| Basic Information | |
|---|---|
| Family ID | F081315 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MDPLGTLIVSLGTLILLDLAALQLGGVRRPRTRTRATRSR |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 71.93 % |
| % of genes near scaffold ends (potentially truncated) | 22.81 % |
| % of genes from short scaffolds (< 2000 bps) | 84.21 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.053 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.105 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.29% β-sheet: 0.00% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF04075 | F420H2_quin_red | 32.46 |
| PF06267 | DUF1028 | 5.26 |
| PF01152 | Bac_globin | 4.39 |
| PF00478 | IMPDH | 3.51 |
| PF03699 | UPF0182 | 1.75 |
| PF02540 | NAD_synthase | 0.88 |
| PF01479 | S4 | 0.88 |
| PF00117 | GATase | 0.88 |
| PF14748 | P5CR_dimer | 0.88 |
| PF00293 | NUDIX | 0.88 |
| PF06153 | CdAMP_rec | 0.88 |
| PF07676 | PD40 | 0.88 |
| PF04879 | Molybdop_Fe4S4 | 0.88 |
| PF13011 | LZ_Tnp_IS481 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG3342 | Uncharacterized conserved protein, Ntn-hydrolase superfamily | General function prediction only [R] | 5.26 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 4.39 |
| COG1615 | Uncharacterized membrane protein, UPF0182 family | Function unknown [S] | 1.75 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.33 % |
| Unclassified | root | N/A | 16.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02HBIW7 | Not Available | 501 | Open in IMG/M |
| 3300003324|soilH2_10025004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1399 | Open in IMG/M |
| 3300004114|Ga0062593_101832995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 668 | Open in IMG/M |
| 3300004156|Ga0062589_100543864 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300004463|Ga0063356_101193739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1104 | Open in IMG/M |
| 3300004463|Ga0063356_103921836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 640 | Open in IMG/M |
| 3300004479|Ga0062595_101051991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 706 | Open in IMG/M |
| 3300004480|Ga0062592_101692651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 615 | Open in IMG/M |
| 3300005329|Ga0070683_101771342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 594 | Open in IMG/M |
| 3300005331|Ga0070670_101168184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 703 | Open in IMG/M |
| 3300005332|Ga0066388_104217837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 733 | Open in IMG/M |
| 3300005332|Ga0066388_108734551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 503 | Open in IMG/M |
| 3300005337|Ga0070682_101654868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 555 | Open in IMG/M |
| 3300005337|Ga0070682_101963641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 514 | Open in IMG/M |
| 3300005338|Ga0068868_100329657 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300005344|Ga0070661_100531030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 945 | Open in IMG/M |
| 3300005406|Ga0070703_10012742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2382 | Open in IMG/M |
| 3300005438|Ga0070701_11135117 | Not Available | 552 | Open in IMG/M |
| 3300005439|Ga0070711_101357329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 618 | Open in IMG/M |
| 3300005468|Ga0070707_100090075 | All Organisms → cellular organisms → Bacteria | 2969 | Open in IMG/M |
| 3300005471|Ga0070698_100077349 | All Organisms → cellular organisms → Bacteria | 3327 | Open in IMG/M |
| 3300005471|Ga0070698_101027228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 772 | Open in IMG/M |
| 3300005518|Ga0070699_100017858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6091 | Open in IMG/M |
| 3300005536|Ga0070697_100442264 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300005545|Ga0070695_100618207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 852 | Open in IMG/M |
| 3300005577|Ga0068857_101274170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 713 | Open in IMG/M |
| 3300005614|Ga0068856_101126050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 802 | Open in IMG/M |
| 3300005616|Ga0068852_102065473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 592 | Open in IMG/M |
| 3300005764|Ga0066903_100471073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2111 | Open in IMG/M |
| 3300005764|Ga0066903_105796713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 649 | Open in IMG/M |
| 3300005842|Ga0068858_101110031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 776 | Open in IMG/M |
| 3300005889|Ga0075290_1025777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 740 | Open in IMG/M |
| 3300005937|Ga0081455_10150669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1794 | Open in IMG/M |
| 3300006573|Ga0074055_11501368 | Not Available | 571 | Open in IMG/M |
| 3300006603|Ga0074064_11649724 | Not Available | 600 | Open in IMG/M |
| 3300006755|Ga0079222_12676800 | Not Available | 502 | Open in IMG/M |
| 3300007004|Ga0079218_10906543 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300009090|Ga0099827_10929708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 754 | Open in IMG/M |
| 3300009094|Ga0111539_10835905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1071 | Open in IMG/M |
| 3300009098|Ga0105245_10588451 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300009137|Ga0066709_100537649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1653 | Open in IMG/M |
| 3300009143|Ga0099792_10004921 | All Organisms → cellular organisms → Bacteria | 5317 | Open in IMG/M |
| 3300009162|Ga0075423_10621130 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300009174|Ga0105241_11340708 | Not Available | 683 | Open in IMG/M |
| 3300009176|Ga0105242_10203739 | Not Available | 1759 | Open in IMG/M |
| 3300009177|Ga0105248_11266172 | Not Available | 834 | Open in IMG/M |
| 3300009789|Ga0126307_10143132 | Not Available | 1912 | Open in IMG/M |
| 3300010044|Ga0126310_10630369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 803 | Open in IMG/M |
| 3300010362|Ga0126377_10320250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1536 | Open in IMG/M |
| 3300010397|Ga0134124_11426085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 719 | Open in IMG/M |
| 3300010400|Ga0134122_13346796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 504 | Open in IMG/M |
| 3300011119|Ga0105246_10916304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 787 | Open in IMG/M |
| 3300011444|Ga0137463_1106477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1055 | Open in IMG/M |
| 3300012200|Ga0137382_11227587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 532 | Open in IMG/M |
| 3300012668|Ga0157216_10036713 | All Organisms → cellular organisms → Bacteria | 2487 | Open in IMG/M |
| 3300012896|Ga0157303_10149246 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012912|Ga0157306_10038586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1138 | Open in IMG/M |
| 3300012914|Ga0157297_10079725 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300012955|Ga0164298_10168503 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300012957|Ga0164303_10731851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 671 | Open in IMG/M |
| 3300012961|Ga0164302_10558498 | Not Available | 821 | Open in IMG/M |
| 3300012984|Ga0164309_10768972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 772 | Open in IMG/M |
| 3300012985|Ga0164308_11025020 | Not Available | 735 | Open in IMG/M |
| 3300012988|Ga0164306_11862810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 523 | Open in IMG/M |
| 3300012989|Ga0164305_11228613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 651 | Open in IMG/M |
| 3300013297|Ga0157378_11082890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 838 | Open in IMG/M |
| 3300014311|Ga0075322_1170416 | Not Available | 544 | Open in IMG/M |
| 3300014325|Ga0163163_11949029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 647 | Open in IMG/M |
| 3300014829|Ga0120104_1114630 | Not Available | 546 | Open in IMG/M |
| 3300015162|Ga0167653_1003449 | All Organisms → cellular organisms → Bacteria | 3558 | Open in IMG/M |
| 3300015203|Ga0167650_1061190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 924 | Open in IMG/M |
| 3300015371|Ga0132258_10860041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2289 | Open in IMG/M |
| 3300015372|Ga0132256_100530645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1289 | Open in IMG/M |
| 3300017792|Ga0163161_11610102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 573 | Open in IMG/M |
| 3300017792|Ga0163161_11650817 | Not Available | 566 | Open in IMG/M |
| 3300017965|Ga0190266_11087861 | Not Available | 544 | Open in IMG/M |
| 3300017997|Ga0184610_1007938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2586 | Open in IMG/M |
| 3300018000|Ga0184604_10010672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1934 | Open in IMG/M |
| 3300018071|Ga0184618_10074815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1284 | Open in IMG/M |
| 3300018433|Ga0066667_11817546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 552 | Open in IMG/M |
| 3300019888|Ga0193751_1020193 | All Organisms → cellular organisms → Bacteria | 3298 | Open in IMG/M |
| 3300021073|Ga0210378_10001506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 12193 | Open in IMG/M |
| 3300021073|Ga0210378_10252900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 667 | Open in IMG/M |
| 3300021080|Ga0210382_10333982 | Not Available | 668 | Open in IMG/M |
| 3300021090|Ga0210377_10096799 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300021344|Ga0193719_10043591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1944 | Open in IMG/M |
| 3300021363|Ga0193699_10072879 | Not Available | 1358 | Open in IMG/M |
| 3300024181|Ga0247693_1051895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 595 | Open in IMG/M |
| 3300025910|Ga0207684_11301779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 598 | Open in IMG/M |
| 3300025911|Ga0207654_10731301 | Not Available | 712 | Open in IMG/M |
| 3300025922|Ga0207646_10011423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 8606 | Open in IMG/M |
| 3300025937|Ga0207669_11810057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 522 | Open in IMG/M |
| 3300025941|Ga0207711_11246223 | Not Available | 685 | Open in IMG/M |
| 3300026023|Ga0207677_10299753 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300026041|Ga0207639_12113019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 524 | Open in IMG/M |
| 3300026109|Ga0208774_1045742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 669 | Open in IMG/M |
| 3300026116|Ga0207674_11263987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 708 | Open in IMG/M |
| 3300026142|Ga0207698_11870885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 615 | Open in IMG/M |
| 3300026320|Ga0209131_1040124 | All Organisms → cellular organisms → Bacteria | 2694 | Open in IMG/M |
| 3300028589|Ga0247818_10833364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 645 | Open in IMG/M |
| 3300028722|Ga0307319_10007836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3244 | Open in IMG/M |
| 3300028784|Ga0307282_10315229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 754 | Open in IMG/M |
| 3300028793|Ga0307299_10029618 | All Organisms → cellular organisms → Bacteria | 1986 | Open in IMG/M |
| 3300028799|Ga0307284_10094489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1111 | Open in IMG/M |
| 3300028824|Ga0307310_10002034 | All Organisms → cellular organisms → Bacteria | 7597 | Open in IMG/M |
| 3300028828|Ga0307312_10187465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1325 | Open in IMG/M |
| 3300028878|Ga0307278_10026887 | All Organisms → cellular organisms → Bacteria | 2642 | Open in IMG/M |
| 3300028880|Ga0307300_10037327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1343 | Open in IMG/M |
| 3300028889|Ga0247827_10660064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 677 | Open in IMG/M |
| 3300030006|Ga0299907_10738061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 749 | Open in IMG/M |
| 3300031716|Ga0310813_10818030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 840 | Open in IMG/M |
| 3300032002|Ga0307416_100377614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1446 | Open in IMG/M |
| 3300032126|Ga0307415_100202424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1577 | Open in IMG/M |
| 3300033811|Ga0364924_000432 | All Organisms → cellular organisms → Bacteria | 6401 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.26% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.51% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.63% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.63% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.75% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.75% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.75% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.75% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.88% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.88% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.88% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.88% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.88% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.88% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026109 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_12070010 | 2170459005 | Grass Soil | MDPLGTLILSLGTLIVLDLAALKLGGIRRPRSRTRATRSR |
| soilH2_100250042 | 3300003324 | Sugarcane Root And Bulk Soil | MDPLGTLIVSLGTLIVLDLAALQLGGPRRQRTRTRAARTR* |
| Ga0062593_1018329951 | 3300004114 | Soil | MDPLGTLIVTLGTLLILDIAALQLGGARRPRNRARGPRR* |
| Ga0062589_1005438643 | 3300004156 | Soil | MDPLGTLIVTLGTLVILDIAALQLGGYRRPRSRARGSRR* |
| Ga0063356_1011937392 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDPLGTLIISLGALIVLDLAALRMGRSARPRPRVRTARPR* |
| Ga0063356_1039218362 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDPLATLIVSLGTLLVLDLAALQLGGVRRPKNRARATRSR* |
| Ga0062595_1010519912 | 3300004479 | Soil | MDPLGTLIVTLGTLLILDIAALQLGKASRPRDRVRGSRR* |
| Ga0062592_1016926512 | 3300004480 | Soil | ASARIGHMDPLGTLIVTLGTLVILDIAALQLGGYRRPRSRARGSRR* |
| Ga0070683_1017713421 | 3300005329 | Corn Rhizosphere | MDPLGTLIVTLGTLVILDIAALQLGKVRRPRDRARGSRR* |
| Ga0070670_1011681842 | 3300005331 | Switchgrass Rhizosphere | MDPLGTLIVSLGTLIVLDLAALQLGAPRRSRTRTRATRSR* |
| Ga0066388_1042178372 | 3300005332 | Tropical Forest Soil | MDPLGTLIVSLGTLIVLDLVALQLGGPRRPRTRTRATRSR* |
| Ga0066388_1087345511 | 3300005332 | Tropical Forest Soil | MDPLTTLIVSLGALIVLDLAALQLGGPRRPRTRSRVVRPR* |
| Ga0070682_1016548681 | 3300005337 | Corn Rhizosphere | MDPLGTLIVTLGTLVILDIAALQLGKTRRPRDRARGSRR* |
| Ga0070682_1019636412 | 3300005337 | Corn Rhizosphere | MDPLGTLIVSLGTLIVLDLAARQLGAPQRPRSRSKATRSR* |
| Ga0068868_1003296572 | 3300005338 | Miscanthus Rhizosphere | MDPLGTLIVSLGALIVIDLAAHQLGGPRRPRPRPRVTRSR* |
| Ga0070661_1005310301 | 3300005344 | Corn Rhizosphere | MDPLGTLIVTLGTLVILDIAALQLGKSSRPRPRVKGSRR* |
| Ga0070703_100127423 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPLGTLIVSLGALIVLDLAALQLGGIRRPRSRTRATRSR* |
| Ga0070701_111351171 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | RHREDRNMDPLGTLIVTLGTLVILDIAALQLGKVRRPRDRARGSRR* |
| Ga0070711_1013573292 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | PMDPLGTLIVSLGTLIVLDLAARQLGGGRRSRTRSRATRSR* |
| Ga0070707_1000900751 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ATKGWTEMDPLGTLLVSLGTLIVLDLAARQLGGPRRSRTRTRATRSR* |
| Ga0070698_1000773494 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPLGTLIVTLGTLLILDLAALSLGGSRKSRSRARTARSR* |
| Ga0070698_1010272282 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPLGTLVVSLGTLIVLNLAALQLGGIRRPRTRSRATRPR* |
| Ga0070699_1000178583 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPLGTLIVTLGTLLILDLAALSLGGSRKSRTKARTARSR* |
| Ga0070697_1004422642 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPIATLIVSLGTLIVLDLAALQLGGVRRPRTRTRATRPR* |
| Ga0070695_1006182071 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MATKGWTEMDPLGTLIVSLGTLIVLDLAALQLGGPRRPRTRTRAARSR* |
| Ga0068857_1012741702 | 3300005577 | Corn Rhizosphere | LPMATKGWTEMDPLGTLIVSLGTLIVLDLAALQLGGTRRSRTRARAARSR* |
| Ga0068856_1011260502 | 3300005614 | Corn Rhizosphere | MDPLGTLIVSLGALIVIDLAAHQPAGHDGLVPSRVIRSR* |
| Ga0068852_1020654732 | 3300005616 | Corn Rhizosphere | VVAGTKRHREDRNMDPLGTLIVTLGTLVILDIAALQLGGYRRPRSRARGSRR* |
| Ga0066903_1004710731 | 3300005764 | Tropical Forest Soil | MDPLGTLIVSLGTLIVLDLAALQLGGGRRSRNRSRATRSR* |
| Ga0066903_1057967131 | 3300005764 | Tropical Forest Soil | MDPLGTLIVTLGTLVILDLAALQLGRTSRPRSRARGSRR* |
| Ga0068858_1011100311 | 3300005842 | Switchgrass Rhizosphere | VVAGTKRHREDRNMDPLGTLIVTLGTLVILDIAALQLGKARRPRDRARGSRR* |
| Ga0075290_10257771 | 3300005889 | Rice Paddy Soil | MDPLGTLIVSLGTLIVLDLAALQLGGPRRTRTRPRPSRSR* |
| Ga0081455_101506692 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MDPLGTLIVTLGTLVILDFAALKLGERKQPRGRARSTRRAPPTSAIRT* |
| Ga0074055_115013682 | 3300006573 | Soil | MDPLGTLIVTLGTLVILDIAALQLGKARRPRTRARGSRR* |
| Ga0074064_116497242 | 3300006603 | Soil | ARDGPMDPLGTLIVSLGALIVIDLAAHQLGGPRRPRPRSRAIRSR* |
| Ga0079222_126768001 | 3300006755 | Agricultural Soil | MVRSRHLPMATKGWTEMDPLGTLIVSLGTLILLDLAALQLGGSRRSRTRSKATRTR* |
| Ga0079218_109065433 | 3300007004 | Agricultural Soil | MDPLGTLIVTLGTLLILDLAALQLGGYRRPRARARGRR* |
| Ga0099827_109297082 | 3300009090 | Vadose Zone Soil | KYRMDPLGTLIVSLGALLVLDLAALQLGGSKRRRRTRPRYR* |
| Ga0111539_108359052 | 3300009094 | Populus Rhizosphere | MDPLGTLIVTLGTLVVLDLAALQLGGYRRPRARARGRR* |
| Ga0105245_105884511 | 3300009098 | Miscanthus Rhizosphere | RDGPMDPLGTLIVSLGTLIVLDLAARQLGAPQRPRSRSKATRSR* |
| Ga0066709_1005376491 | 3300009137 | Grasslands Soil | MDPLGTLLVSLGTLIVLDLAALQLGAPRRSRTRIRAIRSR* |
| Ga0099792_100049215 | 3300009143 | Vadose Zone Soil | MDPLGTLIVTLGALLVLDLAALQLGGSRRRRQTRPRYR* |
| Ga0075423_106211303 | 3300009162 | Populus Rhizosphere | MDPLGTLIVTLGTLLILDIAALQLGKASRPRDRVR |
| Ga0105241_113407082 | 3300009174 | Corn Rhizosphere | DPLGTLIVSLGTLIVLDLAALQLGGPRRPRTRTRAARSR* |
| Ga0105242_102037392 | 3300009176 | Miscanthus Rhizosphere | VVAGTKRHREDRNMDPLGTLIVTLGTLVILDIAALQLGKVRRPRDRARGSRR* |
| Ga0105248_112661721 | 3300009177 | Switchgrass Rhizosphere | ASGGIVVAGTKRHREDRNMDPLGTLIVTLGTLVILDIAALQLGKVRRPRDRARGSRR* |
| Ga0126307_101431321 | 3300009789 | Serpentine Soil | MDPLGTLIVSLGALIVLDLAARQLGAPRRSRTRIRATRSR* |
| Ga0126310_106303692 | 3300010044 | Serpentine Soil | MDPLATLIVSLGTLIVLDLAAIQLGGSRRSRNRIRPARSR* |
| Ga0126377_103202502 | 3300010362 | Tropical Forest Soil | MDPLGTLIVTLGTLVILDLAALQLGGTRRPRSRSRGRRSA* |
| Ga0134124_114260852 | 3300010397 | Terrestrial Soil | MATKGWTEMDPLGTLLVSLGTLIVLDLAALQLGGPRRSRTRTRATRSR* |
| Ga0134122_133467962 | 3300010400 | Terrestrial Soil | MDLKDGPMDPLGTLIVSLGALIVLDLAALQLGGPRRRTRSRVTRSR* |
| Ga0105246_109163042 | 3300011119 | Miscanthus Rhizosphere | MDPLGTLIVSLGTLIVLDLAARQLGAPRRPRTRTRATRSR* |
| Ga0137463_11064772 | 3300011444 | Soil | MATKGWTEMDPLGTLIVSLGTLIVLDLAALQLGGSRRSRTRTRATRSR* |
| Ga0137382_112275872 | 3300012200 | Vadose Zone Soil | MDPLGTLIVSLGALIVLNLAALQLGGIRRPRSRTRATRSR* |
| Ga0157216_100367131 | 3300012668 | Glacier Forefield Soil | MATKGWTEMDPLGTLIVSLGTLIVLDLAALQLGGPRRSRTRTRATRSR* |
| Ga0157303_101492461 | 3300012896 | Soil | NMDPLGTLIVTLGTLLILDIAALQLGKASRPRDRVRGSRR* |
| Ga0157306_100385863 | 3300012912 | Soil | MDPLGTLIVTLGTLLILDIAALQLGGGRRPRNRVRGPRR* |
| Ga0157297_100797253 | 3300012914 | Soil | MDPLGTLIVTLGTLVILDIAALQLGKASRPRDRVRGSRR* |
| Ga0164298_101685031 | 3300012955 | Soil | LIVSLGALIVIDLAAHQLGGPRRPRPRPRVTRSR* |
| Ga0164303_107318512 | 3300012957 | Soil | MDPLGTLIVTLGTLVILDIAALQLGKARRPRDRARGSRR* |
| Ga0164302_105584981 | 3300012961 | Soil | AEIARDGSMDPLGTLIVSLGALIVIDLAAHQLGGSRRPRPRPRVTRSR* |
| Ga0164309_107689722 | 3300012984 | Soil | MDPLGTLIVTLGTLLILDIAALQLGKARRPRDRARGSRR* |
| Ga0164308_110250201 | 3300012985 | Soil | MDPLGTLLVSLGALIVIDLAAHQLGGPRRPRPRSRVIRSR* |
| Ga0164306_118628102 | 3300012988 | Soil | MDPLGTLIVSLGTLILLDLAALQLGGIRRPRNRTRATRSR* |
| Ga0164305_112286131 | 3300012989 | Soil | MDPLGTLIVSLGTLIVLDLAARQLGAPQRPRSRSKATLT |
| Ga0157378_110828902 | 3300013297 | Miscanthus Rhizosphere | MDPLGTLIVTLGTLVILDIDAHQLGKIRRPRARARGSRR* |
| Ga0075322_11704161 | 3300014311 | Natural And Restored Wetlands | MDPLGTLIVSLGTLIVLDLAALQLGGSRRTRARTRPSRSR* |
| Ga0163163_119490292 | 3300014325 | Switchgrass Rhizosphere | MDPLGTLIVTLGTLVILDIAALQLGKVRRPRDRATGSRR* |
| Ga0120104_11146302 | 3300014829 | Permafrost | LGTLIVSLGTLILLDLAALQLGGIRRPRNRIRATRSR* |
| Ga0167653_10034492 | 3300015162 | Glacier Forefield Soil | MDPLGTLIVSLGTLILLDLAALQLGGVRRPRTRTRATRSR* |
| Ga0167650_10611902 | 3300015203 | Glacier Forefield Soil | MDPLGTLILSLGTLIVLDLAALQLGGPRRQRSRIRAHRPR* |
| Ga0132258_108600413 | 3300015371 | Arabidopsis Rhizosphere | MDPLGTLIVTLGTLVILDIAALQLGKTRRPRNRARGSRR* |
| Ga0132256_1005306453 | 3300015372 | Arabidopsis Rhizosphere | MDPLGTLIVTLGTLVILDIAALQLGKARRPRDRARSSRR* |
| Ga0163161_116101021 | 3300017792 | Switchgrass Rhizosphere | MDPLGTLIVTLGTLLIMDLAALQLGRVQKPRTRARG |
| Ga0163161_116508171 | 3300017792 | Switchgrass Rhizosphere | MDPLGTLIVTLGTLVILDIAALQLGKVRRPRDRARGSRR |
| Ga0190266_110878611 | 3300017965 | Soil | MDPLGTLIVTLGTLVVLDLAALQLGGYRRPRARARGRR |
| Ga0184610_10079382 | 3300017997 | Groundwater Sediment | MDPLGTLIIALGTLIVIDLAALRLGRSARPRPRVRTARPR |
| Ga0184604_100106722 | 3300018000 | Groundwater Sediment | MDPLGTLIVSLGALLILDLAALQLGGPKRRRRARPRYR |
| Ga0184618_100748151 | 3300018071 | Groundwater Sediment | MDPLGTLIVSLGALIVLNLAAHQLGGIRRPRSRTRATRSR |
| Ga0066667_118175461 | 3300018433 | Grasslands Soil | MDPLGTLLVSLGTLIVLDLAALQLGAPRRSRTRIRAIRSR |
| Ga0193751_10201933 | 3300019888 | Soil | MDPLGTLIVSLGTLILLDLAALQLGGIRRPRNRTRATRSR |
| Ga0210378_100015063 | 3300021073 | Groundwater Sediment | MDPLGTLIIALGALIVIDVAALRLGRSARPRPRVRTARPR |
| Ga0210378_102529001 | 3300021073 | Groundwater Sediment | MDPLATLIVSLGTLLVLDLAALQLGGVRRPKNRVRATRSR |
| Ga0210382_103339822 | 3300021080 | Groundwater Sediment | MDPFGTLIVSVGALIVLNLAAHQLGGIRRPRSRTRATRSR |
| Ga0210377_100967993 | 3300021090 | Groundwater Sediment | MATKGWTEMDPLGTLLVSLGTLIVLDLAALQLGGSRRSRTRTRATRSR |
| Ga0193719_100435913 | 3300021344 | Soil | MDPLGTLIVSLGTLLILDLAALSLGGSRKSRNKARTARSR |
| Ga0193699_100728791 | 3300021363 | Soil | MDPLGTLIVSLGALLVIDLAARQLGRPRRRPAPRPRYR |
| Ga0247693_10518952 | 3300024181 | Soil | MATKGWTEMDPLGTLLVSLGTLIVLDLAALQLGGPRRSRTRTRATRSR |
| Ga0207684_113017791 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPLGTLIVSLGTLIVLDLAALKLGAPRRPRTRTRATRSR |
| Ga0207654_107313011 | 3300025911 | Corn Rhizosphere | DPLGTLIVSLGTLIVLDLAALQLGGPRRPRTRTRAARSR |
| Ga0207646_100114236 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPLGTLIVSLGALIVLDLAALQLGGIRRPRSRTRATRSR |
| Ga0207669_118100572 | 3300025937 | Miscanthus Rhizosphere | MDPLGTLIVTLGTLLILDIAALQLGGARRPRNRARGPRR |
| Ga0207711_112462232 | 3300025941 | Switchgrass Rhizosphere | NMDPLGTLIVTLGTLVILDIAALQLGKVRRPRDRARGSRR |
| Ga0207677_102997532 | 3300026023 | Miscanthus Rhizosphere | MDPLGTLIVSLGALIVIDLAAHQLGGPRRPRPRPRVTRSR |
| Ga0207639_121130192 | 3300026041 | Corn Rhizosphere | MDPLGTLIVTLGTLVILDIAALQLGKTRRPRDRARGS |
| Ga0208774_10457423 | 3300026109 | Rice Paddy Soil | TEMDPLGTLIVSLGTLIVLDLAALQLGGPRRTRTRPRPSRSRDAAARRLP |
| Ga0207674_112639871 | 3300026116 | Corn Rhizosphere | MATKGWTEMDPLGTLIVSLGTLIVLDLAALQLGAPRRSRTRTRAIRAR |
| Ga0207698_118708852 | 3300026142 | Corn Rhizosphere | MDPLGTLIVTLGTLVILDIAALQLGKARRPRDRARGSRR |
| Ga0209131_10401244 | 3300026320 | Grasslands Soil | MDPLGTLIVTLGALLVLDLAALQLGGSRRRRQTRPRYR |
| Ga0247818_108333641 | 3300028589 | Soil | MATKGWTEMDPLGTLIVSLGTLIVLDLAALQLGGTRRSRTRTRAARSR |
| Ga0307319_100078364 | 3300028722 | Soil | MDPLATLIVSLGTLLVLDLAALQLGGVRRPKNRIRATRSR |
| Ga0307282_103152292 | 3300028784 | Soil | MARILWSRHLPMATKGWTEMDPLGTLLVSLGTLIVLDLAALQLGGPRRSRTRTRATRSR |
| Ga0307299_100296183 | 3300028793 | Soil | MDPLGTLIVSLGALLILDLAALQLGGSKRRRPTRPRYR |
| Ga0307284_100944891 | 3300028799 | Soil | MDPLGTLIVSLGALLVIDLAARQLGRPRRRPAPRP |
| Ga0307310_100020342 | 3300028824 | Soil | MDPFGTLIATLGALLILDLAALQLGGSRQRRPRARGRAR |
| Ga0307312_101874652 | 3300028828 | Soil | MATKGWTEMDPLGTLLVSLGALIVLDLAALQLGGPRRARTRTRATRSR |
| Ga0307278_100268873 | 3300028878 | Soil | MDPFGTLIVSLGALIVLNLAAHQLGGIRRPRSRTRATRSR |
| Ga0307300_100373273 | 3300028880 | Soil | MDPLGTLIVSLGALLILDLAALQLGGPKRRRRARP |
| Ga0247827_106600642 | 3300028889 | Soil | MDPLGTLIVTLGTLLILDIAALQLGGARRPRSRARGPRR |
| Ga0299907_107380612 | 3300030006 | Soil | MDPLGTLIVSLGTLIVLDFAALRLGVTNRQRPRRSRGR |
| Ga0310813_108180302 | 3300031716 | Soil | MDPLGTLIVTLGTLVILDIAALQLGKTRRPRDRARGSRR |
| Ga0307416_1003776143 | 3300032002 | Rhizosphere | LGTLIVSLGTLIVLDLAALQLGGTRRSRTRTRAARSR |
| Ga0307415_1002024241 | 3300032126 | Rhizosphere | MDPFGTLIVSLGTLLVLDFAALKLGASSRQRPRARASSRQR |
| Ga0364924_000432_139_261 | 3300033811 | Sediment | MDPLGTLIVSLGTLIVIDLAALKLGASRRPRPRVRTPRPR |
| ⦗Top⦘ |