Basic Information | |
---|---|
Family ID | F081330 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 114 |
Average Sequence Length | 46 residues |
Representative Sequence | MTMEQEILGFTNWLYTNNWKLIGDGMCLNTETKAIGYIDELMVEYNK |
Number of Associated Samples | 87 |
Number of Associated Scaffolds | 114 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 34.21 % |
% of genes near scaffold ends (potentially truncated) | 15.79 % |
% of genes from short scaffolds (< 2000 bps) | 75.44 % |
Associated GOLD sequencing projects | 79 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (48.246 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (30.702 % of family members) |
Environment Ontology (ENVO) | Unclassified (60.526 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (74.561 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 72.34% β-sheet: 0.00% Coil/Unstructured: 27.66% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 114 Family Scaffolds |
---|---|---|
PF14279 | HNH_5 | 39.47 |
PF01844 | HNH | 11.40 |
PF01555 | N6_N4_Mtase | 4.39 |
PF13748 | ABC_membrane_3 | 3.51 |
PF06467 | zf-FCS | 0.88 |
COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
---|---|---|---|
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 4.39 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 4.39 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 4.39 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 67.54 % |
Unclassified | root | N/A | 32.46 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002161|JGI24766J26685_10003093 | All Organisms → Viruses → Predicted Viral | 4907 | Open in IMG/M |
3300002408|B570J29032_109611499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 936 | Open in IMG/M |
3300002447|JGI24768J34885_10006464 | All Organisms → Viruses → Predicted Viral | 3861 | Open in IMG/M |
3300002447|JGI24768J34885_10140621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
3300002835|B570J40625_100058495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5329 | Open in IMG/M |
3300002835|B570J40625_100140283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2796 | Open in IMG/M |
3300003404|JGI25920J50251_10068173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
3300003986|Ga0063233_10094646 | Not Available | 877 | Open in IMG/M |
3300004054|Ga0063232_10256218 | Not Available | 529 | Open in IMG/M |
3300004769|Ga0007748_11294375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
3300005517|Ga0070374_10073181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1786 | Open in IMG/M |
3300005517|Ga0070374_10182311 | All Organisms → Viruses → Predicted Viral | 1084 | Open in IMG/M |
3300005662|Ga0078894_10694705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
3300005662|Ga0078894_11745598 | Not Available | 509 | Open in IMG/M |
3300006484|Ga0070744_10109561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
3300007555|Ga0102817_1106487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300007559|Ga0102828_1079706 | Not Available | 784 | Open in IMG/M |
3300007621|Ga0102872_1096391 | Not Available | 794 | Open in IMG/M |
3300007708|Ga0102859_1261020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300007734|Ga0104986_1970 | Not Available | 72142 | Open in IMG/M |
3300008107|Ga0114340_1168442 | Not Available | 783 | Open in IMG/M |
3300008110|Ga0114343_1214146 | Not Available | 544 | Open in IMG/M |
3300008117|Ga0114351_1050463 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 2601 | Open in IMG/M |
3300008267|Ga0114364_1034837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4368 | Open in IMG/M |
3300008267|Ga0114364_1097909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
3300008448|Ga0114876_1048934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1923 | Open in IMG/M |
3300008448|Ga0114876_1102526 | All Organisms → Viruses → Predicted Viral | 1136 | Open in IMG/M |
3300008448|Ga0114876_1120120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1009 | Open in IMG/M |
3300008996|Ga0102831_1023412 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2105 | Open in IMG/M |
3300009026|Ga0102829_1095643 | Not Available | 923 | Open in IMG/M |
3300009026|Ga0102829_1313275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300009152|Ga0114980_10138564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1445 | Open in IMG/M |
3300009155|Ga0114968_10032198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3502 | Open in IMG/M |
3300009158|Ga0114977_10273262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
3300009159|Ga0114978_10509271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300009163|Ga0114970_10003621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11298 | Open in IMG/M |
3300009164|Ga0114975_10169898 | All Organisms → Viruses → Predicted Viral | 1241 | Open in IMG/M |
3300009164|Ga0114975_10612250 | Not Available | 580 | Open in IMG/M |
3300009169|Ga0105097_10378903 | Not Available | 785 | Open in IMG/M |
3300009180|Ga0114979_10467395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300009183|Ga0114974_10486158 | Not Available | 694 | Open in IMG/M |
3300009184|Ga0114976_10012517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5233 | Open in IMG/M |
3300010338|Ga0116245_10099574 | All Organisms → Viruses → Predicted Viral | 1729 | Open in IMG/M |
3300010885|Ga0133913_11194492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1951 | Open in IMG/M |
3300017699|Ga0181345_103450 | Not Available | 622 | Open in IMG/M |
3300017716|Ga0181350_1067076 | Not Available | 926 | Open in IMG/M |
3300017722|Ga0181347_1021372 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 2042 | Open in IMG/M |
3300017723|Ga0181362_1086276 | Not Available | 631 | Open in IMG/M |
3300017761|Ga0181356_1075811 | Not Available | 1122 | Open in IMG/M |
3300017774|Ga0181358_1280433 | Not Available | 514 | Open in IMG/M |
3300017780|Ga0181346_1329986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300017784|Ga0181348_1016022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3221 | Open in IMG/M |
3300017784|Ga0181348_1092517 | Not Available | 1188 | Open in IMG/M |
3300017785|Ga0181355_1197042 | Not Available | 793 | Open in IMG/M |
3300017785|Ga0181355_1318657 | Not Available | 579 | Open in IMG/M |
3300019784|Ga0181359_1009539 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 3406 | Open in IMG/M |
3300019784|Ga0181359_1176283 | Not Available | 710 | Open in IMG/M |
3300020141|Ga0211732_1329809 | Not Available | 714 | Open in IMG/M |
3300020151|Ga0211736_10854495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3297 | Open in IMG/M |
3300020159|Ga0211734_10646653 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
3300020159|Ga0211734_10877252 | Not Available | 913 | Open in IMG/M |
3300020160|Ga0211733_10127879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
3300020162|Ga0211735_11380629 | Not Available | 1225 | Open in IMG/M |
3300020549|Ga0207942_1001839 | All Organisms → Viruses → Predicted Viral | 3835 | Open in IMG/M |
3300020562|Ga0208597_1050414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
3300020572|Ga0207909_1068704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300021519|Ga0194048_10046692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1763 | Open in IMG/M |
3300021961|Ga0222714_10214212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1103 | Open in IMG/M |
3300022190|Ga0181354_1073526 | All Organisms → Viruses → Predicted Viral | 1132 | Open in IMG/M |
3300022190|Ga0181354_1176113 | Not Available | 653 | Open in IMG/M |
3300022190|Ga0181354_1225201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300022407|Ga0181351_1035855 | All Organisms → Viruses → Predicted Viral | 2102 | Open in IMG/M |
3300022407|Ga0181351_1146519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 854 | Open in IMG/M |
3300022407|Ga0181351_1167501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
3300023184|Ga0214919_10060050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3531 | Open in IMG/M |
3300023184|Ga0214919_10216830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1413 | Open in IMG/M |
3300023184|Ga0214919_10285253 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1152 | Open in IMG/M |
3300023184|Ga0214919_10549440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
3300024346|Ga0244775_10040287 | All Organisms → Viruses → Predicted Viral | 4116 | Open in IMG/M |
3300024346|Ga0244775_10093469 | All Organisms → Viruses → Predicted Viral | 2560 | Open in IMG/M |
3300024346|Ga0244775_10180540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1775 | Open in IMG/M |
3300024346|Ga0244775_10554651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
3300027642|Ga0209135_1166244 | Not Available | 699 | Open in IMG/M |
3300027679|Ga0209769_1091140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 993 | Open in IMG/M |
3300027707|Ga0209443_1308165 | Not Available | 525 | Open in IMG/M |
3300027732|Ga0209442_1060845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1602 | Open in IMG/M |
3300027754|Ga0209596_1017352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4440 | Open in IMG/M |
3300027756|Ga0209444_10088907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1289 | Open in IMG/M |
3300027759|Ga0209296_1107950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1316 | Open in IMG/M |
3300027769|Ga0209770_10231740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
3300027782|Ga0209500_10101088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1428 | Open in IMG/M |
3300027798|Ga0209353_10213442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
3300027805|Ga0209229_10051313 | All Organisms → Viruses → Predicted Viral | 1838 | Open in IMG/M |
3300027836|Ga0209230_10000759 | Not Available | 12561 | Open in IMG/M |
3300027836|Ga0209230_10050823 | Not Available | 2174 | Open in IMG/M |
3300027836|Ga0209230_10507705 | Not Available | 683 | Open in IMG/M |
3300027836|Ga0209230_10685863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300027892|Ga0209550_10331690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
3300027899|Ga0209668_11008907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300027969|Ga0209191_1004579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7997 | Open in IMG/M |
3300031758|Ga0315907_10177588 | All Organisms → Viruses → Predicted Viral | 1794 | Open in IMG/M |
3300031784|Ga0315899_11430225 | Not Available | 584 | Open in IMG/M |
3300031787|Ga0315900_10260582 | Not Available | 1472 | Open in IMG/M |
3300031834|Ga0315290_10715417 | Not Available | 862 | Open in IMG/M |
3300031857|Ga0315909_10095046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2587 | Open in IMG/M |
3300031951|Ga0315904_10083456 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 3412 | Open in IMG/M |
3300031997|Ga0315278_11703170 | Not Available | 599 | Open in IMG/M |
3300031999|Ga0315274_10255461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2127 | Open in IMG/M |
3300032050|Ga0315906_10805744 | Not Available | 736 | Open in IMG/M |
3300032050|Ga0315906_10982029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300032092|Ga0315905_10562342 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
3300032116|Ga0315903_10165284 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 2012 | Open in IMG/M |
3300034013|Ga0334991_0228821 | Not Available | 789 | Open in IMG/M |
3300034104|Ga0335031_0820052 | Not Available | 518 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 30.70% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.16% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.89% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 7.02% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.14% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.14% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.26% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.39% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.39% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 4.39% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.63% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.63% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.88% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.88% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.88% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.88% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.88% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.88% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300010338 | AD_JPMRca | Engineered | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300017699 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24766J26685_1000309311 | 3300002161 | Freshwater And Sediment | MEQEILGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMVEYKK* |
B570J29032_1096114993 | 3300002408 | Freshwater | MEQEILGFTNWLYTNNWKLIGDGMCLNLETKEIGYINELMVEYELIAEYKE* |
JGI24768J34885_100064645 | 3300002447 | Freshwater And Sediment | MEQEILGFTNWLYTNNWKLIGDGMCLNTETKAIGYIDELMVEYKKYKL* |
JGI24768J34885_101406211 | 3300002447 | Freshwater And Sediment | MSLEKEILGFTNWLYTNNWKLIGDGMCLNTETKEIGCIDELMVEYNK* |
B570J40625_10005849515 | 3300002835 | Freshwater | MTMEQEILGFTNWLYTNNWKLIGDGMCLNLETKEIGYINELMVEYELIAEYKE* |
B570J40625_1001402833 | 3300002835 | Freshwater | MSLEKEILGFTNWLYANNWKLIGDGMCLNLETKSIGYINELMVEYNK* |
JGI25920J50251_100681732 | 3300003404 | Freshwater Lake | MEQEILGFTNWLYTNNWKLIGAGMCLNTETKAIGYIDELMVEYNK* |
Ga0063233_100946462 | 3300003986 | Freshwater Lake | MGQEILGFTNWLYTNNWKLIGAGMCLNTETKAIGYIDELMVEYNK* |
Ga0063232_102562182 | 3300004054 | Freshwater Lake | MSLEKEILGFTNWLYTNNWKLIGDGMCLNTETKAIGYIDELMVEYNK* |
Ga0007748_112943752 | 3300004769 | Freshwater Lake | MSLEKEILGFTNWLYINNWKLIGDGMCLNLETKAIGRIDELMVEYNK* |
Ga0070374_100731813 | 3300005517 | Freshwater Lake | MEQEILGFTNWLYTNNWKLIGDGMCLNTETKAIGYIDELMVEYNK* |
Ga0070374_101823113 | 3300005517 | Freshwater Lake | MSLEKEILGFTNWLYTNNWKLIGDGMCLNLETKAIGRIDELMVEYNK* |
Ga0078894_106947052 | 3300005662 | Freshwater Lake | MSLEKEILGFTNWLYANNWKLIGDGMCLNLETKAIGYINELMVEYKN* |
Ga0078894_117455981 | 3300005662 | Freshwater Lake | MSLEKEILGFTNWLYTNNWKLIGDGMCLNTETKAIGYINELMVEYNK* |
Ga0070744_101095612 | 3300006484 | Estuarine | MSLEKEILGFTNWLYTNNWKLIGDGMCLNLETKAIGRIDELMVEYKN* |
Ga0102817_11064872 | 3300007555 | Estuarine | MTTAQDILGFTNWLYINNWKLIGDGMCLNIKTKDIGYINELMVEYELIDEYKE* |
Ga0102828_10797063 | 3300007559 | Estuarine | MSLEKEILGFTNWLYTNNWKLIGAGMCLNTETKAIGYIDELMVEYNK* |
Ga0102872_10963913 | 3300007621 | Estuarine | MTMEQEILGFTNWLYINNWKLIGDGMCLNLETKAIGRIDELMVEYKK* |
Ga0102859_12610202 | 3300007708 | Estuarine | MTMEQEILGFTNWLYTNNWKLIGDGMCLNTETKAIGYIDELIVEYKK* |
Ga0104986_197096 | 3300007734 | Freshwater | MSLEKEILGFTNWLYTNNWKLIGDGMCLNTETKAIGRIDELMVEYNK* |
Ga0114340_11684423 | 3300008107 | Freshwater, Plankton | MTMEQEMLGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMVEYKK* |
Ga0114343_12141462 | 3300008110 | Freshwater, Plankton | MTMEQEMLGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMVEYKN* |
Ga0114351_10504633 | 3300008117 | Freshwater, Plankton | MTTTEEILGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMVEYNK* |
Ga0114364_103483713 | 3300008267 | Freshwater, Plankton | MTTAQDILGFTNWLYINNWKLIGDGMCLNLETKAIGYIEELMVEYKK* |
Ga0114364_10979092 | 3300008267 | Freshwater, Plankton | MTMGQEILGFTNWLYTNNWKLIGAGMCLNTETKAIGYIDELMVEYNK* |
Ga0114876_10489342 | 3300008448 | Freshwater Lake | MEQEMLGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMTEYKK* |
Ga0114876_11025263 | 3300008448 | Freshwater Lake | MEQEMLGFTNWLYINNWKLIGDGMCLNTETKAIGYINELMTEYNK* |
Ga0114876_11201202 | 3300008448 | Freshwater Lake | MTMEQEILGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMVEYKK* |
Ga0102831_10234123 | 3300008996 | Estuarine | MTTAQDILGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMVEYKK* |
Ga0102829_10956433 | 3300009026 | Estuarine | MTMEQEILGFTNWLYTNNWKLIGDGMCLNTETKAIGYIDELMVEYNK* |
Ga0102829_13132752 | 3300009026 | Estuarine | MTMEQEILGFTNWLYINNWKLIGDGMCLNLETKAIGRIDELMVEYNK* |
Ga0114980_101385643 | 3300009152 | Freshwater Lake | MSLEKEILGFTNWLYTNNWKLIGDGMCLNTETKMIGRIDELMVEYNK* |
Ga0114968_100321982 | 3300009155 | Freshwater Lake | MSLEKEILGFTNWLYINNWKLIGDGMCLNTETKAIGRIDELMVEYKK* |
Ga0114977_102732622 | 3300009158 | Freshwater Lake | MSLEKEILGFTNWLYTNNWKLIGDGMCLNIETKAIGRIDELMVEYNK* |
Ga0114978_105092712 | 3300009159 | Freshwater Lake | MTTAQDILGFTNWLYINNWKLIGDGMCLNLETKEIGYIEELMVEYKK* |
Ga0114970_100036218 | 3300009163 | Freshwater Lake | MTTAQDILGFTNWLYNNNWKLIGDGMCLNLETKAIGYIDELMVEYKK* |
Ga0114975_101698983 | 3300009164 | Freshwater Lake | MSLEKEILGFTNWLYANNWKLIGDGMCLNTETKAIGYINELMVEYKN* |
Ga0114975_106122501 | 3300009164 | Freshwater Lake | LEKEILGFTNWLYTNNWKLIGDGMCLNTETKAIGYIDELMVEYNK* |
Ga0105097_103789032 | 3300009169 | Freshwater Sediment | MSLEKEILGFTNWLYTNNWKLIGDGMCLNTETKVIGRIDELMVEYNK* |
Ga0114979_104673952 | 3300009180 | Freshwater Lake | MSLEKEILGFKNWLYTKNWKLIGDGMCLNIETKAIGRIDELMVEYNK* |
Ga0114974_104861581 | 3300009183 | Freshwater Lake | MTTSQEILGFTNWLYDNNWKLIGDGMCLNLETKAIGYINELMVEYKK* |
Ga0114976_1001251715 | 3300009184 | Freshwater Lake | MSLEKEILGFTNWLYANNWKLIGDGMCLNTETKAIGYIDELMVEYNK* |
Ga0116245_100995744 | 3300010338 | Anaerobic Digestor Sludge | MTTGQEILDFTNWLHKNNWKLIGDGMCLHLESKQIKFIKDLLVESK* |
Ga0133913_111944925 | 3300010885 | Freshwater Lake | MSLEKEILGFTNWLYTNNWKLIGTGMCLNTETKAIGYIDELMVE |
Ga0181345_1034501 | 3300017699 | Freshwater Lake | MEQEILGFTNWLYTNNWKLIGDGMCLNTETKAIGYIDELMVEYKK |
Ga0181350_10670761 | 3300017716 | Freshwater Lake | MLLEKEILGFTNWLYTNNWKLIGAGMCLNTETKAIGYIDELMVEYNK |
Ga0181347_10213721 | 3300017722 | Freshwater Lake | MSLEKEILGFTNWLYTNNWKLIGAGMCLNTETKAIGYIDELMVEY |
Ga0181362_10862761 | 3300017723 | Freshwater Lake | EQEILGFTNWLYINNWRLIGDGMCLNLETKAIGRIDELMVEYNK |
Ga0181356_10758114 | 3300017761 | Freshwater Lake | FTNWLYTNNWKLIGAGMCLNTETKAIGYIDELMVEYNK |
Ga0181358_12804331 | 3300017774 | Freshwater Lake | NGETMSLEKEILGFTNWLYTNNWKLIGDGMCLNLETKAIGRIDELMVEYNK |
Ga0181346_13299862 | 3300017780 | Freshwater Lake | MGQEILGFTNWLYTNNWKLIGDGMCLNTETKAIGYIDELMV |
Ga0181348_10160222 | 3300017784 | Freshwater Lake | MTMEQDILGFTNWLYINNWKLIGDGMCLNLETKAIGYIEELMVEYKK |
Ga0181348_10925174 | 3300017784 | Freshwater Lake | MGQEILGFTNWLYTNNWKLIGDGMCLNTETKAIGYIDELMVEYNK |
Ga0181355_11970421 | 3300017785 | Freshwater Lake | EILGFTNWLYTNNWKLIGAGMCLNTETKAIGYIDELMVEYNK |
Ga0181355_13186571 | 3300017785 | Freshwater Lake | MTTAQDILGFTNWLYNNNWKLIGDGMCLNLETKAIGYIEELMVEYKK |
Ga0181359_10095396 | 3300019784 | Freshwater Lake | MSLEKEILGFTNWLYTNNWKLIGDGMCLNLETKAIGYINELMVEYNK |
Ga0181359_11762834 | 3300019784 | Freshwater Lake | MEQEILGFTNWLYTNNWKLIGAGMCLNTETKAIGYIDELMVEYNK |
Ga0211732_13298093 | 3300020141 | Freshwater | MTTTEEILGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMVEYNK |
Ga0211736_1085449513 | 3300020151 | Freshwater | MEQEILSFTNWLYINNWKLIGAGMCLNTETKDIGYINELMVEYNK |
Ga0211734_106466533 | 3300020159 | Freshwater | MTTTEEILGFTNWLYNNNWKLIGDGMCLNLETKEIGYVNELMTEYKK |
Ga0211734_108772522 | 3300020159 | Freshwater | MEQEILSFTNWLYINNWKLIGDGMCLNTETKAIGRINELMVEYNK |
Ga0211733_101278793 | 3300020160 | Freshwater | MEQEILSFTNWLYINNWKLIGAGMCLNTETKDIGYINELMV |
Ga0211735_113806292 | 3300020162 | Freshwater | MTTTEEILGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMVEYKN |
Ga0207942_100183911 | 3300020549 | Freshwater | MSLEKEILGFTNWLYANNWKLIGDGMCLNLETKSIGYINELMVEYNK |
Ga0208597_10504143 | 3300020562 | Freshwater | MTMEQEILGFTNWLYTNNWKLIGDGMCLNLETKEIGYINELMVEYELIAEYKE |
Ga0207909_10687042 | 3300020572 | Freshwater | MSLEKEILGFTNWLYTNNWKLIGDGMCLNLETKEIGYINELMVEYELIAEYKE |
Ga0194048_100466922 | 3300021519 | Anoxic Zone Freshwater | MLLEKEILGFTNWLYTNNWKLIGDGMCLNIETKAIGRIDELMVEYNK |
Ga0222714_102142123 | 3300021961 | Estuarine Water | MSLEKEILGFTNWLYANNWKLIGDGMCLNLETKAIGYINELMVEYKN |
Ga0181354_10735262 | 3300022190 | Freshwater Lake | MSLEKEILGFTNWLYTNNWKLIGDGMCLNLETKAIGRIDELMVEYNK |
Ga0181354_11761134 | 3300022190 | Freshwater Lake | INMTMEQEILGFTNWLYTNNWKLIGDGMCLNTETKAIGYIDELMVEYKK |
Ga0181354_12252011 | 3300022190 | Freshwater Lake | MSLEKEILGFTNWLYINNWKLIGDGMCLNLETKAIGRIDELMVEYNK |
Ga0181351_10358551 | 3300022407 | Freshwater Lake | MEQEILGFTNWLYTNNWKLIGDGMCLNTETKAIGYIDELMVEYNK |
Ga0181351_11465192 | 3300022407 | Freshwater Lake | MSLEKEILGFTNWLYTNNWKLIGDGMCLNIETKAIGRIDELMVEYNK |
Ga0181351_11675012 | 3300022407 | Freshwater Lake | MTMGQEILGFTNWLYTNNWKLIGAGMCLNTETKAIGYIDELMVEYNK |
Ga0214919_100600503 | 3300023184 | Freshwater | MLLEKEILGFTNWLYTNNWKLIGDGMCLNTETKAIGRIDELMVEYNK |
Ga0214919_102168301 | 3300023184 | Freshwater | MTTAQDILGFTNWLYINNWKLIGDGMCLNLETKAIGYIDELMIEYKK |
Ga0214919_102852532 | 3300023184 | Freshwater | MTTVQDILGFTNWLYINNWKLIGDGMCLNLETKAIGYIEELMVEYKN |
Ga0214919_105494402 | 3300023184 | Freshwater | MSLEKEILGFTNWLYTNNWKLIGDGMCLNTETKAIGRIDELMVEYNK |
Ga0244775_1004028710 | 3300024346 | Estuarine | MTTAQDILGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMVEYKK |
Ga0244775_100934694 | 3300024346 | Estuarine | MSLEKEILGFTNWLYTNNWKLIGDGMCLNLETKAIGRIDELMVEYKN |
Ga0244775_101805401 | 3300024346 | Estuarine | MSLEKEILGFTNWLYANNWKLIGDGMCLNLETKAIGRIDELMVEYNK |
Ga0244775_105546511 | 3300024346 | Estuarine | MEQEILGFTNWLYINNWKLIGDGMCLNTETKEIGYINELMVEYKK |
Ga0209135_11662441 | 3300027642 | Freshwater Lake | LCQKLIDMTTAQDILGFTNWLYINNWKLIGDGMCLNLETKAIGYIEELMVEYKK |
Ga0209769_10911401 | 3300027679 | Freshwater Lake | MEQEILGFTNWLYTNNWKLIGDGMCLNLETKAIGYIDELMVEYKK |
Ga0209443_13081652 | 3300027707 | Freshwater Lake | MTTAQDILGFTNWLYNNNWKLIGDGMCLNLETKAIGYIDELMVEYKK |
Ga0209442_10608452 | 3300027732 | Freshwater Lake | MSLEKEILGFTNWLYTNNWKLIGAGMCLNTETKAIGYIDELMVEYNK |
Ga0209596_10173528 | 3300027754 | Freshwater Lake | MSLEKEILGFTNWLYINNWKLIGDGMCLNTETKAIGRIDELMVEYKK |
Ga0209444_100889072 | 3300027756 | Freshwater Lake | MSLEKEILGFTNWLYTNNWKLIGDGMCLNTETKAIGYIDELMVEYNK |
Ga0209296_11079505 | 3300027759 | Freshwater Lake | MSLEKEILGFTNWLYANNWKLIGDGMCLNTETKAIGYIDELMVEYNK |
Ga0209770_102317402 | 3300027769 | Freshwater Lake | MSLEKEILGFTNWLYTNNWKLIGDGMCLNTETKAIGYINELMVEYNK |
Ga0209500_101010885 | 3300027782 | Freshwater Lake | MTTAQDILGFTNWLYINNWKLIGDGMCLNLETKEIGYIEELMVEYKK |
Ga0209353_102134422 | 3300027798 | Freshwater Lake | MGQEILGFTNWLYTNNWKLIGAGMCLNTETKAIGYIDELMVEYNK |
Ga0209229_100513136 | 3300027805 | Freshwater And Sediment | MEQEILGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMVEYKN |
Ga0209230_1000075934 | 3300027836 | Freshwater And Sediment | MEQEILGFTNWLYTNNWKLIGDGMCLNTETKAIGYIDELMVEYKKYKL |
Ga0209230_100508236 | 3300027836 | Freshwater And Sediment | YSYLCQKLIDMTTAQDILGFTNWLYNNNWKLIGDGMCLNLETKAIGYIEELMVEYKK |
Ga0209230_105077053 | 3300027836 | Freshwater And Sediment | MEQEILGFTNWLYTNNWKLIGAGMCLNTETKMIGRIDELMVEYNK |
Ga0209230_106858632 | 3300027836 | Freshwater And Sediment | MSLEKEILGFTNWLYTNNWKLIGDGMCLNTETKEIGCIDELMVEYNK |
Ga0209550_103316904 | 3300027892 | Freshwater Lake | MSLEKEILGFTNWLYTNNWKLIGDGMCLNTETKAIGYIDELM |
Ga0209668_110089072 | 3300027899 | Freshwater Lake Sediment | MEQDILGFTNWLYINNWKLIGDGMCLNIKTKDIGYINELMVEYELIAEYKE |
Ga0209191_10045793 | 3300027969 | Freshwater Lake | MSLEKEILGFTNWLYANNWKLIGDGMCLNTETKAIGYINELMVEYKN |
Ga0315907_101775882 | 3300031758 | Freshwater | MTMEQEMLGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMTEYKK |
Ga0315899_114302253 | 3300031784 | Freshwater | LCQKLIDMTMEQEMLGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMTEYKK |
Ga0315900_102605821 | 3300031787 | Freshwater | MEQEMLGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMTEYKK |
Ga0315290_107154172 | 3300031834 | Sediment | MTTAEEILGFTNWLYNNNWKLIGDGMCLNTETKAIGYIDELMVEYKN |
Ga0315909_100950468 | 3300031857 | Freshwater | MEQEMLGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMVEYKN |
Ga0315904_100834563 | 3300031951 | Freshwater | MTMEQEILGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMTEYKK |
Ga0315278_117031701 | 3300031997 | Sediment | MTTAEEILGFTNWLYNNNWKLIGDGMCLNTETKKVSKITELVNQ |
Ga0315274_102554612 | 3300031999 | Sediment | MTLEKELLDFTNWLYNNNWKLIGDGMCLNTETKAIGYIDELMVEYKN |
Ga0315906_108057441 | 3300032050 | Freshwater | MLGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMTEYKK |
Ga0315906_109820292 | 3300032050 | Freshwater | MEQEILGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMTEYKK |
Ga0315905_105623421 | 3300032092 | Freshwater | MTTAQDILGFTNWLYINNWKLIGDGMCLNLETKAIGYINELMVEYKN |
Ga0315903_101652843 | 3300032116 | Freshwater | MTTTEEILGFTNWLYINNWKLIGDGMCLNLETKAIGYVNELMVEYNK |
Ga0334991_0228821_2_124 | 3300034013 | Freshwater | LGFTNWLYTNNWKLIGDGMCLNLETKAIGRIDELMVEYKN |
Ga0335031_0820052_1_108 | 3300034104 | Freshwater | WLYANNWKLIGDGMCLNLETKSIGYINELMVEYNK |
⦗Top⦘ |