NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F081333

Metagenome Family F081333

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081333
Family Type Metagenome
Number of Sequences 114
Average Sequence Length 46 residues
Representative Sequence MKYLPSVLQVIGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK
Number of Associated Samples 80
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 81.58 %
% of genes near scaffold ends (potentially truncated) 23.68 %
% of genes from short scaffolds (< 2000 bps) 71.05 %
Associated GOLD sequencing projects 74
AlphaFold2 3D model prediction Yes
3D model pTM-score0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (80.702 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(13.158 % of family members)
Environment Ontology (ENVO) Unclassified
(57.018 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(58.772 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.95%    β-sheet: 0.00%    Coil/Unstructured: 46.05%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.61
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF04860Phage_portal 37.72
PF03354TerL_ATPase 21.93
PF04586Peptidase_S78 2.63
PF05065Phage_capsid 2.63
PF13539Peptidase_M15_4 1.75
PF09250Prim-Pol 1.75
PF05135Phage_connect_1 1.75
PF01370Epimerase 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG4626Phage terminase-like protein, large subunit, contains N-terminal HTH domainMobilome: prophages, transposons [X] 21.93
COG3740Phage head maturation proteaseMobilome: prophages, transposons [X] 2.63
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 2.63


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002408|B570J29032_108747136All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes501Open in IMG/M
3300002408|B570J29032_109877521All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1888Open in IMG/M
3300003429|JGI25914J50564_10135430All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes596Open in IMG/M
3300004240|Ga0007787_10200631All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage972Open in IMG/M
3300005517|Ga0070374_10368186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales724Open in IMG/M
3300005527|Ga0068876_10001527All Organisms → cellular organisms → Bacteria18084Open in IMG/M
3300005527|Ga0068876_10265453All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes982Open in IMG/M
3300005581|Ga0049081_10001260All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9606Open in IMG/M
3300005581|Ga0049081_10002825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae6557Open in IMG/M
3300005581|Ga0049081_10171663All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes787Open in IMG/M
3300005582|Ga0049080_10317341All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes501Open in IMG/M
3300005805|Ga0079957_1066928All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2097Open in IMG/M
3300005805|Ga0079957_1132486All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1297Open in IMG/M
3300006484|Ga0070744_10063162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1079Open in IMG/M
3300006805|Ga0075464_10030548All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2870Open in IMG/M
3300006805|Ga0075464_10222579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1124Open in IMG/M
3300006805|Ga0075464_10448092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales787Open in IMG/M
3300006805|Ga0075464_10739322All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage610Open in IMG/M
3300006805|Ga0075464_10879194All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage559Open in IMG/M
3300006805|Ga0075464_11103119All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes500Open in IMG/M
3300006917|Ga0075472_10178142All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300007734|Ga0104986_1456All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15232Open in IMG/M
3300007734|Ga0104986_1652All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage21064Open in IMG/M
3300007972|Ga0105745_1057784All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1078Open in IMG/M
3300008107|Ga0114340_1016568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3523Open in IMG/M
3300008114|Ga0114347_1024233All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2819Open in IMG/M
3300008116|Ga0114350_1013210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3604Open in IMG/M
3300008264|Ga0114353_1133752All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.1272Open in IMG/M
3300008266|Ga0114363_1017364All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3228Open in IMG/M
3300008266|Ga0114363_1021023All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2872Open in IMG/M
3300008266|Ga0114363_1039888All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1924Open in IMG/M
3300008266|Ga0114363_1119036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage920Open in IMG/M
3300008448|Ga0114876_1010882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5178Open in IMG/M
3300008450|Ga0114880_1013639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3931Open in IMG/M
3300008450|Ga0114880_1221476All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300009075|Ga0105090_10104149All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1776Open in IMG/M
3300009081|Ga0105098_10231697All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage864Open in IMG/M
3300009085|Ga0105103_10224092All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1010Open in IMG/M
3300009085|Ga0105103_10530780All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage663Open in IMG/M
3300009152|Ga0114980_10000845All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage21868Open in IMG/M
3300009161|Ga0114966_10131441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1648Open in IMG/M
3300009161|Ga0114966_10520869All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage674Open in IMG/M
3300009163|Ga0114970_10602430All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes591Open in IMG/M
3300009163|Ga0114970_10732363All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300009168|Ga0105104_10231236All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1008Open in IMG/M
3300009183|Ga0114974_10487156All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes693Open in IMG/M
3300009183|Ga0114974_10727533All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes537Open in IMG/M
3300010885|Ga0133913_11385126All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1790Open in IMG/M
3300011115|Ga0151514_10321All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage21880Open in IMG/M
3300012666|Ga0157498_1015166All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1211Open in IMG/M
3300013004|Ga0164293_10372903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria968Open in IMG/M
3300014819|Ga0119954_1042978All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes801Open in IMG/M
3300017785|Ga0181355_1348100All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage545Open in IMG/M
3300017788|Ga0169931_10220844All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1586Open in IMG/M
3300019784|Ga0181359_1010662All Organisms → cellular organisms → Bacteria3272Open in IMG/M
3300019784|Ga0181359_1024368All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2308Open in IMG/M
3300020048|Ga0207193_1214364All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1502Open in IMG/M
3300020205|Ga0211731_10228639All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1440Open in IMG/M
3300020498|Ga0208050_1011201All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes999Open in IMG/M
3300020506|Ga0208091_1005026All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1802Open in IMG/M
3300020527|Ga0208232_1039081All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage625Open in IMG/M
3300020530|Ga0208235_1002548All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2856Open in IMG/M
3300020536|Ga0207939_1040144All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300020551|Ga0208360_1009153All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1435Open in IMG/M
3300020556|Ga0208486_1031011All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage805Open in IMG/M
3300020569|Ga0208229_1059410All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
3300021963|Ga0222712_10356879All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes900Open in IMG/M
3300021963|Ga0222712_10807523All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes516Open in IMG/M
3300022747|Ga0228703_1048420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1157Open in IMG/M
3300022752|Ga0214917_10053135All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2715Open in IMG/M
3300022752|Ga0214917_10072537All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2154Open in IMG/M
3300022752|Ga0214917_10305141All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage706Open in IMG/M
3300023174|Ga0214921_10002785All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage27791Open in IMG/M
3300023174|Ga0214921_10085723All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2457Open in IMG/M
3300023179|Ga0214923_10232919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1054Open in IMG/M
3300023184|Ga0214919_10074569All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3037Open in IMG/M
3300025075|Ga0209615_110279All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage517Open in IMG/M
3300025635|Ga0208147_1035851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1299Open in IMG/M
3300025896|Ga0208916_10010489All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3609Open in IMG/M
3300025896|Ga0208916_10072718All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.1432Open in IMG/M
3300025896|Ga0208916_10072945All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1430Open in IMG/M
3300025896|Ga0208916_10295954All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage704Open in IMG/M
3300025896|Ga0208916_10391957All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage606Open in IMG/M
3300025896|Ga0208916_10398819All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes600Open in IMG/M
3300027659|Ga0208975_1070670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1044Open in IMG/M
3300027683|Ga0209392_1237573All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes546Open in IMG/M
3300027734|Ga0209087_1096456All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1260Open in IMG/M
3300027736|Ga0209190_1030894All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2873Open in IMG/M
3300027754|Ga0209596_1175800All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage931Open in IMG/M
3300027764|Ga0209134_10089200All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1049Open in IMG/M
3300027892|Ga0209550_10318059All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage994Open in IMG/M
3300027963|Ga0209400_1059309All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1937Open in IMG/M
3300027975|Ga0209391_10124436All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1123Open in IMG/M
3300029930|Ga0119944_1004811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2192Open in IMG/M
3300031758|Ga0315907_10150304All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1973Open in IMG/M
3300031758|Ga0315907_10698980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300031787|Ga0315900_10090071All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3027Open in IMG/M
3300031857|Ga0315909_10008894All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10943Open in IMG/M
3300031857|Ga0315909_10060875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3431Open in IMG/M
3300031857|Ga0315909_10750675All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes625Open in IMG/M
3300031951|Ga0315904_11120766All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes612Open in IMG/M
3300031951|Ga0315904_11443807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage510Open in IMG/M
3300032050|Ga0315906_10522478All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage998Open in IMG/M
3300032050|Ga0315906_11267508All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes529Open in IMG/M
3300032093|Ga0315902_10010175All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12469Open in IMG/M
3300032116|Ga0315903_10369629All Organisms → Viruses → Predicted Viral1180Open in IMG/M
3300033233|Ga0334722_10746465All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes694Open in IMG/M
3300033521|Ga0316616_100113906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2437Open in IMG/M
3300034061|Ga0334987_0547319All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes695Open in IMG/M
3300034095|Ga0335022_0471398All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage661Open in IMG/M
3300034101|Ga0335027_0334551All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1008Open in IMG/M
3300034106|Ga0335036_0001789All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage19015Open in IMG/M
3300034122|Ga0335060_0309346All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage861Open in IMG/M
3300034283|Ga0335007_0282548All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1098Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater13.16%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.28%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake10.53%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater10.53%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake8.77%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton7.02%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment6.14%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater5.26%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic4.39%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.39%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.51%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.63%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake1.75%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.75%
Freshwater, Surface IceEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice0.88%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.88%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.88%
AquaticEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic0.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.88%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.88%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300003429Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007734Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015JanEnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008264Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011115Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016MayEnvironmentalOpen in IMG/M
3300012666Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300014819Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011AEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020498Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020506Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020527Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020530Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020536Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020551Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020556Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020569Freshwater microbial communities from Lake Mendota, WI - 22AUG2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022747Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MGEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300025075Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027683Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027975Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300029930Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034095Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B570J29032_10874713623300002408FreshwaterMKYLSSALQVVGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK*
B570J29032_10987752133300002408FreshwaterMKYLSSALQVTGSILIIAGVATFNPVVAVILAGAFLVLFGVALENRGK*
JGI25914J50564_1013543023300003429Freshwater LakeMKYIPSVLQVVGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK*
Ga0007787_1020063113300004240Freshwater LakeMKYLPSALQVSGSLLIIAGVATFNPIVAVILSGAFLVLFGIALENRGK*
Ga0070374_1036818623300005517Freshwater LakeMKYLPSVLQVVGSFLIVAGVATFYPVVAVILSGVFLVLFGIALENRGK*
Ga0068876_10001527283300005527Freshwater LakeMKYLSSALQVIGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK*
Ga0068876_1026545323300005527Freshwater LakeMKYLSSILQVSGSLLIVAGVATINSLVAVILSGAFLVLFGIALENRGK*
Ga0049081_1000126043300005581Freshwater LenticMKYIPSVLQVIGSLLIVAGVATISPLIAVILSGAFLVLFGIALENRGK*
Ga0049081_1000282593300005581Freshwater LenticMKYLPSALQVLGSSVIIAGVATYNPFVAVILAGAFLVLFGIALENRGK*
Ga0049081_1017166323300005581Freshwater LenticMKYLSSILQVSGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK*
Ga0049080_1031734113300005582Freshwater LenticMKYLPSVLQVVGSFLIVAGVATFYPVVAVILSGVFL
Ga0079957_106692833300005805LakeMKYLPSVLQVIGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK*
Ga0079957_113248623300005805LakeMKYISSVLQIIGSLVIVAGVATLNPLVAVILSGAFLVLFGIALENRGK*
Ga0070744_1006316223300006484EstuarineMKYIPSVLQVIGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK*
Ga0075464_1003054823300006805AqueousMKYIPSVLQVVGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGR*
Ga0075464_1022257923300006805AqueousMKYIPSVLQIIGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK*
Ga0075464_1044809223300006805AqueousMKYLSSALQVAGSLLIVAGVATINPIVAVILSGALLVLFGVALENRGK*
Ga0075464_1073932223300006805AqueousMKYIPSVLQVTGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK*
Ga0075464_1087919413300006805AqueousMKYLPSALQVAGSFLIVAGVATFYPVVAVILSGVFLVLFGIALENRGK*
Ga0075464_1110311923300006805AqueousMKYLPSVLQIIGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK*
Ga0075472_1017814223300006917AqueousMKYIPSVLQVIGSLITVAGVATFNPIVAVILSGVFLVLFGIALENRGK*
Ga0104986_145643300007734FreshwaterMKYLPSVLQIIGSLLIVAGVATINPLVAVILWGAFLVLFGIALENRGK*
Ga0104986_1652333300007734FreshwaterMKYLPSALQITGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK*
Ga0105745_105778423300007972Estuary WaterMKYISSVLQIIGSLLIVAGVATINPLIAVILSGAFLILFGIALENRGK*
Ga0114340_101656823300008107Freshwater, PlanktonMKYLPSALQLSGSLLIVAGVATFNPVVAVILSGAFLVLFGIALENRGK*
Ga0114347_102423323300008114Freshwater, PlanktonMKYISSVLQIIGSLVIVAGVATINPLIAVILSGAFLVLFGIALENRGK*
Ga0114350_101321033300008116Freshwater, PlanktonMKYIPSVLQITGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK*
Ga0114353_113375223300008264Freshwater, PlanktonMKYLSSALQVIGSLFIVAGVATFNTVVAVILAGAFLVLFGVALENRGK*
Ga0114363_101736433300008266Freshwater, PlanktonMKYLSSALQITGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK*
Ga0114363_102102323300008266Freshwater, PlanktonMKYISSVLQIMGSLVIVAGVATINPLIAVILSGAFLVLFGIALENRGK*
Ga0114363_103988813300008266Freshwater, PlanktonMKYLSSALQIVGSLIIVAGVATINSIVAVILSGALLVLFGIALENRGK*
Ga0114363_111903613300008266Freshwater, PlanktonSLLIVAGVATFNPVVAVILSGAFLVLFGIALENRGK*
Ga0114876_101088223300008448Freshwater LakeMKYISSVLQITGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK*
Ga0114880_101363923300008450Freshwater LakeMKYLSSALQIVGSLIIVAGVATINSIVAVILSGALLVLFGVALENRGK*
Ga0114880_122147623300008450Freshwater LakeMKYIPSVLQVTGCLIIIAGVATINPLIAVTLSGAFLILFGIALENRGK*
Ga0105090_1010414923300009075Freshwater SedimentMKYIPSVLQIIGSLLIVAGVATISPLIAVILSGAFLVLFGIALENRGK*
Ga0105098_1023169723300009081Freshwater SedimentALQVIGSILIIAGVATFNPVVAVILAGAFLVLFGVALENRGK*
Ga0105103_1022409223300009085Freshwater SedimentMKYLSSALQVIGSILIIAGVATFNPVVAVILAGAFLVLFGVALENRGK*
Ga0105103_1053078023300009085Freshwater SedimentMKYISSVLQIIGSLVIVAGVATISPLIAVILSGAFLVLFGIALENRGK*
Ga0114980_10000845123300009152Freshwater LakeMKYIPSVLQVIGSLVTVAGVATFNPVVAVILSGVFLVLFGIALENRGK*
Ga0114966_1013144123300009161Freshwater LakeMKYIPSVLQVIGSLLTVAGVATFNPVVAVILSGVFLILFGIALENRGK*
Ga0114966_1052086913300009161Freshwater LakeGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGR*
Ga0114970_1060243013300009163Freshwater LakeMKYIPSVLQVIGSLLTVAGVATFNPVVAVILSGVFLVLFGI
Ga0114970_1073236313300009163Freshwater LakeSSVLQVIGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK*
Ga0105104_1023123623300009168Freshwater SedimentMKYLSSALQVTGSILIIAGVATFNPVVAVILAGAFLVLFGIALENRGK*
Ga0114974_1048715613300009183Freshwater LakeMKYIPSVLQITGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK*
Ga0114974_1072753323300009183Freshwater LakeMKYLPSALQVIGSLLTIAGVATFNPVVAVILTGVFLVLFGIALENRGK*
Ga0133913_1138512623300010885Freshwater LakeMKYIPSVLQVTGCLIIIAGVATINPLIAVTLSGAFLILFGIALEKRGK*
Ga0151514_10321373300011115FreshwaterMKYLPSVLQVAGSFLIVAGVATFYPVVAVILSGVFLVLFGIALENRGK*
Ga0157498_101516613300012666Freshwater, Surface IceYIPSVLQVIGSLVIVAGVATINPLVAVILSGAFLVLFGIALENRGK*
Ga0164293_1037290323300013004FreshwaterMKYIPSVLQITGSLLIVAGVATINPLIAVILSGAFLVLFGIALENRGK*
Ga0119954_104297813300014819FreshwaterMKYLSSILQVSGSLLIVAGVATINPLVAVILSGAFLVLFGIALE
Ga0181355_134810023300017785Freshwater LakeKYIPSVLQVVGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK
Ga0169931_1022084423300017788FreshwaterMKYLSSILQVVGSLLIVAGVATINPLVALILSGAFLVLFGIALENRGK
Ga0181359_101066223300019784Freshwater LakeMKYLPSVLQVVGSFLIVAGVATFYPVVAVILSGVFLVLFGIALENRGK
Ga0181359_102436823300019784Freshwater LakeMKYIPSVLQVVGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK
Ga0207193_121436423300020048Freshwater Lake SedimentMKYIPSVLQVVGSLLTVAGVATFNPVVAVILSGVFL
Ga0211731_1022863923300020205FreshwaterMKYIPSVLQITGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK
Ga0208050_101120123300020498FreshwaterMKYIPSVLQVIGSLLIVAGVATISPLIAVILSGAFLVLFGIALENRGK
Ga0208091_100502623300020506FreshwaterMKYLSSALQVTGSILIIAGVATFNPVVAVILAGAFLVLFGVALENRGK
Ga0208232_103908123300020527FreshwaterMKYLSSALQVIGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK
Ga0208235_100254823300020530FreshwaterMKYLSSALQVVGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK
Ga0207939_104014413300020536FreshwaterILMKYLSSALQVVGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK
Ga0208360_100915323300020551FreshwaterMKYIPSVLQITGTLVIVAGVATINPLIAVLLSGAFLVLFGIALENRGK
Ga0208486_103101123300020556FreshwaterSSALQVIGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK
Ga0208229_105941023300020569FreshwaterSSVLQIIGSLVIVAGVATINPLIAVILSGAFLVLFGIALENRGK
Ga0222712_1035687913300021963Estuarine WaterMKYLPSALQVAGSFLIVAGVATFYPIVAVILSGVFLVLFGIALENRGK
Ga0222712_1080752323300021963Estuarine WaterMKYLSSALQIVGSLVIVAGVATINPIVAVILSGALLVLFGVALENRGK
Ga0228703_104842023300022747FreshwaterMKYLPSALQVSGSLLIIAGVATFNPIVAVILSGAFLVLFGIALENRGK
Ga0214917_1005313523300022752FreshwaterMKYLSSALQVAGSLLIVAGVATINPIVAVILSGAFLVLFGVALENRGK
Ga0214917_1007253713300022752FreshwaterMKYIPSVLQVTGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK
Ga0214917_1030514113300022752FreshwaterSFLIVAGVATFYPLVAVILSGVFLVLFGIALENRGK
Ga0214921_10002785293300023174FreshwaterMKYIPSVLQVIGSLVIVAGVATFNPVVAVILSGVFLVLFGIALENRGK
Ga0214921_1008572323300023174FreshwaterMKYIPSVLQVIGSLLTIAGVATFNPVVAVILSGVFLVLFGIALENRGK
Ga0214923_1023291923300023179FreshwaterMKYIPSVLQVIGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK
Ga0214919_1007456923300023184FreshwaterMKYIPSILQVVGSLITVAGVATFNPVVAVILSGVFLVLFGIALENRGK
Ga0209615_11027923300025075FreshwaterISSVLQIIGSLVIVAGVATINPLIAVILSGAFLVLFGIALENRGK
Ga0208147_103585123300025635AqueousMKYLPSALQVLGSSVIIAGVATYNPFVAVILAGAFLVLFGIALENRGK
Ga0208916_1001048943300025896AqueousMKYIPSVLQIIGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK
Ga0208916_1007271813300025896AqueousMKYLSSILQVSGSLLIVAGVATINPLVAVILSGAFLVLFGIALEKR
Ga0208916_1007294523300025896AqueousMKYLPSALQVSGSSLIIAGVATFNPIVAVILSGAFLVLFGIALENRGK
Ga0208916_1029595413300025896AqueousMKYLSSALQVIGSLFIVAGVATFNLVVAVILAGAFLVLFGVALENRGK
Ga0208916_1039195723300025896AqueousMKYLPSVLQIIGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK
Ga0208916_1039881923300025896AqueousMKYLSSALQVAGSLLIVAGVATINPIVAVILSGALLVLFGVALENRGK
Ga0208975_107067023300027659Freshwater LenticMKYLSSILQVSGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK
Ga0209392_123757323300027683Freshwater SedimentMKYIPSVLQIIGSLLIVAGVATISPLIAVILSGAFLVLFG
Ga0209087_109645623300027734Freshwater LakeMKYIPSVLQVIGSLVTVAGVATFNPVVAVILSGVFLVLFGIALENRGK
Ga0209190_103089443300027736Freshwater LakeMKYIPSVLQVTGCLIIIAGVATINPLIAVTLSGAFLILFGIALENRGK
Ga0209596_117580023300027754Freshwater LakeMKYIPSVLQVIGSLLTVAGVATFNPVVAVILSGVFLILFGIALENRGK
Ga0209134_1008920013300027764Freshwater LakeMKYISSVLQIIGSLLIVAGVATINPLIAVILSGAFLILFGIALENRGK
Ga0209550_1031805923300027892Freshwater LakeNILMKYLPSVLQVVGSFLIVAGVATFYPVVAVILSGVFLVLFGIALENRGK
Ga0209400_105930933300027963Freshwater LakeMKYISSVLQVIGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK
Ga0209391_1012443623300027975Freshwater SedimentMKYIPSVLQIIGSLLIVAGVATISPLIAVILSGAFLVLFGVALENRGK
Ga0119944_100481123300029930AquaticMKYLPSALQITGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK
Ga0315907_1015030433300031758FreshwaterMKYLPSALQLSGSLLIVAGVATFNPVVAVILSGAFLVLFGIALENRGK
Ga0315907_1069898023300031758FreshwaterMKYISSVLQIIGSLVIVAGVATINPLIAVILSGAFLVLFGIALENRGK
Ga0315900_1009007143300031787FreshwaterMKYLSSILQVSGSLLIVAGVATINSLVAVILSGAFLVLFGIALENRGK
Ga0315909_10008894253300031857FreshwaterMKYISSVLQIMGSLVIVAGVATINPLIAVILSGAFLVLFGIALENRGK
Ga0315909_1006087513300031857FreshwaterQLSGSLLIVAGVATFNPVVAVILSGAFLVLFGIALENRGK
Ga0315909_1075067513300031857FreshwaterMKYLSSALQIIGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK
Ga0315904_1112076613300031951FreshwaterMKYLSSILQISGSLLIVAGVATINSLVAVILSGAFLVLFGIALENRGK
Ga0315904_1144380723300031951FreshwaterMKYLSSALQITGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK
Ga0315906_1052247813300032050FreshwaterSGSLLIVAGVATFNPVVAVILSGAFLVLFGIALENRGK
Ga0315906_1126750823300032050FreshwaterMKYLSSMLQVSGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK
Ga0315902_10010175223300032093FreshwaterTGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK
Ga0315903_1036962923300032116FreshwaterMKYLSSALQITGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRG
Ga0334722_1074646523300033233SedimentMKYLPSVLQVVGSFLIVAGVATFYPVVAVILSGVFLVLFGIA
Ga0316616_10011390633300033521SoilMKYLSSILQIVGALLIVAGVATYNPVLAVILSGGFFVLFGVALENRGK
Ga0334987_0547319_388_5343300034061FreshwaterMKYIPSVLQVIGSLLIVAGVATIYPIIAVILSGAFLVLFGIALENRGK
Ga0335022_0471398_3_1283300034095FreshwaterLQVVGSFLIVAGVATFYPVVAVILSGVFLVLFGIALENRGK
Ga0335027_0334551_772_9183300034101FreshwaterMKYLPSVLQVVGSFLIVAGVATFYAVVAVILSGVFLVLFGIALENRGK
Ga0335036_0001789_16922_170683300034106FreshwaterMKYLPSVIQVIGSFLIVASVATINPLIAVILLGAFLVLFGIALENRGK
Ga0335060_0309346_3_1163300034122FreshwaterGSLLIVAGVATISPLIAVILSGAFLVLFGIALENRGK
Ga0335007_0282548_989_10963300034283FreshwaterLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.