| Basic Information | |
|---|---|
| Family ID | F081353 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MGKFLIKIGNKLVAFNEYLKGKWNSLLYKLMFKKEK |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 5.26 % |
| % of genes near scaffold ends (potentially truncated) | 20.18 % |
| % of genes from short scaffolds (< 2000 bps) | 73.68 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (86.842 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (25.439 % of family members) |
| Environment Ontology (ENVO) | Unclassified (63.158 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (74.561 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.12% β-sheet: 0.00% Coil/Unstructured: 46.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF02867 | Ribonuc_red_lgC | 20.18 |
| PF08291 | Peptidase_M15_3 | 18.42 |
| PF01510 | Amidase_2 | 6.14 |
| PF00268 | Ribonuc_red_sm | 1.75 |
| PF06356 | DUF1064 | 1.75 |
| PF13662 | Toprim_4 | 0.88 |
| PF01694 | Rhomboid | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 20.18 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 1.75 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 86.84 % |
| All Organisms | root | All Organisms | 13.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 25.44% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 14.91% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 14.04% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 9.65% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 5.26% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.63% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.63% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.63% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.75% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.75% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.75% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.75% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 1.75% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.75% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.88% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.88% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.88% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.88% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.88% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.88% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.88% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.88% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.88% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.88% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.88% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.88% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001718 | Marine viral communities from the Pacific Ocean - LP-48 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018603 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782239-ERR1711906) | Environmental | Open in IMG/M |
| 3300019701 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_1-2_MG | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300023089 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MG | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023271 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_1_MG | Environmental | Open in IMG/M |
| 3300024228 | Seawater microbial communities from Monterey Bay, California, United States - 41D | Environmental | Open in IMG/M |
| 3300024340 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5 | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027742 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028128 | Seawater microbial communities from Monterey Bay, California, United States - 57D | Environmental | Open in IMG/M |
| 3300028136 | Seawater microbial communities from Monterey Bay, California, United States - 9D | Environmental | Open in IMG/M |
| 3300028137 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028282 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028396 | Seawater microbial communities from Monterey Bay, California, United States - 55D | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_1000908511 | 3300000117 | Marine | MGKFLVKIGKKLMAFNQHLKGEWNSLLYKLMFKKEK* |
| JGI24523J20078_10009223 | 3300001718 | Marine | MGKLLVKLGEKLIAFNKFLKGKWNSLLYKLMFKEEKKNGKK* |
| Ga0066223_10817842 | 3300004461 | Marine | MGKLLVKLGEKLIAFNKFLKGKWNSLLYRLMFKEEKKNEKK* |
| Ga0070722_105287211 | 3300005601 | Marine Sediment | MGKLLVKIGKKLMAFNQHLKGEWNSLLYKLMFKKEK* |
| Ga0099972_101176731 | 3300006467 | Marine | MGKFLVKIGKILIEFNKYLKSKWNSLMYALMFKGY |
| Ga0070744_100420965 | 3300006484 | Estuarine | MGKFLVKIGKKLIEFNKYLKSKWNSLMYALMFKSYN |
| Ga0098073_100064716 | 3300006734 | Marine | MGKFFIKIGNKLVAFNEYLKGKWNSLLYKLMFKKEK* |
| Ga0098048_11535483 | 3300006752 | Marine | MGKFLIKIGKKLVAFNEYLKGEWNSLLYKLMFKKEK* |
| Ga0098048_11834072 | 3300006752 | Marine | MGKFLIKIGNKLVEFNKHLKGEWNSLLYKLMFKKEK* |
| Ga0070749_1000003939 | 3300006802 | Aqueous | MGKFFIKLGKKIIEFNEFLKSKWNSLMYRLMFKKEQK* |
| Ga0070749_100858303 | 3300006802 | Aqueous | MGKFLIKIGNKLVAFNEYLKGRWNSLLYRLMFKK* |
| Ga0070749_101358944 | 3300006802 | Aqueous | MGKFLIKIGNKLVAFNQHLKGEWNSLLYKLMFKKEQK* |
| Ga0070749_103719562 | 3300006802 | Aqueous | MGKLLVKLGQKLIAFNLLLKIKWNNLIDKLKFKIK* |
| Ga0070749_104644643 | 3300006802 | Aqueous | MGKFFIKIGKKIVAFNEYLKGRWNSLLYKLMFKKEK* |
| Ga0070754_100239513 | 3300006810 | Aqueous | MGKFLIKIGNNLVAFNEYLKGKWNSLMYKLMFKKEK* |
| Ga0070754_100556353 | 3300006810 | Aqueous | MGKFFIKIGKKIVSFNEYLKGRWNSLLYKLMFKKEK* |
| Ga0070754_102171232 | 3300006810 | Aqueous | MGKFFIKIGNKLVAFNEYLKGKWNSLMYKLMFKKEK* |
| Ga0070754_103318113 | 3300006810 | Aqueous | MGKFLIKIGNKLVAFNQHLKGEWNSLLYKLMFKKEK* |
| Ga0070754_103391171 | 3300006810 | Aqueous | RFKYKIIMGKFLIKIGKKLVAFNEYLKGEWNSLLYKLMFKKEK* |
| Ga0070750_100835352 | 3300006916 | Aqueous | MGKFLIKIGKKLVEFNEYLKGKWNSLLYKLMFKKEK* |
| Ga0070746_100549957 | 3300006919 | Aqueous | MGKFLIKIGNKLVAFNEYLKGEWNSLLYKLMFKKEQK* |
| Ga0098045_11486593 | 3300006922 | Marine | MGKFLIKIGNKLVEFNKHLKGEWNSLLYKLMFKKEQ |
| Ga0098051_10502732 | 3300006924 | Marine | MGKFFIKIGNKLVAFNKHLKGEWNSLLYKLMFKKEK* |
| Ga0098051_11648981 | 3300006924 | Marine | KYKITMGKFLIKIGNKLVEFNKHLKGEWNSLLYKLMFKKEK* |
| Ga0098050_11552352 | 3300006925 | Marine | MGKFLIKIGKKLVEFNKHLKGEWNSLLYKLMFKKEQK* |
| Ga0098057_10409592 | 3300006926 | Marine | MGKFLIKIGNKLVEFNKHLKGEWNSLLYKLMFKKEQK* |
| Ga0070745_10599551 | 3300007344 | Aqueous | MGKFLIKIGNKLVAFNEYLKGKWNSLLYKLMFKKEQK* |
| Ga0070752_11065574 | 3300007345 | Aqueous | TINMGKFLIKIGNNLVSFNEYLKGKWNSLLYKLMFKKEK* |
| Ga0070753_11736281 | 3300007346 | Aqueous | MGKFLIKIGNKLVAFNEYLKGKWNSLLYKLMFKKEK* |
| Ga0099851_100433311 | 3300007538 | Aqueous | MGKFLIKIGNKLVALNQHLKGEWNSLLYKLMFKKEK* |
| Ga0099851_10111369 | 3300007538 | Aqueous | MGKFLIKIGKKLVAFNEYLKGKWNSLLYKLMFKKEK* |
| Ga0099849_10014918 | 3300007539 | Aqueous | MGKFLIKIGNKLVAFNEYLKGKWNSLLYRLMFKKEK* |
| Ga0099848_10889984 | 3300007541 | Aqueous | MGKFLIKIGNKLVAFNEYLKGKWNSLLYRLMFKKEQK* |
| Ga0102963_11752482 | 3300009001 | Pond Water | MGKFLIKIGNKLVAFNEHLKGEWNSLLYKLMFKKEK* |
| Ga0115004_105900691 | 3300009526 | Marine | MGKFLVKIGKKLIEFNKFLKNKWNSLMYLLMFKNYNE |
| Ga0114919_105057102 | 3300009529 | Deep Subsurface | MGKLLVKIGKKLMAFNQYLKGEWNSLLYKLMFKKEK* |
| Ga0129342_10482595 | 3300010299 | Freshwater To Marine Saline Gradient | MGKFLIKIGNKLVAFNEYLKGKWNSLMYKLMFKKEK* |
| Ga0118731_1144850538 | 3300010392 | Marine | MGKFLVKIGQKLIEFNKFLKNKWNSLMYLLMFKNYNEE |
| Ga0118733_1046307264 | 3300010430 | Marine Sediment | MGKFLVKIGQKLIEFNKFLKNKWNSLMYLLMFKNYNE |
| Ga0133547_101642793 | 3300010883 | Marine | MGKLLVKLGEKLIAFNKFLKGKWNSLLYRLMFKEEKKNGKK* |
| Ga0114922_105454082 | 3300011118 | Deep Subsurface | MGKFLIKIGNKLVAFNEYLKGKWNSLLYKLMYKKKQK* |
| Ga0164320_100830532 | 3300013098 | Marine Sediment | VGKFLIKIGNKLVAFNEYLKGKWNSLLYKLMFKKEK* |
| Ga0164320_104958172 | 3300013098 | Marine Sediment | MGKFFIKIGKKLVAFNEYLKGKWNSLLYKLMFKKEK* |
| Ga0164313_109989423 | 3300013101 | Marine Sediment | MGKFLVKIGKKLIAFNQHLKGEWNSLLYKLMFKKEK* |
| Ga0164313_115477202 | 3300013101 | Marine Sediment | MGKFLIKIGNKLVAFNEYLKGEWNSLLYKLMFKKEK* |
| Ga0164313_116320242 | 3300013101 | Marine Sediment | MGKLLVKIGKKLIAFNQHLKGEWNSLLYKLMFKKEK* |
| Ga0164321_105307721 | 3300014903 | Marine Sediment | IIMGKFLIKIGNKLVSFNIYLKGEWNLLLYKLMFKKEK* |
| Ga0181369_10243422 | 3300017708 | Marine | MGKFLIKIGKKLVAFNEYLKGEWNSLMYKLMFKKEK |
| Ga0181412_10978663 | 3300017714 | Seawater | MGKFLIKIGNKLVAFNEYLKSEWNSLMYKLMFKKEK |
| Ga0181390_10015872 | 3300017719 | Seawater | MGKLLVKLGNKIIKFNEFLKSKWNSLMYKLMFKKEQK |
| Ga0181390_10068172 | 3300017719 | Seawater | MGKFLIKIGNKLVAFNEYLKGEWNSLLYKLMFKKQK |
| Ga0181373_10252252 | 3300017721 | Marine | MGKFLIKIGKKLVAFNEYLKGEWNSLLYKLMFKKEK |
| Ga0181381_10256164 | 3300017726 | Seawater | MGKFLVKIGKKLIAFNQYLKGEWNSLLYKLMFKKEK |
| Ga0181426_10877242 | 3300017733 | Seawater | MGKFLVKIGKKLIAFNQHLKGEWNSLLYKLMFKKEKWRKIK |
| Ga0181433_10360322 | 3300017739 | Seawater | MGKFLVKIGKKLIAFNKHLKGEWNSLLYKLMFKQKGTK |
| Ga0181418_10970902 | 3300017740 | Seawater | MGKFLIKIGKKLVEFNEYLKSKWNSLLYKLMFKKEK |
| Ga0181393_11173103 | 3300017748 | Seawater | GKFLVKIGKKLIAFNQHLKGEWNSLLYKLMFKKEKL |
| Ga0181425_11392032 | 3300017771 | Seawater | MGKFLIKIGNKLVAFNEHLKGEWNSLLYKLMFKKEK |
| Ga0181430_10126285 | 3300017772 | Seawater | MGKFLIKIGNKLVAFNEYLKGEWNSLLYRLMFKKEQK |
| Ga0181394_10132986 | 3300017776 | Seawater | MGKFLIKIGKRLVAFNEYLKGKWNSLIHKLMFKKEK |
| Ga0181607_106331312 | 3300017950 | Salt Marsh | MGKFLIKIGNKLVAFNQHLKGEWNSLLYKLMFKKEK |
| Ga0180434_100248761 | 3300017991 | Hypersaline Lake Sediment | MGKFLIKIGNKLVAFNEYLKGKWNSLLYKLMFKKEQK |
| Ga0180433_110596022 | 3300018080 | Hypersaline Lake Sediment | MGKFLIKIGNKLVAFNEYLKGKWNSLLYKLMFKKEK |
| Ga0181591_106933052 | 3300018424 | Salt Marsh | KLLVKLGNKIIEFNEFLKSKWNSLMYRLMFKKEQK |
| Ga0192881_10012546 | 3300018603 | Marine | MGKFFIKIGNKLVAFNEYLKGKWNSLLYKLMFKKEQK |
| Ga0194015_10333332 | 3300019701 | Sediment | MGKFLVKIGKKLMAFNQHLKGEWNSLLYKLMFKKEK |
| Ga0194029_10240862 | 3300019751 | Freshwater | MGKFLIKIGKKLVEFNEYLKGKWNSLLYKLMFKKEK |
| Ga0206131_103331214 | 3300020185 | Seawater | MGKFLVKIGKKLIEFNKYLKSKWNSLMYFLMFKGYNEECV |
| Ga0206682_100949592 | 3300021185 | Seawater | MGKFFIKIGNKLVAFNEYLKGEWNSLLYKLMFKKEK |
| Ga0213862_1000032421 | 3300021347 | Seawater | MGKFLIKIGKKIVAFNEYLKGEWNSLMYKLMFKKEK |
| Ga0213865_100322632 | 3300021373 | Seawater | MGKFFIKIGNKLVAFNEYLKGKWNSLLYKLMFKKEK |
| Ga0213865_100626814 | 3300021373 | Seawater | MGKLLVKIGKKLIAFNQYLKGEWNSLLYKLMFKKEK |
| Ga0213865_101492132 | 3300021373 | Seawater | MGKFLVKIGKKLIAFNQYLKGEWNSLLYKLMFKQKGTK |
| Ga0213866_105003661 | 3300021425 | Seawater | MGKLLVKIGKKLMAFNQHLKGEWNSLLYKLMFKKEK |
| Ga0222717_100583292 | 3300021957 | Estuarine Water | MGKFLIKIGNKLVEFNKHLKGEWNSLLYKLMFKKEQK |
| Ga0222717_100796824 | 3300021957 | Estuarine Water | MGKFLIKIGNKLVAFNEYLKGKWNSLLYKLMFKKDN |
| Ga0222718_102065723 | 3300021958 | Estuarine Water | MGKLLVKLGQKLIAFNMFLKNKWNNLIDKLKFKIK |
| Ga0224906_10674173 | 3300022074 | Seawater | MGKFLVKIGKKLIAFNQHLKGEWNSLLYKLMFKKEK |
| Ga0224906_11340863 | 3300022074 | Seawater | MGKFLVKIGKKLIAFNQHLKGEWNSLLYKLMFKQKGTK |
| Ga0196905_10056625 | 3300022198 | Aqueous | MGKFLIKIGNKLVAFNEYLKGKWNSLMYKLMFKKEK |
| Ga0196905_10575013 | 3300022198 | Aqueous | MGKFLIKIGKKLVAFNEYLKGKWNSLLYKLMFKKEK |
| Ga0224513_103967662 | 3300022220 | Sediment | MGKFLIKIGNKLVAFNEHLKGKWNSLLYKLMFKKEK |
| (restricted) Ga0233408_100935572 | 3300023089 | Seawater | MGKFFIKIGNKLVAFNEYLKSEWNSLLYKLMFKKEK |
| (restricted) Ga0233411_101408202 | 3300023112 | Seawater | MGKFLIKIGKKLVAFNIYLKGEWNSLLYKLMFKKEK |
| (restricted) Ga0233403_100456562 | 3300023271 | Seawater | MGKFLIKIGNKLVEFNKHLKGEWNSLLYKLMFKKEK |
| Ga0228633_10173702 | 3300024228 | Seawater | MGKFLIKIGNKLVAFNEYLKGEWNSLLYKLMFKKEK |
| (restricted) Ga0255042_101682352 | 3300024340 | Seawater | MGKLLVKLGQKLIAFNMVLKNKWNNLIDKLKFKIK |
| Ga0209986_100224418 | 3300024433 | Deep Subsurface | MGKFLIKIGKKLVAFNEYLKGKWNSLMYKLMFKKEK |
| (restricted) Ga0255046_103115142 | 3300024519 | Seawater | MGKFIKKIGNKLVAFNEYLKGKWNSLLYKLMFKKEK |
| (restricted) Ga0255045_100762864 | 3300024528 | Seawater | MGKFFIKIGNKLVAFNEYLKGEWNSLLYKLMFKKEKQ |
| (restricted) Ga0255044_102562341 | 3300024529 | Seawater | IINMGKFLIKIGNKLVAFNEYLKGKWNSLLYKLMFKKEK |
| Ga0207905_10019783 | 3300025048 | Marine | MGKLLVKLGEKLIAFNKFLKGKWNSLLYKLMFKEEKKNGKK |
| Ga0209645_10229173 | 3300025151 | Marine | MGKFFIKIGKKLVAFNEYLKSKWNSLMYKLMFKKEK |
| Ga0208303_10253783 | 3300025543 | Aqueous | MGKFLIKIGNKLVALNQHLKGEWNSLLYKLMFKKEK |
| Ga0209654_100060173 | 3300025608 | Marine | MGKFLIKIGNKLVSFNIYLKGEWNSLLYKLMFKKEK |
| Ga0208161_10131053 | 3300025646 | Aqueous | MGKFLIKIGNKLVAFNEYLKGKWNSLLYRLMFKKEK |
| Ga0208161_10508334 | 3300025646 | Aqueous | MGKFLIKIGNKLVAFNEYLKGKWNSLLYRLMFKKEQK |
| Ga0208161_11133223 | 3300025646 | Aqueous | MGKFFIKIGNKLVAFNEYLKGKWNSLMYKLMFKKEK |
| Ga0209653_10433914 | 3300025695 | Marine | MGKFFIKIGNKIINCKEHFKGKWNSLMYKLMFKKEK |
| Ga0208542_11539113 | 3300025818 | Aqueous | MGKLLVKLGQKLIAFNLLLKIKWNNLIDKLKFKIK |
| Ga0208645_10151401 | 3300025853 | Aqueous | MGKFLIKIGNKLVAFNEYLKGKWNSLLYKLMFKKEQ |
| Ga0208645_10529412 | 3300025853 | Aqueous | MGKFFIKIGKKIVSFNEYLKGRWNSLLYKLMFKKEK |
| Ga0208644_13455992 | 3300025889 | Aqueous | MGKFFIKIGKKIVAFNEYLKGRWNSLLYKLMFKKEK |
| Ga0209121_102096563 | 3300027742 | Marine | MGKFLIKIGNKLVAFNEYLKGEWNSLLYKLMFKKEQK |
| Ga0208671_101405033 | 3300027757 | Estuarine | KSKLQKIIMGKFFIKIGNKLVAFNEYLKGKWNSLLYKLMFKK |
| Ga0209092_102626141 | 3300027833 | Marine | MGKFLVKIGKKLIEFNKYLKSKWNSLMYTLMFKGYNE |
| Ga0209013_104351882 | 3300027858 | Marine | MGKFLVKIGKKLIAFNQHLKGEWNSLLYKLMFKKEKL |
| Ga0228645_10803981 | 3300028128 | Seawater | TNMGKFFIKIGNKLVAFNEYLKGKWNSLLYKLMFKKEQK |
| Ga0228608_12005491 | 3300028136 | Seawater | KKRFEYKIIMGKFLIKIGNKLVAFNEYLKGKWNSLLYKLMFKKDN |
| Ga0256412_11915142 | 3300028137 | Seawater | MGKFLIKIGNKLVAFNEYLKGKWNSLLYKLMFKKYK |
| Ga0256413_13305922 | 3300028282 | Seawater | MGKFFIKIGNKLVAFNEYLKGEWNSLLYKLMFKKDN |
| Ga0228643_10326593 | 3300028396 | Seawater | MGKFLIKIGNKLVAFNEYLKGKWNTLLYKLMFKKDN |
| Ga0307376_104794421 | 3300031578 | Soil | IFNMGKLLVKLGQKLIAFNMFLKNKWNNLIDKLKFKIK |
| Ga0316202_100720142 | 3300032277 | Microbial Mat | MGKFLIKIGNKLVEFNKHLKSEWNSLLYKLMFKKEK |
| ⦗Top⦘ |