWQDDRYDPTKFSHPHRYDNVNFPE
Ga0214500_110353323300032589Switchgrass PhyllosphereMEVCPDHVLEGLREKKRWFLRAEVIDNETYKRAMVVGDYNKNRSVSDLQLKSWDYGKSLRSDSLWQDDRYNPTKYSHPHRYDNVNFPEQEYKDVFGGTIGTAEEKEY
Ga0315742_1247714113300032756Forest SoilEGLREKKKWYLRAEVIDNETYKRAMTVGDYNKGKSVSDLQLKSWDYGKAGNLRADSLWQDDRYNPTKYSHPHRYDNVNFPEQEYKDVFGGTLGQAELKEY
Ga0334989_0507996_223_5553300033984FreshwaterMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKYSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE
Ga0335053_0680781_220_5523300034118FreshwaterMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKYSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.