| Basic Information | |
|---|---|
| Family ID | F081390 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVDVPTQH |
| Number of Associated Samples | 56 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 14.91 % |
| % of genes from short scaffolds (< 2000 bps) | 79.82 % |
| Associated GOLD sequencing projects | 51 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (71.930 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat (69.298 % of family members) |
| Environment Ontology (ENVO) | Unclassified (99.123 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (69.298 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.00% β-sheet: 11.43% Coil/Unstructured: 58.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF10145 | PhageMin_Tail | 38.60 |
| PF02086 | MethyltransfD12 | 1.75 |
| PF05135 | Phage_connect_1 | 1.75 |
| PF04233 | Phage_Mu_F | 0.88 |
| PF05065 | Phage_capsid | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 1.75 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 1.75 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 71.93 % |
| All Organisms | root | All Organisms | 28.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003688|Ga0061020_1098361 | Not Available | 591 | Open in IMG/M |
| 3300005241|Ga0068642_180668 | Not Available | 654 | Open in IMG/M |
| 3300005242|Ga0068639_175219 | Not Available | 545 | Open in IMG/M |
| 3300005245|Ga0068640_101168 | Not Available | 1238 | Open in IMG/M |
| 3300005247|Ga0068637_1107916 | Not Available | 1429 | Open in IMG/M |
| 3300005249|Ga0068645_1147388 | Not Available | 532 | Open in IMG/M |
| 3300005251|Ga0068634_1195538 | Not Available | 525 | Open in IMG/M |
| 3300005452|Ga0068706_1030614 | Not Available | 1096 | Open in IMG/M |
| 3300005452|Ga0068706_1056508 | Not Available | 710 | Open in IMG/M |
| 3300005452|Ga0068706_1082357 | Not Available | 563 | Open in IMG/M |
| 3300005453|Ga0068705_10173160 | Not Available | 527 | Open in IMG/M |
| 3300005638|Ga0068669_1257861 | Not Available | 603 | Open in IMG/M |
| 3300005638|Ga0068669_1289661 | Not Available | 585 | Open in IMG/M |
| 3300006363|Ga0068659_1055918 | Not Available | 2545 | Open in IMG/M |
| 3300006380|Ga0068664_1002832 | Not Available | 684 | Open in IMG/M |
| 3300010179|Ga0124936_1067625 | Not Available | 1330 | Open in IMG/M |
| 3300010183|Ga0124919_1140195 | Not Available | 648 | Open in IMG/M |
| 3300010189|Ga0124915_1008961 | Not Available | 573 | Open in IMG/M |
| 3300010189|Ga0124915_1093900 | Not Available | 655 | Open in IMG/M |
| 3300010193|Ga0124924_1044807 | Not Available | 582 | Open in IMG/M |
| 3300010194|Ga0124921_1107540 | Not Available | 630 | Open in IMG/M |
| 3300010195|Ga0124911_1228301 | Not Available | 515 | Open in IMG/M |
| 3300010196|Ga0124923_1024205 | Not Available | 1085 | Open in IMG/M |
| 3300010197|Ga0124922_1014884 | Not Available | 629 | Open in IMG/M |
| 3300010254|Ga0124938_1168291 | Not Available | 1355 | Open in IMG/M |
| 3300010255|Ga0124910_1062760 | Not Available | 1272 | Open in IMG/M |
| 3300010256|Ga0124939_1126620 | Not Available | 629 | Open in IMG/M |
| 3300010272|Ga0124912_1345649 | Not Available | 525 | Open in IMG/M |
| 3300026237|Ga0209750_1047455 | Not Available | 798 | Open in IMG/M |
| 3300026509|Ga0209809_1032218 | Not Available | 1841 | Open in IMG/M |
| 3300026509|Ga0209809_1037649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1623 | Open in IMG/M |
| 3300026509|Ga0209809_1058441 | Not Available | 1136 | Open in IMG/M |
| 3300026509|Ga0209809_1073521 | Not Available | 947 | Open in IMG/M |
| 3300026509|Ga0209809_1109020 | Not Available | 688 | Open in IMG/M |
| 3300027279|Ga0209691_1020192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1655 | Open in IMG/M |
| 3300031245|Ga0308395_1013821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 2970 | Open in IMG/M |
| 3300031245|Ga0308395_1024312 | Not Available | 1917 | Open in IMG/M |
| 3300031245|Ga0308395_1026883 | All Organisms → Viruses → Predicted Viral | 1773 | Open in IMG/M |
| 3300031245|Ga0308395_1034691 | Not Available | 1453 | Open in IMG/M |
| 3300031245|Ga0308395_1036221 | Not Available | 1405 | Open in IMG/M |
| 3300031245|Ga0308395_1054915 | Not Available | 1025 | Open in IMG/M |
| 3300031245|Ga0308395_1112666 | Not Available | 612 | Open in IMG/M |
| 3300031508|Ga0308394_1073830 | Not Available | 735 | Open in IMG/M |
| 3300031509|Ga0308399_1033093 | Not Available | 1219 | Open in IMG/M |
| 3300031509|Ga0308399_1038469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1102 | Open in IMG/M |
| 3300031509|Ga0308399_1057320 | Not Available | 841 | Open in IMG/M |
| 3300031512|Ga0308397_1001997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 10662 | Open in IMG/M |
| 3300031512|Ga0308397_1007084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 4150 | Open in IMG/M |
| 3300031512|Ga0308397_1052693 | Not Available | 985 | Open in IMG/M |
| 3300031512|Ga0308397_1081131 | Not Available | 722 | Open in IMG/M |
| 3300031513|Ga0308412_1051524 | Not Available | 1417 | Open in IMG/M |
| 3300031513|Ga0308412_1066971 | Not Available | 1168 | Open in IMG/M |
| 3300031513|Ga0308412_1097463 | Not Available | 888 | Open in IMG/M |
| 3300031514|Ga0308390_1004210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 7619 | Open in IMG/M |
| 3300031514|Ga0308390_1083214 | Not Available | 717 | Open in IMG/M |
| 3300031515|Ga0308396_1024269 | Not Available | 1581 | Open in IMG/M |
| 3300031515|Ga0308396_1027716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1438 | Open in IMG/M |
| 3300031515|Ga0308396_1075074 | Not Available | 708 | Open in IMG/M |
| 3300031515|Ga0308396_1125007 | Not Available | 501 | Open in IMG/M |
| 3300031516|Ga0308398_1008588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 3696 | Open in IMG/M |
| 3300031516|Ga0308398_1012812 | Not Available | 2767 | Open in IMG/M |
| 3300031516|Ga0308398_1123664 | Not Available | 546 | Open in IMG/M |
| 3300031518|Ga0308389_1124601 | Not Available | 554 | Open in IMG/M |
| 3300031568|Ga0308393_1062435 | Not Available | 843 | Open in IMG/M |
| 3300031767|Ga0308401_1031241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1138 | Open in IMG/M |
| 3300031767|Ga0308401_1114134 | Not Available | 512 | Open in IMG/M |
| 3300031776|Ga0308415_1001526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 9856 | Open in IMG/M |
| 3300031776|Ga0308415_1026729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1591 | Open in IMG/M |
| 3300031776|Ga0308415_1089426 | Not Available | 638 | Open in IMG/M |
| 3300031783|Ga0308418_1001624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 11647 | Open in IMG/M |
| 3300031783|Ga0308418_1019585 | Not Available | 2067 | Open in IMG/M |
| 3300031783|Ga0308418_1051974 | Not Available | 998 | Open in IMG/M |
| 3300031812|Ga0308411_10003195 | Not Available | 10970 | Open in IMG/M |
| 3300031812|Ga0308411_10006216 | All Organisms → cellular organisms → Bacteria | 7680 | Open in IMG/M |
| 3300031812|Ga0308411_10013685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 4805 | Open in IMG/M |
| 3300031812|Ga0308411_10066855 | Not Available | 1519 | Open in IMG/M |
| 3300031812|Ga0308411_10090517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1202 | Open in IMG/M |
| 3300031812|Ga0308411_10133300 | Not Available | 901 | Open in IMG/M |
| 3300031812|Ga0308411_10283077 | Not Available | 536 | Open in IMG/M |
| 3300031812|Ga0308411_10308205 | Not Available | 507 | Open in IMG/M |
| 3300031830|Ga0308409_1009532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 3154 | Open in IMG/M |
| 3300031830|Ga0308409_1024864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1674 | Open in IMG/M |
| 3300031830|Ga0308409_1050031 | Not Available | 1039 | Open in IMG/M |
| 3300031830|Ga0308409_1089000 | Not Available | 698 | Open in IMG/M |
| 3300031865|Ga0308408_1010920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 2816 | Open in IMG/M |
| 3300031865|Ga0308408_1017933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 2024 | Open in IMG/M |
| 3300031865|Ga0308408_1066608 | Not Available | 845 | Open in IMG/M |
| 3300031875|Ga0308405_1001221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 13172 | Open in IMG/M |
| 3300031878|Ga0308404_1006450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 2967 | Open in IMG/M |
| 3300031948|Ga0308406_1028159 | Not Available | 1388 | Open in IMG/M |
| 3300031948|Ga0308406_1043875 | Not Available | 1033 | Open in IMG/M |
| 3300031948|Ga0308406_1074160 | Not Available | 722 | Open in IMG/M |
| 3300031950|Ga0308417_1008848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 5746 | Open in IMG/M |
| 3300031950|Ga0308417_1010856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 5058 | Open in IMG/M |
| 3300031950|Ga0308417_1083749 | Not Available | 1178 | Open in IMG/M |
| 3300031950|Ga0308417_1199040 | Not Available | 627 | Open in IMG/M |
| 3300031950|Ga0308417_1253769 | Not Available | 529 | Open in IMG/M |
| 3300031966|Ga0308420_1077966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1115 | Open in IMG/M |
| 3300031966|Ga0308420_1085973 | Not Available | 1040 | Open in IMG/M |
| 3300031966|Ga0308420_1201546 | Not Available | 569 | Open in IMG/M |
| 3300031980|Ga0308403_1019842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1567 | Open in IMG/M |
| 3300031980|Ga0308403_1057331 | Not Available | 797 | Open in IMG/M |
| 3300031980|Ga0308403_1059027 | Not Available | 782 | Open in IMG/M |
| 3300032033|Ga0308402_1013321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1892 | Open in IMG/M |
| 3300032034|Ga0308407_1068087 | Not Available | 769 | Open in IMG/M |
| 3300032034|Ga0308407_1103322 | Not Available | 579 | Open in IMG/M |
| 3300032045|Ga0308400_1000772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 11269 | Open in IMG/M |
| 3300032058|Ga0308419_1065228 | Not Available | 1179 | Open in IMG/M |
| 3300032058|Ga0308419_1082995 | Not Available | 968 | Open in IMG/M |
| 3300032356|Ga0308414_1001122 | All Organisms → cellular organisms → Bacteria | 17438 | Open in IMG/M |
| 3300032356|Ga0308414_1047725 | Not Available | 1824 | Open in IMG/M |
| 3300033886|Ga0308413_002489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 9372 | Open in IMG/M |
| 3300033886|Ga0308413_088258 | Not Available | 793 | Open in IMG/M |
| 3300034649|Ga0372972_008304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1962 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Hot Spring Phototrophic Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat | 69.30% |
| Anoxygenic And Chlorotrophic Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat | 21.93% |
| Anoxygenic And Chlorotrophic | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic | 8.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003688 | Coassembly of YNP Bryant MS undermat 2012 and YNP Bryant MS upper layer 2012 | Environmental | Open in IMG/M |
| 3300005241 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0800_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005242 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0300_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005245 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0600_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005247 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2000_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005249 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005251 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005452 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG | Environmental | Open in IMG/M |
| 3300005453 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG | Environmental | Open in IMG/M |
| 3300005638 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006363 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0600_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006380 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010179 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_B MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010183 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0700_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010189 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2000_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010193 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300(2)_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010194 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010195 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010196 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010197 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1000_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010254 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_B MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010255 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010256 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500(2)_B MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010272 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300026237 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026509 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027279 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031245 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_P4 | Environmental | Open in IMG/M |
| 3300031508 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_me2 | Environmental | Open in IMG/M |
| 3300031509 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-60 | Environmental | Open in IMG/M |
| 3300031512 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T8 | Environmental | Open in IMG/M |
| 3300031513 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST1-BottomLayer | Environmental | Open in IMG/M |
| 3300031514 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_149 | Environmental | Open in IMG/M |
| 3300031515 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_Pe2 | Environmental | Open in IMG/M |
| 3300031516 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T9 | Environmental | Open in IMG/M |
| 3300031518 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_148 | Environmental | Open in IMG/M |
| 3300031568 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050630_ee2 | Environmental | Open in IMG/M |
| 3300031767 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M1 | Environmental | Open in IMG/M |
| 3300031776 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS55 | Environmental | Open in IMG/M |
| 3300031783 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090729_R4cd | Environmental | Open in IMG/M |
| 3300031812 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-BottomLayer | Environmental | Open in IMG/M |
| 3300031830 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe4 | Environmental | Open in IMG/M |
| 3300031865 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe3 | Environmental | Open in IMG/M |
| 3300031875 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MS13 | Environmental | Open in IMG/M |
| 3300031878 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M4 | Environmental | Open in IMG/M |
| 3300031948 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe1 | Environmental | Open in IMG/M |
| 3300031950 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS65 | Environmental | Open in IMG/M |
| 3300031966 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS55 | Environmental | Open in IMG/M |
| 3300031980 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M3 | Environmental | Open in IMG/M |
| 3300032033 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M2 | Environmental | Open in IMG/M |
| 3300032034 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe2 | Environmental | Open in IMG/M |
| 3300032045 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-65 | Environmental | Open in IMG/M |
| 3300032058 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS50 | Environmental | Open in IMG/M |
| 3300032356 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS50 | Environmental | Open in IMG/M |
| 3300033886 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090729_t10cd | Environmental | Open in IMG/M |
| 3300034649 | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1400_MSt11 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0061020_10983611 | 3300003688 | Anoxygenic And Chlorotrophic Microbial Mat | MRRDQRLMSPFRAQRREVLRHALKRQTVKRVGRAVVNVPAQH* |
| Ga0068642_1806682 | 3300005241 | Anoxygenic And Chlorotrophic Microbial Mat | MRRDQRLMPPLRAQRREVLRHALKRQSVKRVGRAVVNVPTQH* |
| Ga0068639_1752191 | 3300005242 | Anoxygenic And Chlorotrophic Microbial Mat | SLMRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVNVPTQH* |
| Ga0068640_1011683 | 3300005245 | Anoxygenic And Chlorotrophic Microbial Mat | LMLRRNRLIPPFRAQRRKMLRDAPERLTVKRVRRAVVDVPT* |
| Ga0068637_11079161 | 3300005247 | Anoxygenic And Chlorotrophic Microbial Mat | MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVDVPAQH* |
| Ga0068645_11473882 | 3300005249 | Anoxygenic And Chlorotrophic Microbial Mat | MCSDQLLMPPLRAQRREMLRHALKRQSVKRVRRAVVDVPT* |
| Ga0068634_11955381 | 3300005251 | Anoxygenic And Chlorotrophic Microbial Mat | MRRDQRLMPPFRAQRREVLRHALKRQTVKRVGRAVVNVPAQH* |
| Ga0068706_10306142 | 3300005452 | Anoxygenic And Chlorotrophic | MRRDQRLVPPLRAQRRKMLRDAPERLTIKRVGRAVVNVPTQH* |
| Ga0068706_10565082 | 3300005452 | Anoxygenic And Chlorotrophic | MRCDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAVVNVPAQH* |
| Ga0068706_10823572 | 3300005452 | Anoxygenic And Chlorotrophic | MGSDQLLMPPLCAQRREMLRHALKRQSVKRVGRAVVDVPT* |
| Ga0068705_101731602 | 3300005453 | Anoxygenic And Chlorotrophic | MGSDQLLMPPLCAQRREMLRHALKRQSVKRVGRAVVDVPA* |
| Ga0068669_12578611 | 3300005638 | Anoxygenic And Chlorotrophic Microbial Mat | MRRDQRLMPPFRAQRREMLRNAPERLTVKRVGRAVVN |
| Ga0068669_12896612 | 3300005638 | Anoxygenic And Chlorotrophic Microbial Mat | LMCSDQLLMPPLRAQRCKVLRHAPERLPVKRVGRAVVNVPTQH* |
| Ga0068659_10559186 | 3300006363 | Anoxygenic And Chlorotrophic Microbial Mat | MRCNQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVNVPTQH* |
| Ga0068664_10028322 | 3300006380 | Anoxygenic And Chlorotrophic Microbial Mat | MLRRNRLIPPFRAQRRKMLRDAPERLTVKRVRRAVVDVPT* |
| Ga0124936_10676254 | 3300010179 | Anoxygenic And Chlorotrophic Microbial Mat | MRRDQRLMPPFRAQRREMLRNAPERLTVKRVGRAVVNVPTQH* |
| Ga0124919_11401952 | 3300010183 | Anoxygenic And Chlorotrophic Microbial Mat | MLRRNRLIPPFRAQRRKMLRHALKRQSVKRVRRAVVDVPT* |
| Ga0124915_10089611 | 3300010189 | Anoxygenic And Chlorotrophic Microbial Mat | MRRDQRLMPPFRAQRREVLRHALKRQTVKRVGRAVVDVPAQH* |
| Ga0124915_10939002 | 3300010189 | Anoxygenic And Chlorotrophic Microbial Mat | MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVNVPTQH* |
| Ga0124924_10448071 | 3300010193 | Anoxygenic And Chlorotrophic Microbial Mat | MRCNQRLMPPLCAQRREVLRDALQRQTVKRVGRAVVNVPTQH* |
| Ga0124921_11075402 | 3300010194 | Anoxygenic And Chlorotrophic Microbial Mat | MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAMVDVPTQH* |
| Ga0124911_12283012 | 3300010195 | Anoxygenic And Chlorotrophic Microbial Mat | MRCNQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVDVPTQH* |
| Ga0124923_10242053 | 3300010196 | Anoxygenic And Chlorotrophic Microbial Mat | MCSDQLLMPPLRAQRCKVLRDALQRQTVKRVGRAVVNVPTQH* |
| Ga0124922_10148841 | 3300010197 | Anoxygenic And Chlorotrophic Microbial Mat | MRCDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAV |
| Ga0124938_11682914 | 3300010254 | Anoxygenic And Chlorotrophic Microbial Mat | MLRRNRLIPPFRAQRCKVLRDALQRQTVKRVGRAVVNVPTQH* |
| Ga0124910_10627603 | 3300010255 | Anoxygenic And Chlorotrophic Microbial Mat | MRCDQRLMPPFRAQRREMLRHAPERLTVKRVGRAVVNVPTQH* |
| Ga0124939_11266201 | 3300010256 | Anoxygenic And Chlorotrophic Microbial Mat | SLLSLMLRRNRLIPPFRAQRCKVLRDALQRQTVKRVGRAVVNVPTQH* |
| Ga0124912_13456491 | 3300010272 | Anoxygenic And Chlorotrophic Microbial Mat | MRRDQRLMPPFRAQRREVLRHALKRQTVKRVGRAVVNVPTQH* |
| Ga0209750_10474552 | 3300026237 | Anoxygenic And Chlorotrophic Microbial Mat | MLRRNRLIPPFRAQRREMLRHAPERLPVKRVGRAVVDVPT |
| Ga0209809_10322182 | 3300026509 | Anoxygenic And Chlorotrophic | MLRRNRLIPPFRAQRRKMLRDAPERLTVKRVRRAVVDVPT |
| Ga0209809_10376492 | 3300026509 | Anoxygenic And Chlorotrophic | MRCDQRLVPPLRAQRRKMLRDAPERLTIKRVGRAVVNVPTQH |
| Ga0209809_10584412 | 3300026509 | Anoxygenic And Chlorotrophic | MCSDQLLMPPLRAQRCKVLRDALQRQTVKRVGRAVVNVPTQH |
| Ga0209809_10735212 | 3300026509 | Anoxygenic And Chlorotrophic | MLRRNRLIPPFRAQRRKMLRHALKRQSVKRVRRAVVDVPT |
| Ga0209809_11090202 | 3300026509 | Anoxygenic And Chlorotrophic | MRCDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAVVNVPAQH |
| Ga0209691_10201923 | 3300027279 | Anoxygenic And Chlorotrophic | MRRDQRLVPPLRAQRRKMLRDAPERLTIKRVGRAVVNVPTQH |
| Ga0308395_10138213 | 3300031245 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVDVPTQH |
| Ga0308395_10243122 | 3300031245 | Hot Spring Phototrophic Mat | MLRRNRLIPPFRAQRREMLRHALKRQSVKRVGRAVVNVPTQH |
| Ga0308395_10268834 | 3300031245 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRREMLRDALKRQTVKRVGRAVVNVPAQH |
| Ga0308395_10346913 | 3300031245 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRREVLRHALKRQTVKRVGRAVVNVPAQH |
| Ga0308395_10362212 | 3300031245 | Hot Spring Phototrophic Mat | MCSDYLLMPPLSAQRREVLRHAPERLSVKRVGRAVVDVPT |
| Ga0308395_10549152 | 3300031245 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRREVLRHALKRQTVKRVGRAVVNVPTQH |
| Ga0308395_11126662 | 3300031245 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAMVDVPTQH |
| Ga0308394_10738302 | 3300031508 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVNVPTQH |
| Ga0308399_10330932 | 3300031509 | Hot Spring Phototrophic Mat | MRCDQRLMPPFRTQRREVLRDALKRQTVKRVRRAVIDVPT |
| Ga0308399_10384692 | 3300031509 | Hot Spring Phototrophic Mat | MRRDQRLVPPLRAQRRKMLRYALKRQTVKRVRRAVVDVPTQHQF |
| Ga0308399_10573201 | 3300031509 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRRKVLRDALQRQTVKRVGRAVVDVPT |
| Ga0308397_10019974 | 3300031512 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAMVDVPTQH |
| Ga0308397_10070842 | 3300031512 | Hot Spring Phototrophic Mat | MRCDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVNVPAQH |
| Ga0308397_10526932 | 3300031512 | Hot Spring Phototrophic Mat | MCCNQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVNVPTQH |
| Ga0308397_10811311 | 3300031512 | Hot Spring Phototrophic Mat | HHSSTFSLMRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVDVPTQH |
| Ga0308412_10515242 | 3300031513 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRREVLRHALKRQTVKRVGRAVVDVPTQH |
| Ga0308412_10669711 | 3300031513 | Hot Spring Phototrophic Mat | SDYLLMPPLCAQRRKVLRYALKRLPVKRVGRAVIDIST |
| Ga0308412_10974632 | 3300031513 | Hot Spring Phototrophic Mat | MRRDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAVVNVPTQH |
| Ga0308390_10042102 | 3300031514 | Hot Spring Phototrophic Mat | MRRDQRLVPPLRAQRRKMLRDAPERLTVKRVRRAVVDVPT |
| Ga0308390_10832142 | 3300031514 | Hot Spring Phototrophic Mat | MRCDQRLMPPFRAQRREVLRDALKRQTVKRVGRAVVDVPTQH |
| Ga0308396_10242693 | 3300031515 | Hot Spring Phototrophic Mat | MGSDQLLMPPLCAQRREMLRHALKRQSVKRVGRAVVDVPA |
| Ga0308396_10277162 | 3300031515 | Hot Spring Phototrophic Mat | MPPLCAQRREVLRHALKRQSVKRVGRAVVDVPTQH |
| Ga0308396_10750742 | 3300031515 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRRKMLRDALKRQTVKRVGRAVVDVPTQH |
| Ga0308396_11250071 | 3300031515 | Hot Spring Phototrophic Mat | MRCNQRLMPPFRAQRREMLRDALKRQTVKRVGRAVVNVPTQH |
| Ga0308398_10085885 | 3300031516 | Hot Spring Phototrophic Mat | MRCNQRLMPPFRAQRCEMLSDALKRQTVKRVGRAMVDVPTQH |
| Ga0308398_10128125 | 3300031516 | Hot Spring Phototrophic Mat | MRCNQRLMPPFRAQRREMLRNALKRQTVKRVGRAVVNVPTQH |
| Ga0308398_11236642 | 3300031516 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRREMLRNALKRQTVKRVGRAMVDVPTQH |
| Ga0308389_11246012 | 3300031518 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAVVNVPTQH |
| Ga0308393_10624352 | 3300031568 | Hot Spring Phototrophic Mat | MRCDQRLMPPFRAQRREMLRNAPERLTVKRVGRAVVNVPTQH |
| Ga0308401_10312412 | 3300031767 | Hot Spring Phototrophic Mat | MPPLRAQRRKMLRDAPERLTIKRVGRAVVDVPTQHQFG |
| Ga0308401_11141342 | 3300031767 | Hot Spring Phototrophic Mat | MRCDQRLVPPLRAQRRKMLRYAPERLTIKRVGRAVVDVPT |
| Ga0308415_10015265 | 3300031776 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRREMPRNALERLTIKRVGRAVVDVPT |
| Ga0308415_10267292 | 3300031776 | Hot Spring Phototrophic Mat | MRCDQRLMPPFRAQRRKVPRNALERLSVKRVRRAAVDVPTQH |
| Ga0308415_10894262 | 3300031776 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRRKMPRHALERLSVKRVRRAAVDVPTQH |
| Ga0308418_10016245 | 3300031783 | Hot Spring Phototrophic Mat | MRRNQRLMPPFRAQRCEMLRDALKRQTVKRVGRAMVDVPTQH |
| Ga0308418_10195854 | 3300031783 | Hot Spring Phototrophic Mat | MPPLCAQRREVLRDALQRQTVKRVGRAVVNVPTQH |
| Ga0308418_10519742 | 3300031783 | Hot Spring Phototrophic Mat | MRCNQRLMPPFRAQRREMLRNAPERLTVKRVGRAVVNVPAQH |
| Ga0308411_1000319511 | 3300031812 | Hot Spring Phototrophic Mat | MCSDYLLMPPFRAQRRKVLRDALQRQTVKRVGRAVVDVSAQH |
| Ga0308411_100062164 | 3300031812 | Hot Spring Phototrophic Mat | MRCDQRLVPPLRAQRREVLRHALERQTVKRVGRAVIDVSAQH |
| Ga0308411_100136853 | 3300031812 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRCEMLRDALKRQTIKRVGRAMVDVPTQH |
| Ga0308411_100668552 | 3300031812 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRCEMLRDAPERLTVKRVGRAVVDVPT |
| Ga0308411_100905172 | 3300031812 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAVVNIPAQH |
| Ga0308411_101333003 | 3300031812 | Hot Spring Phototrophic Mat | MRRDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAMVDVPTQH |
| Ga0308411_102830772 | 3300031812 | Hot Spring Phototrophic Mat | MRCDQRLMPPFRAQRCEMLRDAMKRQTVKRVGRAVVNVPAQH |
| Ga0308411_103082052 | 3300031812 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRREVLRHAPERLTIKRVGRAVVNVPTQH |
| Ga0308409_10095322 | 3300031830 | Hot Spring Phototrophic Mat | MCSDYLLVPPLRAQRREVLRDALERQTVKRVGRAVIDVPAQH |
| Ga0308409_10248642 | 3300031830 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRREMLRHAPERLPVKRVGRAVVNVPTQH |
| Ga0308409_10500312 | 3300031830 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRCEMLRDALKRQSVKRVGRAVVDVPT |
| Ga0308409_10890002 | 3300031830 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVDVPAQH |
| Ga0308408_10109202 | 3300031865 | Hot Spring Phototrophic Mat | MRRDQRLVPPLRAQRCEVLRHAPERLTVKRVRRAVVDVPT |
| Ga0308408_10179332 | 3300031865 | Hot Spring Phototrophic Mat | MRCNQRLMPPFRAQRREMLRNAPERLTVKRVGRAVVNVPTQH |
| Ga0308408_10666082 | 3300031865 | Hot Spring Phototrophic Mat | MRCNQRLMPPFRAQRCEMLRDALKRQTVKSVGRAVVDVPTQH |
| Ga0308405_10012213 | 3300031875 | Hot Spring Phototrophic Mat | MRCDQRLMPPFRAQRREMLRNAPERLTVKRVGRAVVNVPAQH |
| Ga0308404_10064503 | 3300031878 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRCEMLHDALKRQTVKRVGRAVVDVPAQH |
| Ga0308406_10281592 | 3300031948 | Hot Spring Phototrophic Mat | MLRRNRLIPPFRAQRGEMLRHALKRQSVKRVGRAVVDVPTQH |
| Ga0308406_10438752 | 3300031948 | Hot Spring Phototrophic Mat | MRCDQRLVPPLRAQRRKMLRDAPERLTIKRVGRAVVDVPA |
| Ga0308406_10741601 | 3300031948 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRREVLRHSLKRQTVKRVGRAVVNVPAQH |
| Ga0308417_10088481 | 3300031950 | Hot Spring Phototrophic Mat | MLRYNRLMPPLRAQRREVLCDALKRQSVKRVGWAVVDV |
| Ga0308417_10108566 | 3300031950 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRREMLRHALQRQTIKRVGRAVIDIST |
| Ga0308417_10837492 | 3300031950 | Hot Spring Phototrophic Mat | MRRDQRLMPPLRAQRCKVLRDALQRQTVKRVGRTVVNVPT |
| Ga0308417_11990401 | 3300031950 | Hot Spring Phototrophic Mat | LLMPPLCAQRRKVLRDALQRQTVKRVRRAVVDVPT |
| Ga0308417_12537692 | 3300031950 | Hot Spring Phototrophic Mat | MRCNNRLMPPFRAQRCEMLRYALERLPVKRVRRTVVDVPAQH |
| Ga0308420_10779662 | 3300031966 | Hot Spring Phototrophic Mat | MRRDQRLVPPFRAQRCEMLRDALKRQTVKRVGRAVVDVPTQH |
| Ga0308420_10859732 | 3300031966 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRREMLRNAPERLTVKRVGRAVVNVPTQH |
| Ga0308420_12015461 | 3300031966 | Hot Spring Phototrophic Mat | MCSDYLLMPPLSAQRREVLRHALKRQSVKRVGRAVVDVSAQ |
| Ga0308403_10198422 | 3300031980 | Hot Spring Phototrophic Mat | MRRDQRLMPPLRAQRRKMLRDAPERLTIKRVGRAVVDVPT |
| Ga0308403_10573312 | 3300031980 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRCEVLRDAPERLTIKRIGRAVVDV |
| Ga0308403_10590273 | 3300031980 | Hot Spring Phototrophic Mat | MRRDQRLVPPLRAQRRKMLRDALQRQTVKRVRRAVVNVPTQH |
| Ga0308402_10133212 | 3300032033 | Hot Spring Phototrophic Mat | LTFPLMRCDQRLMPPFRAQRREVLRYALKRQTVKRVRRAVVDVPT |
| Ga0308407_10680872 | 3300032034 | Hot Spring Phototrophic Mat | MRCDQRLIPPLCAQRCEMLRDALKRQTVKRVGRAVVNVPAQH |
| Ga0308407_11033221 | 3300032034 | Hot Spring Phototrophic Mat | MLRRNRLIPPFRAQRCEMLRHAPERLPVKRVRRAVV |
| Ga0308400_100077212 | 3300032045 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRCEVLRHALKRQTVKRVGRAVINVPTQH |
| Ga0308419_10652282 | 3300032058 | Hot Spring Phototrophic Mat | MCSDYLLMPPLSAQRREVLRHALQRQTVKRVRRAVVDVPA |
| Ga0308419_10829951 | 3300032058 | Hot Spring Phototrophic Mat | MPPLCAQRREVLRDALQRQTVKRVGRAVVDVPTQH |
| Ga0308414_100112213 | 3300032356 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAVVDIPAQH |
| Ga0308414_10477252 | 3300032356 | Hot Spring Phototrophic Mat | MGSDQLLMPPLCAQRRKVLRDALQRQTVKRVRRAVVDVPT |
| Ga0308413_002489_9256_9372 | 3300033886 | Hot Spring Phototrophic Mat | MRRDQRLIPPLCAQRSKVLRHAPKRLTVKYVGRAVVDVS |
| Ga0308413_088258_688_792 | 3300033886 | Hot Spring Phototrophic Mat | MRRDQRLMPPLRAQRRKMLRDAPERLTIKRVGRAV |
| Ga0372972_008304_1324_1452 | 3300034649 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRCEMLRHALKRQTVKRVGRAVVDVPTQH |
| ⦗Top⦘ |