| Basic Information | |
|---|---|
| Family ID | F081333 |
| Family Type | Metagenome |
| Number of Sequences | 114 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKYLPSVLQVIGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 81.58 % |
| % of genes near scaffold ends (potentially truncated) | 23.68 % |
| % of genes from short scaffolds (< 2000 bps) | 71.05 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (80.702 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (13.158 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.018 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (58.772 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.95% β-sheet: 0.00% Coil/Unstructured: 46.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF04860 | Phage_portal | 37.72 |
| PF03354 | TerL_ATPase | 21.93 |
| PF04586 | Peptidase_S78 | 2.63 |
| PF05065 | Phage_capsid | 2.63 |
| PF13539 | Peptidase_M15_4 | 1.75 |
| PF09250 | Prim-Pol | 1.75 |
| PF05135 | Phage_connect_1 | 1.75 |
| PF01370 | Epimerase | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 21.93 |
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 2.63 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 2.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_108747136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 501 | Open in IMG/M |
| 3300002408|B570J29032_109877521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1888 | Open in IMG/M |
| 3300003429|JGI25914J50564_10135430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 596 | Open in IMG/M |
| 3300004240|Ga0007787_10200631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 972 | Open in IMG/M |
| 3300005517|Ga0070374_10368186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 724 | Open in IMG/M |
| 3300005527|Ga0068876_10001527 | All Organisms → cellular organisms → Bacteria | 18084 | Open in IMG/M |
| 3300005527|Ga0068876_10265453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 982 | Open in IMG/M |
| 3300005581|Ga0049081_10001260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9606 | Open in IMG/M |
| 3300005581|Ga0049081_10002825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 6557 | Open in IMG/M |
| 3300005581|Ga0049081_10171663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 787 | Open in IMG/M |
| 3300005582|Ga0049080_10317341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 501 | Open in IMG/M |
| 3300005805|Ga0079957_1066928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2097 | Open in IMG/M |
| 3300005805|Ga0079957_1132486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1297 | Open in IMG/M |
| 3300006484|Ga0070744_10063162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1079 | Open in IMG/M |
| 3300006805|Ga0075464_10030548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2870 | Open in IMG/M |
| 3300006805|Ga0075464_10222579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1124 | Open in IMG/M |
| 3300006805|Ga0075464_10448092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 787 | Open in IMG/M |
| 3300006805|Ga0075464_10739322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300006805|Ga0075464_10879194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300006805|Ga0075464_11103119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 500 | Open in IMG/M |
| 3300006917|Ga0075472_10178142 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300007734|Ga0104986_1456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15232 | Open in IMG/M |
| 3300007734|Ga0104986_1652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21064 | Open in IMG/M |
| 3300007972|Ga0105745_1057784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1078 | Open in IMG/M |
| 3300008107|Ga0114340_1016568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3523 | Open in IMG/M |
| 3300008114|Ga0114347_1024233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2819 | Open in IMG/M |
| 3300008116|Ga0114350_1013210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3604 | Open in IMG/M |
| 3300008264|Ga0114353_1133752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1272 | Open in IMG/M |
| 3300008266|Ga0114363_1017364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3228 | Open in IMG/M |
| 3300008266|Ga0114363_1021023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2872 | Open in IMG/M |
| 3300008266|Ga0114363_1039888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1924 | Open in IMG/M |
| 3300008266|Ga0114363_1119036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
| 3300008448|Ga0114876_1010882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5178 | Open in IMG/M |
| 3300008450|Ga0114880_1013639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3931 | Open in IMG/M |
| 3300008450|Ga0114880_1221476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300009075|Ga0105090_10104149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1776 | Open in IMG/M |
| 3300009081|Ga0105098_10231697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
| 3300009085|Ga0105103_10224092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
| 3300009085|Ga0105103_10530780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300009152|Ga0114980_10000845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21868 | Open in IMG/M |
| 3300009161|Ga0114966_10131441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1648 | Open in IMG/M |
| 3300009161|Ga0114966_10520869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300009163|Ga0114970_10602430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 591 | Open in IMG/M |
| 3300009163|Ga0114970_10732363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300009168|Ga0105104_10231236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1008 | Open in IMG/M |
| 3300009183|Ga0114974_10487156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 693 | Open in IMG/M |
| 3300009183|Ga0114974_10727533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 537 | Open in IMG/M |
| 3300010885|Ga0133913_11385126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1790 | Open in IMG/M |
| 3300011115|Ga0151514_10321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21880 | Open in IMG/M |
| 3300012666|Ga0157498_1015166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1211 | Open in IMG/M |
| 3300013004|Ga0164293_10372903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 968 | Open in IMG/M |
| 3300014819|Ga0119954_1042978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 801 | Open in IMG/M |
| 3300017785|Ga0181355_1348100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300017788|Ga0169931_10220844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1586 | Open in IMG/M |
| 3300019784|Ga0181359_1010662 | All Organisms → cellular organisms → Bacteria | 3272 | Open in IMG/M |
| 3300019784|Ga0181359_1024368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2308 | Open in IMG/M |
| 3300020048|Ga0207193_1214364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1502 | Open in IMG/M |
| 3300020205|Ga0211731_10228639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1440 | Open in IMG/M |
| 3300020498|Ga0208050_1011201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 999 | Open in IMG/M |
| 3300020506|Ga0208091_1005026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1802 | Open in IMG/M |
| 3300020527|Ga0208232_1039081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
| 3300020530|Ga0208235_1002548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2856 | Open in IMG/M |
| 3300020536|Ga0207939_1040144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300020551|Ga0208360_1009153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1435 | Open in IMG/M |
| 3300020556|Ga0208486_1031011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
| 3300020569|Ga0208229_1059410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300021963|Ga0222712_10356879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 900 | Open in IMG/M |
| 3300021963|Ga0222712_10807523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 516 | Open in IMG/M |
| 3300022747|Ga0228703_1048420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1157 | Open in IMG/M |
| 3300022752|Ga0214917_10053135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2715 | Open in IMG/M |
| 3300022752|Ga0214917_10072537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2154 | Open in IMG/M |
| 3300022752|Ga0214917_10305141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300023174|Ga0214921_10002785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27791 | Open in IMG/M |
| 3300023174|Ga0214921_10085723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2457 | Open in IMG/M |
| 3300023179|Ga0214923_10232919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1054 | Open in IMG/M |
| 3300023184|Ga0214919_10074569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3037 | Open in IMG/M |
| 3300025075|Ga0209615_110279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300025635|Ga0208147_1035851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1299 | Open in IMG/M |
| 3300025896|Ga0208916_10010489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3609 | Open in IMG/M |
| 3300025896|Ga0208916_10072718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1432 | Open in IMG/M |
| 3300025896|Ga0208916_10072945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1430 | Open in IMG/M |
| 3300025896|Ga0208916_10295954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300025896|Ga0208916_10391957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300025896|Ga0208916_10398819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 600 | Open in IMG/M |
| 3300027659|Ga0208975_1070670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1044 | Open in IMG/M |
| 3300027683|Ga0209392_1237573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 546 | Open in IMG/M |
| 3300027734|Ga0209087_1096456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1260 | Open in IMG/M |
| 3300027736|Ga0209190_1030894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2873 | Open in IMG/M |
| 3300027754|Ga0209596_1175800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
| 3300027764|Ga0209134_10089200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1049 | Open in IMG/M |
| 3300027892|Ga0209550_10318059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 994 | Open in IMG/M |
| 3300027963|Ga0209400_1059309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1937 | Open in IMG/M |
| 3300027975|Ga0209391_10124436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1123 | Open in IMG/M |
| 3300029930|Ga0119944_1004811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2192 | Open in IMG/M |
| 3300031758|Ga0315907_10150304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1973 | Open in IMG/M |
| 3300031758|Ga0315907_10698980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
| 3300031787|Ga0315900_10090071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3027 | Open in IMG/M |
| 3300031857|Ga0315909_10008894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10943 | Open in IMG/M |
| 3300031857|Ga0315909_10060875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3431 | Open in IMG/M |
| 3300031857|Ga0315909_10750675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 625 | Open in IMG/M |
| 3300031951|Ga0315904_11120766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 612 | Open in IMG/M |
| 3300031951|Ga0315904_11443807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300032050|Ga0315906_10522478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
| 3300032050|Ga0315906_11267508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 529 | Open in IMG/M |
| 3300032093|Ga0315902_10010175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12469 | Open in IMG/M |
| 3300032116|Ga0315903_10369629 | All Organisms → Viruses → Predicted Viral | 1180 | Open in IMG/M |
| 3300033233|Ga0334722_10746465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 694 | Open in IMG/M |
| 3300033521|Ga0316616_100113906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2437 | Open in IMG/M |
| 3300034061|Ga0334987_0547319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 695 | Open in IMG/M |
| 3300034095|Ga0335022_0471398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300034101|Ga0335027_0334551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1008 | Open in IMG/M |
| 3300034106|Ga0335036_0001789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19015 | Open in IMG/M |
| 3300034122|Ga0335060_0309346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
| 3300034283|Ga0335007_0282548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1098 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.16% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.28% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.53% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.53% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.77% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.02% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 6.14% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.26% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.39% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.39% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.51% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.63% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.75% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.75% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.88% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.88% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.88% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.88% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.88% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020569 | Freshwater microbial communities from Lake Mendota, WI - 22AUG2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1087471362 | 3300002408 | Freshwater | MKYLSSALQVVGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK* |
| B570J29032_1098775213 | 3300002408 | Freshwater | MKYLSSALQVTGSILIIAGVATFNPVVAVILAGAFLVLFGVALENRGK* |
| JGI25914J50564_101354302 | 3300003429 | Freshwater Lake | MKYIPSVLQVVGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK* |
| Ga0007787_102006311 | 3300004240 | Freshwater Lake | MKYLPSALQVSGSLLIIAGVATFNPIVAVILSGAFLVLFGIALENRGK* |
| Ga0070374_103681862 | 3300005517 | Freshwater Lake | MKYLPSVLQVVGSFLIVAGVATFYPVVAVILSGVFLVLFGIALENRGK* |
| Ga0068876_1000152728 | 3300005527 | Freshwater Lake | MKYLSSALQVIGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK* |
| Ga0068876_102654532 | 3300005527 | Freshwater Lake | MKYLSSILQVSGSLLIVAGVATINSLVAVILSGAFLVLFGIALENRGK* |
| Ga0049081_100012604 | 3300005581 | Freshwater Lentic | MKYIPSVLQVIGSLLIVAGVATISPLIAVILSGAFLVLFGIALENRGK* |
| Ga0049081_100028259 | 3300005581 | Freshwater Lentic | MKYLPSALQVLGSSVIIAGVATYNPFVAVILAGAFLVLFGIALENRGK* |
| Ga0049081_101716632 | 3300005581 | Freshwater Lentic | MKYLSSILQVSGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK* |
| Ga0049080_103173411 | 3300005582 | Freshwater Lentic | MKYLPSVLQVVGSFLIVAGVATFYPVVAVILSGVFL |
| Ga0079957_10669283 | 3300005805 | Lake | MKYLPSVLQVIGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK* |
| Ga0079957_11324862 | 3300005805 | Lake | MKYISSVLQIIGSLVIVAGVATLNPLVAVILSGAFLVLFGIALENRGK* |
| Ga0070744_100631622 | 3300006484 | Estuarine | MKYIPSVLQVIGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK* |
| Ga0075464_100305482 | 3300006805 | Aqueous | MKYIPSVLQVVGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGR* |
| Ga0075464_102225792 | 3300006805 | Aqueous | MKYIPSVLQIIGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK* |
| Ga0075464_104480922 | 3300006805 | Aqueous | MKYLSSALQVAGSLLIVAGVATINPIVAVILSGALLVLFGVALENRGK* |
| Ga0075464_107393222 | 3300006805 | Aqueous | MKYIPSVLQVTGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK* |
| Ga0075464_108791941 | 3300006805 | Aqueous | MKYLPSALQVAGSFLIVAGVATFYPVVAVILSGVFLVLFGIALENRGK* |
| Ga0075464_111031192 | 3300006805 | Aqueous | MKYLPSVLQIIGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK* |
| Ga0075472_101781422 | 3300006917 | Aqueous | MKYIPSVLQVIGSLITVAGVATFNPIVAVILSGVFLVLFGIALENRGK* |
| Ga0104986_14564 | 3300007734 | Freshwater | MKYLPSVLQIIGSLLIVAGVATINPLVAVILWGAFLVLFGIALENRGK* |
| Ga0104986_165233 | 3300007734 | Freshwater | MKYLPSALQITGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK* |
| Ga0105745_10577842 | 3300007972 | Estuary Water | MKYISSVLQIIGSLLIVAGVATINPLIAVILSGAFLILFGIALENRGK* |
| Ga0114340_10165682 | 3300008107 | Freshwater, Plankton | MKYLPSALQLSGSLLIVAGVATFNPVVAVILSGAFLVLFGIALENRGK* |
| Ga0114347_10242332 | 3300008114 | Freshwater, Plankton | MKYISSVLQIIGSLVIVAGVATINPLIAVILSGAFLVLFGIALENRGK* |
| Ga0114350_10132103 | 3300008116 | Freshwater, Plankton | MKYIPSVLQITGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK* |
| Ga0114353_11337522 | 3300008264 | Freshwater, Plankton | MKYLSSALQVIGSLFIVAGVATFNTVVAVILAGAFLVLFGVALENRGK* |
| Ga0114363_10173643 | 3300008266 | Freshwater, Plankton | MKYLSSALQITGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK* |
| Ga0114363_10210232 | 3300008266 | Freshwater, Plankton | MKYISSVLQIMGSLVIVAGVATINPLIAVILSGAFLVLFGIALENRGK* |
| Ga0114363_10398881 | 3300008266 | Freshwater, Plankton | MKYLSSALQIVGSLIIVAGVATINSIVAVILSGALLVLFGIALENRGK* |
| Ga0114363_11190361 | 3300008266 | Freshwater, Plankton | SLLIVAGVATFNPVVAVILSGAFLVLFGIALENRGK* |
| Ga0114876_10108822 | 3300008448 | Freshwater Lake | MKYISSVLQITGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK* |
| Ga0114880_10136392 | 3300008450 | Freshwater Lake | MKYLSSALQIVGSLIIVAGVATINSIVAVILSGALLVLFGVALENRGK* |
| Ga0114880_12214762 | 3300008450 | Freshwater Lake | MKYIPSVLQVTGCLIIIAGVATINPLIAVTLSGAFLILFGIALENRGK* |
| Ga0105090_101041492 | 3300009075 | Freshwater Sediment | MKYIPSVLQIIGSLLIVAGVATISPLIAVILSGAFLVLFGIALENRGK* |
| Ga0105098_102316972 | 3300009081 | Freshwater Sediment | ALQVIGSILIIAGVATFNPVVAVILAGAFLVLFGVALENRGK* |
| Ga0105103_102240922 | 3300009085 | Freshwater Sediment | MKYLSSALQVIGSILIIAGVATFNPVVAVILAGAFLVLFGVALENRGK* |
| Ga0105103_105307802 | 3300009085 | Freshwater Sediment | MKYISSVLQIIGSLVIVAGVATISPLIAVILSGAFLVLFGIALENRGK* |
| Ga0114980_1000084512 | 3300009152 | Freshwater Lake | MKYIPSVLQVIGSLVTVAGVATFNPVVAVILSGVFLVLFGIALENRGK* |
| Ga0114966_101314412 | 3300009161 | Freshwater Lake | MKYIPSVLQVIGSLLTVAGVATFNPVVAVILSGVFLILFGIALENRGK* |
| Ga0114966_105208691 | 3300009161 | Freshwater Lake | GSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGR* |
| Ga0114970_106024301 | 3300009163 | Freshwater Lake | MKYIPSVLQVIGSLLTVAGVATFNPVVAVILSGVFLVLFGI |
| Ga0114970_107323631 | 3300009163 | Freshwater Lake | SSVLQVIGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK* |
| Ga0105104_102312362 | 3300009168 | Freshwater Sediment | MKYLSSALQVTGSILIIAGVATFNPVVAVILAGAFLVLFGIALENRGK* |
| Ga0114974_104871561 | 3300009183 | Freshwater Lake | MKYIPSVLQITGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK* |
| Ga0114974_107275332 | 3300009183 | Freshwater Lake | MKYLPSALQVIGSLLTIAGVATFNPVVAVILTGVFLVLFGIALENRGK* |
| Ga0133913_113851262 | 3300010885 | Freshwater Lake | MKYIPSVLQVTGCLIIIAGVATINPLIAVTLSGAFLILFGIALEKRGK* |
| Ga0151514_1032137 | 3300011115 | Freshwater | MKYLPSVLQVAGSFLIVAGVATFYPVVAVILSGVFLVLFGIALENRGK* |
| Ga0157498_10151661 | 3300012666 | Freshwater, Surface Ice | YIPSVLQVIGSLVIVAGVATINPLVAVILSGAFLVLFGIALENRGK* |
| Ga0164293_103729032 | 3300013004 | Freshwater | MKYIPSVLQITGSLLIVAGVATINPLIAVILSGAFLVLFGIALENRGK* |
| Ga0119954_10429781 | 3300014819 | Freshwater | MKYLSSILQVSGSLLIVAGVATINPLVAVILSGAFLVLFGIALE |
| Ga0181355_13481002 | 3300017785 | Freshwater Lake | KYIPSVLQVVGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK |
| Ga0169931_102208442 | 3300017788 | Freshwater | MKYLSSILQVVGSLLIVAGVATINPLVALILSGAFLVLFGIALENRGK |
| Ga0181359_10106622 | 3300019784 | Freshwater Lake | MKYLPSVLQVVGSFLIVAGVATFYPVVAVILSGVFLVLFGIALENRGK |
| Ga0181359_10243682 | 3300019784 | Freshwater Lake | MKYIPSVLQVVGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK |
| Ga0207193_12143642 | 3300020048 | Freshwater Lake Sediment | MKYIPSVLQVVGSLLTVAGVATFNPVVAVILSGVFL |
| Ga0211731_102286392 | 3300020205 | Freshwater | MKYIPSVLQITGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK |
| Ga0208050_10112012 | 3300020498 | Freshwater | MKYIPSVLQVIGSLLIVAGVATISPLIAVILSGAFLVLFGIALENRGK |
| Ga0208091_10050262 | 3300020506 | Freshwater | MKYLSSALQVTGSILIIAGVATFNPVVAVILAGAFLVLFGVALENRGK |
| Ga0208232_10390812 | 3300020527 | Freshwater | MKYLSSALQVIGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK |
| Ga0208235_10025482 | 3300020530 | Freshwater | MKYLSSALQVVGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK |
| Ga0207939_10401441 | 3300020536 | Freshwater | ILMKYLSSALQVVGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK |
| Ga0208360_10091532 | 3300020551 | Freshwater | MKYIPSVLQITGTLVIVAGVATINPLIAVLLSGAFLVLFGIALENRGK |
| Ga0208486_10310112 | 3300020556 | Freshwater | SSALQVIGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK |
| Ga0208229_10594102 | 3300020569 | Freshwater | SSVLQIIGSLVIVAGVATINPLIAVILSGAFLVLFGIALENRGK |
| Ga0222712_103568791 | 3300021963 | Estuarine Water | MKYLPSALQVAGSFLIVAGVATFYPIVAVILSGVFLVLFGIALENRGK |
| Ga0222712_108075232 | 3300021963 | Estuarine Water | MKYLSSALQIVGSLVIVAGVATINPIVAVILSGALLVLFGVALENRGK |
| Ga0228703_10484202 | 3300022747 | Freshwater | MKYLPSALQVSGSLLIIAGVATFNPIVAVILSGAFLVLFGIALENRGK |
| Ga0214917_100531352 | 3300022752 | Freshwater | MKYLSSALQVAGSLLIVAGVATINPIVAVILSGAFLVLFGVALENRGK |
| Ga0214917_100725371 | 3300022752 | Freshwater | MKYIPSVLQVTGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK |
| Ga0214917_103051411 | 3300022752 | Freshwater | SFLIVAGVATFYPLVAVILSGVFLVLFGIALENRGK |
| Ga0214921_1000278529 | 3300023174 | Freshwater | MKYIPSVLQVIGSLVIVAGVATFNPVVAVILSGVFLVLFGIALENRGK |
| Ga0214921_100857232 | 3300023174 | Freshwater | MKYIPSVLQVIGSLLTIAGVATFNPVVAVILSGVFLVLFGIALENRGK |
| Ga0214923_102329192 | 3300023179 | Freshwater | MKYIPSVLQVIGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK |
| Ga0214919_100745692 | 3300023184 | Freshwater | MKYIPSILQVVGSLITVAGVATFNPVVAVILSGVFLVLFGIALENRGK |
| Ga0209615_1102792 | 3300025075 | Freshwater | ISSVLQIIGSLVIVAGVATINPLIAVILSGAFLVLFGIALENRGK |
| Ga0208147_10358512 | 3300025635 | Aqueous | MKYLPSALQVLGSSVIIAGVATYNPFVAVILAGAFLVLFGIALENRGK |
| Ga0208916_100104894 | 3300025896 | Aqueous | MKYIPSVLQIIGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK |
| Ga0208916_100727181 | 3300025896 | Aqueous | MKYLSSILQVSGSLLIVAGVATINPLVAVILSGAFLVLFGIALEKR |
| Ga0208916_100729452 | 3300025896 | Aqueous | MKYLPSALQVSGSSLIIAGVATFNPIVAVILSGAFLVLFGIALENRGK |
| Ga0208916_102959541 | 3300025896 | Aqueous | MKYLSSALQVIGSLFIVAGVATFNLVVAVILAGAFLVLFGVALENRGK |
| Ga0208916_103919572 | 3300025896 | Aqueous | MKYLPSVLQIIGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK |
| Ga0208916_103988192 | 3300025896 | Aqueous | MKYLSSALQVAGSLLIVAGVATINPIVAVILSGALLVLFGVALENRGK |
| Ga0208975_10706702 | 3300027659 | Freshwater Lentic | MKYLSSILQVSGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK |
| Ga0209392_12375732 | 3300027683 | Freshwater Sediment | MKYIPSVLQIIGSLLIVAGVATISPLIAVILSGAFLVLFG |
| Ga0209087_10964562 | 3300027734 | Freshwater Lake | MKYIPSVLQVIGSLVTVAGVATFNPVVAVILSGVFLVLFGIALENRGK |
| Ga0209190_10308944 | 3300027736 | Freshwater Lake | MKYIPSVLQVTGCLIIIAGVATINPLIAVTLSGAFLILFGIALENRGK |
| Ga0209596_11758002 | 3300027754 | Freshwater Lake | MKYIPSVLQVIGSLLTVAGVATFNPVVAVILSGVFLILFGIALENRGK |
| Ga0209134_100892001 | 3300027764 | Freshwater Lake | MKYISSVLQIIGSLLIVAGVATINPLIAVILSGAFLILFGIALENRGK |
| Ga0209550_103180592 | 3300027892 | Freshwater Lake | NILMKYLPSVLQVVGSFLIVAGVATFYPVVAVILSGVFLVLFGIALENRGK |
| Ga0209400_10593093 | 3300027963 | Freshwater Lake | MKYISSVLQVIGSLLTVAGVATFNPVVAVILSGVFLVLFGIALENRGK |
| Ga0209391_101244362 | 3300027975 | Freshwater Sediment | MKYIPSVLQIIGSLLIVAGVATISPLIAVILSGAFLVLFGVALENRGK |
| Ga0119944_10048112 | 3300029930 | Aquatic | MKYLPSALQITGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK |
| Ga0315907_101503043 | 3300031758 | Freshwater | MKYLPSALQLSGSLLIVAGVATFNPVVAVILSGAFLVLFGIALENRGK |
| Ga0315907_106989802 | 3300031758 | Freshwater | MKYISSVLQIIGSLVIVAGVATINPLIAVILSGAFLVLFGIALENRGK |
| Ga0315900_100900714 | 3300031787 | Freshwater | MKYLSSILQVSGSLLIVAGVATINSLVAVILSGAFLVLFGIALENRGK |
| Ga0315909_1000889425 | 3300031857 | Freshwater | MKYISSVLQIMGSLVIVAGVATINPLIAVILSGAFLVLFGIALENRGK |
| Ga0315909_100608751 | 3300031857 | Freshwater | QLSGSLLIVAGVATFNPVVAVILSGAFLVLFGIALENRGK |
| Ga0315909_107506751 | 3300031857 | Freshwater | MKYLSSALQIIGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK |
| Ga0315904_111207661 | 3300031951 | Freshwater | MKYLSSILQISGSLLIVAGVATINSLVAVILSGAFLVLFGIALENRGK |
| Ga0315904_114438072 | 3300031951 | Freshwater | MKYLSSALQITGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK |
| Ga0315906_105224781 | 3300032050 | Freshwater | SGSLLIVAGVATFNPVVAVILSGAFLVLFGIALENRGK |
| Ga0315906_112675082 | 3300032050 | Freshwater | MKYLSSMLQVSGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK |
| Ga0315902_1001017522 | 3300032093 | Freshwater | TGSLLIVAGVATINPLVAVILSGAFLVLFGIALENRGK |
| Ga0315903_103696292 | 3300032116 | Freshwater | MKYLSSALQITGSLFIVAGVATFNPVVAVILAGAFLVLFGVALENRG |
| Ga0334722_107464652 | 3300033233 | Sediment | MKYLPSVLQVVGSFLIVAGVATFYPVVAVILSGVFLVLFGIA |
| Ga0316616_1001139063 | 3300033521 | Soil | MKYLSSILQIVGALLIVAGVATYNPVLAVILSGGFFVLFGVALENRGK |
| Ga0334987_0547319_388_534 | 3300034061 | Freshwater | MKYIPSVLQVIGSLLIVAGVATIYPIIAVILSGAFLVLFGIALENRGK |
| Ga0335022_0471398_3_128 | 3300034095 | Freshwater | LQVVGSFLIVAGVATFYPVVAVILSGVFLVLFGIALENRGK |
| Ga0335027_0334551_772_918 | 3300034101 | Freshwater | MKYLPSVLQVVGSFLIVAGVATFYAVVAVILSGVFLVLFGIALENRGK |
| Ga0335036_0001789_16922_17068 | 3300034106 | Freshwater | MKYLPSVIQVIGSFLIVASVATINPLIAVILLGAFLVLFGIALENRGK |
| Ga0335060_0309346_3_116 | 3300034122 | Freshwater | GSLLIVAGVATISPLIAVILSGAFLVLFGIALENRGK |
| Ga0335007_0282548_989_1096 | 3300034283 | Freshwater | LFIVAGVATFNPVVAVILAGAFLVLFGVALENRGK |
| ⦗Top⦘ |