NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F081378

Metagenome / Metatranscriptome Family F081378

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081378
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 76 residues
Representative Sequence MDYFVPNFGMDKDILATQADEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFDPSLDSNMVDSLNSLRI
Number of Associated Samples 74
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 28.57 %
% of genes near scaffold ends (potentially truncated) 43.86 %
% of genes from short scaffolds (< 2000 bps) 98.25 %
Associated GOLD sequencing projects 73
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (89.474 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(41.228 % of family members)
Environment Ontology (ENVO) Unclassified
(64.035 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(65.789 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.37%    β-sheet: 0.00%    Coil/Unstructured: 62.63%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.23 %
UnclassifiedrootN/A8.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006382|Ga0075494_1373321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1053Open in IMG/M
3300006382|Ga0075494_1373321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1053Open in IMG/M
3300006382|Ga0075494_1401053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium887Open in IMG/M
3300006399|Ga0075495_1555716Not Available506Open in IMG/M
3300006399|Ga0075495_1561422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300006399|Ga0075495_1594269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300006424|Ga0075497_1435522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300009432|Ga0115005_10310338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1242Open in IMG/M
3300009432|Ga0115005_11239057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani607Open in IMG/M
3300009432|Ga0115005_11295786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani594Open in IMG/M
3300009436|Ga0115008_10671105Not Available751Open in IMG/M
3300009507|Ga0115572_10247070All Organisms → Viruses → Predicted Viral1021Open in IMG/M
3300009543|Ga0115099_10555814Not Available674Open in IMG/M
3300009599|Ga0115103_1351922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium567Open in IMG/M
3300009599|Ga0115103_1402386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium642Open in IMG/M
3300009599|Ga0115103_1690312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1370Open in IMG/M
3300009677|Ga0115104_10119441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium826Open in IMG/M
3300016734|Ga0182092_1024561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300018980|Ga0192961_10030173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1449Open in IMG/M
3300018980|Ga0192961_10040979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1297Open in IMG/M
3300018980|Ga0192961_10146926Not Available718Open in IMG/M
3300018980|Ga0192961_10205142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani590Open in IMG/M
3300018980|Ga0192961_10257193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300019031|Ga0193516_10144714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani805Open in IMG/M
3300019032|Ga0192869_10045116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1436Open in IMG/M
3300019048|Ga0192981_10054632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1459Open in IMG/M
3300019048|Ga0192981_10224180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium727Open in IMG/M
3300019048|Ga0192981_10274045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium638Open in IMG/M
3300019050|Ga0192966_10241832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300021169|Ga0206687_1066467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani974Open in IMG/M
3300021169|Ga0206687_1423376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300021169|Ga0206687_1556662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium878Open in IMG/M
3300021345|Ga0206688_10335479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300021350|Ga0206692_1871004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium579Open in IMG/M
3300021359|Ga0206689_10186256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300021359|Ga0206689_10204897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300021887|Ga0063105_1012338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium776Open in IMG/M
3300021887|Ga0063105_1012338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium776Open in IMG/M
3300021887|Ga0063105_1017416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1182Open in IMG/M
3300021887|Ga0063105_1017416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1182Open in IMG/M
3300021913|Ga0063104_1025204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300021922|Ga0063869_1023897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300021925|Ga0063096_1030338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium582Open in IMG/M
3300021927|Ga0063103_1067457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300021941|Ga0063102_1001900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium637Open in IMG/M
3300021941|Ga0063102_1002781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1382Open in IMG/M
3300021941|Ga0063102_1007077Not Available1066Open in IMG/M
3300021941|Ga0063102_1011783Not Available585Open in IMG/M
3300021941|Ga0063102_1013125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1246Open in IMG/M
3300021941|Ga0063102_1031937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum780Open in IMG/M
3300021941|Ga0063102_1034850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300021942|Ga0063098_1028172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300021942|Ga0063098_1138403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300021950|Ga0063101_1071378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300021954|Ga0063755_1070574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300023685|Ga0228686_1065598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300023696|Ga0228687_1036657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300025570|Ga0208660_1072534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium803Open in IMG/M
3300025704|Ga0209602_1179827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani648Open in IMG/M
3300026447|Ga0247607_1077974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani585Open in IMG/M
3300026466|Ga0247598_1133436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani606Open in IMG/M
3300026468|Ga0247603_1016634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1331Open in IMG/M
3300026495|Ga0247571_1111254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium639Open in IMG/M
3300026495|Ga0247571_1173611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300026513|Ga0247590_1143709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani612Open in IMG/M
3300027849|Ga0209712_10497102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani683Open in IMG/M
3300027849|Ga0209712_10559753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium638Open in IMG/M
3300028110|Ga0247584_1062601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani940Open in IMG/M
3300028110|Ga0247584_1168018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300028110|Ga0247584_1168018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300028137|Ga0256412_1166459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum814Open in IMG/M
3300028282|Ga0256413_1221000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300028290|Ga0247572_1161868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300030653|Ga0307402_10417623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium774Open in IMG/M
3300030671|Ga0307403_10825512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300030702|Ga0307399_10225837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium872Open in IMG/M
3300030722|Ga0308137_1100698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300031523|Ga0307492_10132424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani864Open in IMG/M
3300031523|Ga0307492_10229238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300031594|Ga0302131_1287871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300031622|Ga0302126_10173229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium787Open in IMG/M
3300031710|Ga0307386_10069289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1443Open in IMG/M
3300031710|Ga0307386_10601408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium582Open in IMG/M
3300031725|Ga0307381_10138462Not Available826Open in IMG/M
3300031725|Ga0307381_10378893Not Available519Open in IMG/M
3300031729|Ga0307391_10675295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300031729|Ga0307391_10677007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300031734|Ga0307397_10295640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium734Open in IMG/M
3300031735|Ga0307394_10077459All Organisms → Viruses → Predicted Viral1227Open in IMG/M
3300031735|Ga0307394_10083983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1183Open in IMG/M
3300031735|Ga0307394_10118559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1011Open in IMG/M
3300031738|Ga0307384_10613318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300031739|Ga0307383_10210378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani920Open in IMG/M
3300031739|Ga0307383_10739789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300031742|Ga0307395_10266505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium736Open in IMG/M
3300032481|Ga0314668_10263339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium889Open in IMG/M
3300032517|Ga0314688_10082757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1399Open in IMG/M
3300032520|Ga0314667_10548717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300032521|Ga0314680_10616037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium686Open in IMG/M
3300032540|Ga0314682_10420478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium737Open in IMG/M
3300032540|Ga0314682_10536181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300032615|Ga0314674_10300861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium834Open in IMG/M
3300032616|Ga0314671_10439559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium712Open in IMG/M
3300032666|Ga0314678_10081901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1216Open in IMG/M
3300032707|Ga0314687_10499454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium678Open in IMG/M
3300032708|Ga0314669_10524526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300032744|Ga0314705_10462985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium682Open in IMG/M
3300032747|Ga0314712_10296931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium771Open in IMG/M
3300032748|Ga0314713_10335473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300032750|Ga0314708_10184281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1008Open in IMG/M
3300033572|Ga0307390_10426511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani813Open in IMG/M
3300033572|Ga0307390_10426511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani813Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine41.23%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine14.04%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater13.16%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater12.28%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.02%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater6.14%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.63%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine1.75%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.88%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006424Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016734Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023685Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030722Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031594Marine microbial communities from Western Arctic Ocean, Canada - CB9_20mEnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0075494_137332123300006382AqueousMDYFVPNFGMDKDIIATEQNEKVASALVGHGWAFKTPESWEKWRNRAKDTDYNFTQHSVTI*
Ga0075494_137332133300006382AqueousMDYFVPNFGMDRDIIATEQNERVATALTGHAWSFKTPESWEKWRNRAKDVDYNFDPELDEDMRTSLNSA*
Ga0075494_140105323300006382AqueousMDYFVPNFGMDRDIIATEQDEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFDPALEGDMVTSLDNMHNATQQYGPNY*
Ga0075495_155571613300006399AqueousMDYFVPNFGMDKHDVLWTAEDEKVATELTGHAWSFKTPESWEKWRNRAKDAPYNFEPELSEDMKINENSEKIANKQYGNDGTPYKWDLIAD*
Ga0075495_156142213300006399AqueousMDYFVPNFGMDHDVLATEANEKVASALVGHAWAFKTPESWEKWRNRAKDVDYNFDPALDQNMNDSLNSLGIAENQYGRRIGELSAGEKV*
Ga0075495_159426913300006399AqueousMDYFVPNFGMDKDILSTQENEKVASALVGHGWSMKTPESWEKWRNRAKEVDYNFDPALDGNMVDSQNSLK
Ga0075497_143552213300006424AqueousMDYFVPNFGMDHDVLATQANEKVASALVGHGWAFKTPESWEKWRNRAKDVDYNFDPALDQNMNDSLNSLGIAENQYGRRIGELSAGEKV*
Ga0115005_1031033823300009432MarineMDYFVPNFGMDKHDVLWTAEDEKVASQLTGHAWNFKTPESWEKWRNRAKDAPYNFDPELSEEMRTNENSVKIADK*
Ga0115005_1123905713300009432MarineMDYFVPNFGMDRDVLATEENEKVASALVGQAWSFKTPESWEKWRNRAKDVDYNFAPELSEDMVTSQNSASIA*
Ga0115005_1129578613300009432MarineMDYFVPNFGMDRDIINTEENERVASALVNQAWSFKTPESWEKWRNRAKDVDYNFDPELDEDMITSQNSAQVAEDQYGPNYNWDLL*
Ga0115008_1067110513300009436MarineMDYFVPNFGMDKKDVLWTAENEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFNMELSEDMKTSLSN*
Ga0115571_120298213300009495Pelagic MarineQYKQPEGPKQHPMDYFVPNFGMDRDIIATEQDEKVASALVGHAWAFKTPESWEKWRNRAKDVDYNFDPALEGDMVTSLDNMHNATQQYGPNY*
Ga0115572_1024707023300009507Pelagic MarineMDYFVPNFGMDRDIIATEQDEKVASALVGHAWAFKTPESWEKWRNRAKDVDYNFDPALEGDMVTSLDNMHNATQQYGPNY*
Ga0115099_1055581413300009543MarineMDYFVPNFGMDKKDVLWTAENEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFNMELSED
Ga0115103_135192213300009599MarineMDYFVPNFGMDHDVLATQANEKVASALVGHGWSMKTPESWEKWRNRAKDVDYNFDPALDGNMVDSQNSLKIAESIRGQ
Ga0115103_140238613300009599MarineMDYFVPNFGMDKDILSTQENEKVASALVGHAWSFKTPESFEKNRARAKDVDYNFDPALDGNMVDSQNSLKIAENIRG*
Ga0115103_169031223300009599MarineMDYFVPNFGMDKHDVLWTAEDEKVATELTGHAWSFKTPESWEKWRNRAKDAPYNFEPELSEDMKTNENSEKIANKQYGNDGTPYKWDLIAD*
Ga0115104_1011944113300009677MarineTQYKQPEGPKMWPIDYFVPNFGMDRDIKWTAEDEKVASALVGHAWSFKTPESWEKWRNRAKDAPYNFDPELSEDMRDSAVS*
Ga0138263_179013023300012415Polar MarineMDYFVPNFGMDRDIKWSEEDEKFASALVGHAWAFKTPESWEKWRNRAKDAEY
Ga0182092_102456123300016734Salt MarshKPPPRDYFVPNFGMDHDIKNTLEDEKVASALVGHGWAFKTPESWEKYRIRAKDVDYNFDPELDENMKTSL
Ga0192961_1003017323300018980MarineMDYFVPNFGMDKHDVLWTAEDEKVATELTGHAWSFKTPESWEKWRNRAKDAPYNFEPELSEDMKINENSEKIANKQYGNDGTPYKWDLIAD
Ga0192961_1004097933300018980MarineMNYHVPNFGMDHDIVASENNEKIASALVGHSWAFKTPESWEKYRNRAKDASYNFDPELSEDMIANQTSMKIAEGQYGNPKYEW
Ga0192961_1014692613300018980MarineMDRDIIGTQENEKVASALVGHAWSFKTPESFEKYRNRAKDVDYNFDPALDEDMIDNQASMGWAEMD
Ga0192961_1020514213300018980MarineMDYFVPNFGMDRDIMASENDEKIASALVGHSWSFKTPESWEKWRNRAKDASYDFDPDLDQDMVTSLSNMGLATQ
Ga0192961_1025719313300018980MarineMDYFVPNFGMDKDILSTQENEKVASALVGHGWSMKTPESWEKWRNRAKEVDYNFDPALDGNMVDSQNSLKIAESIRG
Ga0193516_1014471433300019031MarineYKQPEGPPPPPMDYFVPNFGMDKDVKNTLEDEKVASKLVGHGWAFKTPESWEKYRIRAKDVDYNFDPELDENMRISL
Ga0192869_1004511633300019032MarineMDYFVPNFGMDKDILATEQNEKVASALVGQAWSFKTPESWEKWRNRAKDVDYNFDPELSEDMVVSANSAAIAEEQYN
Ga0192981_1005463233300019048MarineMDYFVPNFGMDKDVLNTEEDERVATALVGHAWSFKTPESWEKWRNRAKDSDYNFAPELDEDMIDS
Ga0192981_1022418013300019048MarineMDYFVPNFGMDHDIKSTWEDEKVASALVGHAWSFKTPESFEKWRNRAKDVDYNFNPSLDGNMVDSLSNLTWAENDLGRNLGSLNK
Ga0192981_1027404513300019048MarineMDYFVPNFGMDKEILASEADEKVASALVGHAWAFKTPESWEKWRNRAKDVDYNFDPSLDSNMNDSLSNMRNAES
Ga0192966_1024183213300019050MarineMDYFVPNFGMDKDILATQADEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFDPSLDSNMVDSLNSLRIASDIRGQGIKSMDK
Ga0206687_106646723300021169SeawaterMNYFVPNFGMDRDVINTLADEKVATALTGHAWSFKTPESWEKWRNRAKDVDYNFVPELEDDMIDS
Ga0206687_142337613300021169SeawaterMDYFVPNFGMDKDILATQADEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFDPALDSNMVDSLNSLRIASDIRGQGIKSLEK
Ga0206687_155666213300021169SeawaterMDYFVPNFGMDKKDVLWTAENEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFNMELSEDMKTSLSN
Ga0206688_1033547913300021345SeawaterMDYFVPNFGMDHDVLATQANEKVASALVGHGWSMKTPESWEKWRNRAKDVDYNFDPALDG
Ga0206692_187100413300021350SeawaterMDYFVPNFGMDKDILATQADEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFDPSLDSNMVDSLNSLRIASDIRGQGIKS
Ga0206689_1018625613300021359SeawaterMDYFVPNFGMDHDIKASIEDEKVASALVGHGWSFKTPESFEKYRTRAKDVDYNFNPELDENMRYSLHNMRAAEMDYGR
Ga0206689_1020489713300021359SeawaterMDYFVPNFGMDHDVLATQANEKVASALVGHGWSMKTPESWEKWRNRAKDVDYNFDPALDGNMVDSQNSLKIAESIRGQGMT
Ga0063105_101233823300021887MarineMDYFVPNFGMDRDVLATEENEKVASALVGQAWSFKTPESWEKWRNRAKDVDYNFAPELSEDMVTSQNSASIA
Ga0063105_101233833300021887MarineMDYFVPNFGMDRDVIATETNEKVASALVGQAWSFKTPESWEKWRNRAKDVDYNFAPELSEDMIVSQNSASIAQDQYG
Ga0063105_101741613300021887MarineMDYFVPNFGMDRDIINTEENERVASALVNQAWSFKTPESWEKWRNRAKDVDYNFDPELDEDMITSQNSAQVAEDQYGPNYNWDLL
Ga0063105_101741623300021887MarineMDYFVPNFGMDHDVLATESNEKVASALVGHAWSFKTPESFEKYRIRAKDVDYNFDPKLDEDMVTAQNSEKIAENQYGEKIDLVQTGI
Ga0063104_102520423300021913MarineMDYFVPNFGMDKDIIATEDNEKVASALVGQAWSFKTPESFEKWRNRAKDVDYNFDPALNGDMVDSLNSMAIAEGQYGRKVGGF
Ga0063869_102389713300021922MarineFVPNFGMDRDIIATEQDEKVASALVGHAWAFKTPESWEKWRNRAKDVDYNFDPALEGDMVTSLDNMHNATQQYGPNYKW
Ga0063096_103033813300021925MarineMDYFVPNFGMDKDILATEANEKVASALVGHAWSFKTPESFEKYRNRAKDVDYNFDPALDSNMVDSLNSLRIASDIRGQGIKDMDK
Ga0063103_106745723300021927MarineMQSDPICSSAGCSQYKQPEGPPDHPMDYKVPNFGMDKEIIGSIDDEKVASALVGHAWAFKTPESWEKYRNRAKDTDYNFA
Ga0063102_100190013300021941MarineMDYFVPNFGVDHDVLATESNEKLASAMVGHAWSFHTPESFEKNRSRAKDVDYNFDPKLDGNMIDSQNSLRIAENIRGQ
Ga0063102_100278133300021941MarineMDYFVPNFGQDKEITNSIEDEKVASALVGHAWSFKTPESWEKWRNRAKDTDYNFAPELSDEMKTSANSQKIAEDQVDKPF
Ga0063102_100707723300021941MarineMDYFVPNFGMDKHDVLWTAEDEKVATELTGHAWSFKTPESWEKWRNRAKDAPYNFEPELSEDMKTNENSEKIANKQYGNDGTPYKWDLIAD
Ga0063102_101178313300021941MarineMDYFVPSFGMDKDILATEANEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFDPALDGNMVDSLNSLRIAGDIRGQGIKSLE
Ga0063102_101312523300021941MarineMDYFVPNFGMDKHDVLWTAEDEKVASQLTGHAWNFKTPESWEKWRNRAKDAPYNFDPELSEEMRTNENSVKIADK
Ga0063102_103193723300021941MarineMDYFVPNFGMDKHDVLWTAEDEKVASQLTGHAWSFKTPESWEKWRNRAKDAPYNFDPELDEDMRTNENSEKIADKQYGIDGDPYKWDLVKE
Ga0063102_103485013300021941MarineMDYFVPNFGMDHDVLATQENEKIASAMVGHAWSFKTPESFEKNRNRAKDIDYNFDPSLDGNMIDS
Ga0063098_102817223300021942MarineMDYFVPNFGMDKDILATEANEKVASALVGHAWSFKTPESFEKYRNRAKDVDYNFDPALDSNMVDSLNSLRIASDIRGQGIKDMDKA
Ga0063098_113840323300021942MarineMDYFVPNFGMDKDILATEAKKVASALVGHAWSFKTPESFEKYRNRAKDVDYNFDPALDSNMVDSLNSLRIASDIR
Ga0063101_107137823300021950MarineMDYFVPNFGMDKDILATEANEKVASALVGHAWSFKTPESFEKYRNRAKDVDYNFDPALDSNMVDSLNSLRIASDIRGQGIEKNEQVR
Ga0063755_107057413300021954MarineMDYFVPNFGMDRDIIATEQDEKVASALVGHAWAFKTPESWEKWRNRAKDVDYNFDPALEGDMVTSLDNMHNATQQYGPNYKW
Ga0228686_106559813300023685SeawaterMDYFVPNFGMDKDILATQADEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFDP
Ga0228687_103665713300023696SeawaterMDYFVPNFGMDKDILATQADEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFDPALDSNMVDSLNSLRIASDIRGQGIKS
Ga0208660_107253413300025570AqueousMDYFVPNFGMDRDIIATEQNERVATALTGHAWSFKTPESWEKWRNRAKDVDYNFDPELDEDMRTSLNSA
Ga0209602_117982713300025704Pelagic MarineMDYFVPNFGMDRDIIATEQDEKVASALVGHAWAFKTPESWEKWRNRAKDVDYNFDPALEGDMVTSLDNMHNATQQYGPNY
Ga0247607_107797423300026447SeawaterMDYLVPNFGMDKDVKNTIADEKVAAAMVGHAWSFKTPESWEKWRNRAKDTDYNFAPELSDDMKTSAN
Ga0247598_113343613300026466SeawaterMDYFVPNFGMDKDVKNTIADEKVAAAMVGHAWSFKTPESWEKWRNRAKDTDYNFAPELSDDMKTSANSQKIAED
Ga0247603_101663423300026468SeawaterMDYFVPNFGMDKDVKNTIADEKVAAAMVGHAWSFKTPESWEKWRNRAKDTDYNFAPELSDDMKTSANSQKNC
Ga0247571_111125413300026495SeawaterMDYFVPNFGMDKDILASQQNEKVASALVGHAWSFKTPESFEKNRLRAKDVDYNFDPALDSNMVDSLNSLRIAGDIRGQGIKSLE
Ga0247571_117361113300026495SeawaterMDYFVPNFGMDKDILATQADEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFDPALDSNMVDSL
Ga0247590_114370923300026513SeawaterMDYFVPNFGMDKDILGTQADEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFDPKLSEDMVTSQNSAAIATSQYGPNYKWGLD
Ga0209712_1049710213300027849MarineMDYFVPNFGMDRDVLATEENEKVASALVGQAWSFKTPESWEKWRNRAKDVDYNFAPELSEDMIVSQNSASIAQDQYG
Ga0209712_1055975313300027849MarineMDYFVPNFGMDKDILATEANEKVASALVGHAWSFKTPESFEKYRNVAKDVDYNFDPALDSNMVDSLNSLRIAGDIRGQGIKSLD
Ga0247584_106260113300028110SeawaterMDHDVKNTLEDEKVASALVGHGWAFKTPESWEKYRVRAKDVDYNFDPELDENISVFN
Ga0247584_116801813300028110SeawaterFVPNFGLDKKDVLWTAENEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFAPDLEDDMVDSANSAGIAESQYGSDSKPYQW
Ga0247584_116801823300028110SeawaterMDYFVPNFGMDKDVKNTIADEKVAAAMVGHAWSFKTPESWEKWRNRAKDTDYNFAPELSDDMKTS
Ga0256412_116645923300028137SeawaterMDYFVPNFGMDKDILATEADEKVASALVGHAWSFKTPETFEKWRNRAKDVDYNFDPKLSDDMITSANSQAIAEDQKGNPYKWDMLQL
Ga0256413_122100013300028282SeawaterMDYFVPNFGMDKDILATQQDEKVASALVGHAWSFKTPESFEKWRNRAKDADYNFDPSLDEDMVTSENSLGIAENQYGRRIAMAKDEVAKXXTW
Ga0247572_116186813300028290SeawaterMDYFVPNFGMDKDILATQADEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFDPALDSNMVDSLNSLRIASDIR
Ga0307402_1041762323300030653MarineMDYFVPHFGMDKDIIASEADEKVASALVGHAWAFKTPESWEKWRNRAKDTDYNFAPALSDDMVISANSQKIAE
Ga0307403_1082551213300030671MarineMDYFVPNFGMDKDVLNTEEDERVATALVGHAWSFKTPESWEKWRNRAKDSDYNFNPELDEDMIDS
Ga0307399_1022583723300030702MarineMDYFVPNFGMDHDIIATATDEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFNMELSEEMKTSLHNMKFAEDTVK
Ga0308137_110069813300030722MarineMDYFIPNFGMDHDVLATQANEKVASALVGHGWSMKTPESWEKWRNRAKDVDYNFDPALDGNMVDSLNSLRIAGDIRGQGIKSLE
Ga0307492_1013242413300031523Sea-Ice BrineMDYFVPNFGMDHDIISSETDEKIASALVGHAWAFKTPESWEKWRNRAKDAEYNYHPELSEDMTTSLSNMKFAEDTV
Ga0307492_1022923813300031523Sea-Ice BrineMDYFVPNFGMDHDIIASETDEKVASALVGHAWAFKTPESWEKWRNRAKDAEYNYTPELSEDMRDSAVSQ
Ga0302131_128787123300031594MarineMDYKVPNFGMDKEIIGSIDDEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFAPELSEDMVDSANSAAIAEDQYGNDG
Ga0302126_1017322913300031622MarineMDYFVPNFGMDKDILATEANEKVASALVGHAWSFKTPESFEKYRNRAKDVDYNFDPALDSNMVDSLNSLRIASDIRGQGIERMNK
Ga0307386_1006928923300031710MarineMDYFVPNFGMDKHDVLWTAEDEKVATELTGHAWSFKTPESWEKWRNRAKDAPYNFEPELSEEMKINENSEKIANKQYGNDGTPYKWDLIAD
Ga0307386_1060140813300031710MarineMDYFVPNFGMDKDILSTQENEKVASALVGHAWSFKTPESFEKNRSRAKDVDYNFDPALDGNMIDSQNSLKIAENIRG
Ga0307381_1013846223300031725MarineYFVPNFGMDHDVLATEKDEKVAAALVGHGWAFKTKESWEKYRNRAIDTNYNWAPKLDDDMITSENSQKNS
Ga0307381_1037889313300031725MarineMDYFVPNFGMDKKDVLWTAENEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFDMELSEDMKTSLSN
Ga0307391_1067529513300031729MarineMDYFVPNFGMDHDIKSTWEDEKVASALVGHAWSFKTPESFEKWRNRAKDVDYNFNPSLDGNMVDSLSNLTWAENDLGRNLG
Ga0307391_1067700713300031729MarineMDYFVPNFGMDKDVLATEANEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFDPSLDSNRVDSLNSLRIASDIRGEGIKSMDK
Ga0307397_1029564033300031734MarineMDYFVPNFGMDHDIIATATDEKVASALVGHAWSFKTPESWEKWRNRAKDAKYDYNMELSEDMKAS
Ga0307394_1007745923300031735MarineMDYFVPNFGMDHNIIASEEDEKIASALVGHAWAFKTPESWEKWRNRAKDVDYNFDPSLSQDMQTSLSNMNNATQEYGPNYKWNLAADQPAESLV
Ga0307394_1008398313300031735MarinePPMDYFVPNFGMDRDILATEQDEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFDPELEEDMITSANSA
Ga0307394_1011855923300031735MarineMDYFVPNFGMDHDILATKKDEEVASALVGHGWAFKTPESWAKYRNRAIDTNYNFAPKLDADMVTSANSQKIA
Ga0307384_1061331813300031738MarineMDYFVPNFGMDKDILSTQENEKVASALVGHGWSMKTPESWEKWRNRAKEVDYNFDPALDGNMV
Ga0307383_1021037823300031739MarineRDVINTLADEKVATALTGHAWSFKTPESWEKWRNRAKDVDYNFVPELEDDMIDS
Ga0307383_1073978913300031739MarineMDYFVPNFGMDKDILATQADEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFDPSLDSNMVDSLNSLRI
Ga0307395_1026650523300031742MarineMDYFVPNFGMDHDVLATKKDEEVASALVGHGWAFKTPESWAKYRNRAIDTNYNFAPKLDADMVTSANSQKIAEDQY
Ga0314668_1026333923300032481SeawaterMDYFVPNFGMDKHDVMWTAENEKIASALVGHAWSFKTPESWEKWRNRAKDVDYNFDPELDEDMRTSLNSA
Ga0314688_1008275713300032517SeawaterMDYFVPNFGMDRDIIATEQNERVATALTGHAWSFKTPESWEKWRNRAKDVDYNFDPELDEDMRTSLNSS
Ga0314667_1054871713300032520SeawaterMDYFVPNFGMDHDVLATEANEKVASALVGHAWAFKTPESWEKWRNRAKDVDYNFDPALDQNMNDSLNSLGIAENQYGRRIGELSAGEKV
Ga0314680_1061603723300032521SeawaterPEGPKQHPMDYFVPNFGMDRDIIATEQDEKVASALVGHAWAFKTPESWEKWRNRAKDVDYNFDPALEGDMVTSLDNMHNATQQYGPNY
Ga0314682_1042047823300032540SeawaterMDYFVPNFGMDKDIIATEQNEKVASALVGHGWAFKTPESWEKWRNRAKDTDYNFDPALSDDMITAQNSAK
Ga0314682_1053618123300032540SeawaterMDYFVPNFGMDHDILASEQNEKVASALVGHGWSFKTPESFEKYRLRSKDVDYNFDPSLD
Ga0314674_1030086123300032615SeawaterMDYFVPNFGMDRDIIATEQDEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFDPALEGDMVTSLDNMHNATQQYGPNY
Ga0314671_1043955913300032616SeawaterMDYFVPNFGMDKDIIATEQNEKVASALVGHGWAFKTPESWEKWRNRAKDTDYNFDPA
Ga0314678_1008190133300032666SeawaterYKQPDGPEPPPMDYFVPNFGMDRDIIATEQNERVATALTGHAWSFKTPESWEKWRNRVKDVDYNFDPELDEDMRTSLNSA
Ga0314687_1049945423300032707SeawaterMDYFVPNFGMDKDIIATEQNEKVASALVGHGWAFKTPESWEKWRNRAKDTD
Ga0314669_1052452613300032708SeawaterMQSDPICSSSGCSQYKQPEGPPAHPMDYFVPNFGMDKDIIATEQNEKVASALVGHGWAFKTPESWEKWRNRAKDTD
Ga0314705_1046298523300032744SeawaterMDYFVPNFGMDKHDVMWTAENEKIASALVGHAWSFKTPESWEKWRNRAKDAEY
Ga0314712_1029693123300032747SeawaterMDYFVPNFGMDKHDVMWTAENEKIASALVGHAWSFKTPESWEKWRNRAKDAEYNYNPELSEDMKSSLSNMAYAE
Ga0314713_1033547323300032748SeawaterFVPNFGMDRDIIATEQDEKVASALVGHAWSFKTPESWEKWRNRAKDVDYNFDPALEGDMVTSLDNMHNATQQYGPNY
Ga0314708_1018428133300032750SeawaterPEPPPMDYFVPNFGMDRDIIATEQNERVATALTGHAWSFKTPESWEKWRNRAKDVDYNFDPELDEDMRTSLNSA
Ga0307390_1042651113300033572MarineMDYFVPNFGMDKDVKNTIENEKVASALTGHAWPFKTPESWEKWRNRAKDTDYNFAPELSDDMKTSANSQKIAEDQIDKPFQWDLDTLVQTQDD
Ga0307390_1042651123300033572MarineMDYFVPNFGMDRDVINTLADEKVATALTGHAWSFKTPESWEKWRNRAKDVDYNFVPELEDDMIDS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.