Metagenome / Metatranscriptome Family F081245

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F081245
Family Type	Metagenome / Metatranscriptome
Number of Sequences	114
Average Sequence Length	37 residues
Representative Sequence	MIDFVKQLELENYLADEPIDPLAKMLDELISKGEYK
Number of Associated Samples	89
Number of Associated Scaffolds	114

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	78.95 %
% of genes near scaffold ends (potentially truncated)	4.39 %
% of genes from short scaffolds (< 2000 bps)	69.30 %
Associated GOLD sequencing projects	82
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (44.737 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (12.281 % of family members)
Environment Ontology (ENVO)	Unclassified (44.737 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (52.632 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 37.50% β-sheet: 0.00% Coil/Unstructured: 62.50%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.29
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 114 Family Scaffolds
PF06067	DUF932	5.26
PF13640	2OG-FeII_Oxy_3	1.75
PF04572	Gb3_synth	0.88
PF02511	Thy1	0.88
PF05257	CHAP	0.88
PF02675	AdoMet_dc	0.88
PF13385	Laminin_G_3	0.88
PF02945	Endonuclease_7	0.88
PF01844	HNH	0.88

COG ID	Name	Functional Category	% Frequency in 114 Family Scaffolds
COG1351	Thymidylate synthase ThyX, FAD-dependent family	Nucleotide transport and metabolism [F]	0.88
COG1586	S-adenosylmethionine decarboxylase	Amino acid transport and metabolism [E]	0.88

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	64.04 %
Unclassified	root	N/A	35.96 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	64.04 %
Unclassified	root	N/A	35.96 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	44.74 %
Unclassified	root	N/A	35.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	19.30 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	44.74 %
Unclassified	root	N/A	35.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	19.30 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	44.74 %
Unclassified	root	N/A	35.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	19.30 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	44.74 %
Unclassified	root	N/A	35.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	19.30 %

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	41.23 %
Unclassified	root	N/A	35.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	19.30 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	41.23 %
Unclassified	root	N/A	35.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	19.30 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2199352005\|2200043897	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	547	Open in IMG/M
3300000756\|JGI12421J11937_10160515	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	548	Open in IMG/M
3300001847\|RCM41_1089305	Not Available	644	Open in IMG/M
3300002408\|B570J29032_109259278	Not Available	659	Open in IMG/M
3300002408\|B570J29032_109818633	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1459	Open in IMG/M
3300002835\|B570J40625_100025585	Not Available	9621	Open in IMG/M
3300005517\|Ga0070374_10070448	All Organisms → Viruses → Predicted Viral	1822	Open in IMG/M
3300005527\|Ga0068876_10214183	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1114	Open in IMG/M
3300005528\|Ga0068872_10027435	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3743	Open in IMG/M
3300005580\|Ga0049083_10117296	Not Available	918	Open in IMG/M
3300005581\|Ga0049081_10345529	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	505	Open in IMG/M
3300005583\|Ga0049085_10320051	Not Available	502	Open in IMG/M
3300005662\|Ga0078894_10050603	Not Available	3519	Open in IMG/M
3300005662\|Ga0078894_11442780	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	573	Open in IMG/M
3300005662\|Ga0078894_11615908	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	534	Open in IMG/M
3300005941\|Ga0070743_10003710	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5595	Open in IMG/M
3300005941\|Ga0070743_10239068	Not Available	591	Open in IMG/M
3300006030\|Ga0075470_10017640	All Organisms → Viruses → Predicted Viral	2210	Open in IMG/M
3300006641\|Ga0075471_10661524	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	509	Open in IMG/M
3300006875\|Ga0075473_10102562	All Organisms → Viruses → Predicted Viral	1134	Open in IMG/M
3300007546\|Ga0102874_1269472	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	514	Open in IMG/M
3300007632\|Ga0102894_1092738	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	794	Open in IMG/M
3300007974\|Ga0105747_1223348	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	625	Open in IMG/M
3300007992\|Ga0105748_10159064	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	928	Open in IMG/M
3300008107\|Ga0114340_1000599	Not Available	62989	Open in IMG/M
3300008107\|Ga0114340_1007121	Not Available	8235	Open in IMG/M
3300008107\|Ga0114340_1045365	Not Available	1948	Open in IMG/M
3300008107\|Ga0114340_1201472	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	667	Open in IMG/M
3300008108\|Ga0114341_10302630	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	830	Open in IMG/M
3300008108\|Ga0114341_10389370	Not Available	681	Open in IMG/M
3300008110\|Ga0114343_1062623	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1393	Open in IMG/M
3300008114\|Ga0114347_1007139	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5940	Open in IMG/M
3300008116\|Ga0114350_1007262	Not Available	5756	Open in IMG/M
3300008116\|Ga0114350_1140878	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	690	Open in IMG/M
3300008261\|Ga0114336_1083685	All Organisms → Viruses → Predicted Viral	1541	Open in IMG/M
3300008448\|Ga0114876_1012337	Not Available	4787	Open in IMG/M
3300008953\|Ga0104241_1009975	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	651	Open in IMG/M
3300008996\|Ga0102831_1190536	Not Available	678	Open in IMG/M
3300009165\|Ga0105102_10236527	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	926	Open in IMG/M
3300009169\|Ga0105097_10265343	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	947	Open in IMG/M
3300009194\|Ga0114983_1072582	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	781	Open in IMG/M
3300009419\|Ga0114982_1018684	All Organisms → Viruses → Predicted Viral	2327	Open in IMG/M
3300009419\|Ga0114982_1065400	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1135	Open in IMG/M
3300010354\|Ga0129333_10034494	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4779	Open in IMG/M
3300010966\|Ga0137675_1000054	Not Available	10697	Open in IMG/M
3300012017\|Ga0153801_1045126	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	778	Open in IMG/M
3300012665\|Ga0157210_1000595	Not Available	14319	Open in IMG/M
3300013004\|Ga0164293_10348121	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1012	Open in IMG/M
3300017761\|Ga0181356_1121849	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	832	Open in IMG/M
3300020141\|Ga0211732_1383944	All Organisms → Viruses → Predicted Viral	1466	Open in IMG/M
3300020141\|Ga0211732_1567859	Not Available	18827	Open in IMG/M
3300020151\|Ga0211736_10803110	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	829	Open in IMG/M
3300020159\|Ga0211734_10154726	Not Available	511	Open in IMG/M
3300020159\|Ga0211734_10431979	Not Available	654	Open in IMG/M
3300020161\|Ga0211726_10982205	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	700	Open in IMG/M
3300020172\|Ga0211729_11001577	All Organisms → Viruses → Predicted Viral	3704	Open in IMG/M
3300020205\|Ga0211731_11536038	Not Available	937	Open in IMG/M
3300020487\|Ga0208200_105341	All Organisms → Viruses → Predicted Viral	1051	Open in IMG/M
3300020506\|Ga0208091_1016785	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	870	Open in IMG/M
3300020506\|Ga0208091_1016947	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	865	Open in IMG/M
3300020514\|Ga0208202_1041359	Not Available	500	Open in IMG/M
3300020515\|Ga0208234_1019478	Not Available	796	Open in IMG/M
3300020560\|Ga0208852_1079396	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	501	Open in IMG/M
3300020573\|Ga0208485_1013260	All Organisms → Viruses → Predicted Viral	1800	Open in IMG/M
3300021961\|Ga0222714_10000425	Not Available	48763	Open in IMG/M
3300021961\|Ga0222714_10037205	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3529	Open in IMG/M
3300021961\|Ga0222714_10485830	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	636	Open in IMG/M
3300021962\|Ga0222713_10041400	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3603	Open in IMG/M
3300021962\|Ga0222713_10133714	All Organisms → Viruses → Predicted Viral	1733	Open in IMG/M
3300021963\|Ga0222712_10176476	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1419	Open in IMG/M
3300022591\|Ga0236341_1003451	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7430	Open in IMG/M
3300023174\|Ga0214921_10069087	All Organisms → Viruses → Predicted Viral	2898	Open in IMG/M
3300024343\|Ga0244777_10164921	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1428	Open in IMG/M
3300024346\|Ga0244775_10006587	Not Available	11553	Open in IMG/M
3300024346\|Ga0244775_10038686	Not Available	4210	Open in IMG/M
3300024346\|Ga0244775_10074109	All Organisms → Viruses → Predicted Viral	2915	Open in IMG/M
3300024348\|Ga0244776_10298032	All Organisms → Viruses → Predicted Viral	1102	Open in IMG/M
3300024348\|Ga0244776_10659064	Not Available	652	Open in IMG/M
3300024496\|Ga0255151_1060270	Not Available	614	Open in IMG/M
3300025732\|Ga0208784_1003440	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	6064	Open in IMG/M
3300025896\|Ga0208916_10350094	Not Available	644	Open in IMG/M
3300027132\|Ga0255110_1045910	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	696	Open in IMG/M
3300027144\|Ga0255102_1001057	Not Available	7247	Open in IMG/M
3300027365\|Ga0209300_1059875	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	613	Open in IMG/M
3300027418\|Ga0208022_1018456	All Organisms → Viruses → Predicted Viral	1642	Open in IMG/M
3300027621\|Ga0208951_1115938	Not Available	720	Open in IMG/M
3300027710\|Ga0209599_10000753	Not Available	18787	Open in IMG/M
3300027710\|Ga0209599_10060554	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	996	Open in IMG/M
(restricted) 3300027730\|Ga0247833_1115219	All Organisms → Viruses → Predicted Viral	1151	Open in IMG/M
3300027793\|Ga0209972_10316733	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	683	Open in IMG/M
3300027805\|Ga0209229_10146737	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1063	Open in IMG/M
3300027805\|Ga0209229_10406684	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	590	Open in IMG/M
3300027816\|Ga0209990_10299611	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	720	Open in IMG/M
3300028025\|Ga0247723_1031475	All Organisms → Viruses → Predicted Viral	1665	Open in IMG/M
3300028025\|Ga0247723_1048779	All Organisms → Viruses → Predicted Viral	1222	Open in IMG/M
3300028103\|Ga0255172_1021720	Not Available	1229	Open in IMG/M
3300028178\|Ga0265593_1104223	Not Available	755	Open in IMG/M
3300031758\|Ga0315907_10013119	Not Available	8043	Open in IMG/M
3300031758\|Ga0315907_10058108	All Organisms → Viruses → Predicted Viral	3380	Open in IMG/M
3300031758\|Ga0315907_10118272	All Organisms → Viruses → Predicted Viral	2263	Open in IMG/M
3300031857\|Ga0315909_10044143	Not Available	4188	Open in IMG/M
3300031963\|Ga0315901_10811728	Not Available	677	Open in IMG/M
3300032092\|Ga0315905_10264818	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1663	Open in IMG/M
3300033816\|Ga0334980_0000095	Not Available	41955	Open in IMG/M
3300033816\|Ga0334980_0421626	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	503	Open in IMG/M
3300033992\|Ga0334992_0069495	All Organisms → Viruses → Predicted Viral	1945	Open in IMG/M
3300033993\|Ga0334994_0023694	All Organisms → Viruses → Predicted Viral	4048	Open in IMG/M
3300033994\|Ga0334996_0132545	Not Available	1409	Open in IMG/M
3300033996\|Ga0334979_0582130	Not Available	596	Open in IMG/M
3300034022\|Ga0335005_0016113	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5288	Open in IMG/M
3300034061\|Ga0334987_0678105	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	594	Open in IMG/M
3300034063\|Ga0335000_0608240	Not Available	613	Open in IMG/M
3300034092\|Ga0335010_0082967	All Organisms → Viruses → Predicted Viral	2183	Open in IMG/M
3300034116\|Ga0335068_0139536	Not Available	1321	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	92.98%
Terrestrial	Environmental → Terrestrial	7.02%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	69.30%
Marine	Environmental → Aquatic → Marine	22.81%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	7.02%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	0.88%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	32.46%
Lentic	Environmental → Aquatic → Freshwater → Lentic	23.68%
Unclassified	Environmental → Aquatic → Marine → Unclassified	9.65%
Coastal	Environmental → Aquatic → Marine → Coastal	7.02%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	7.02%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	6.14%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	5.26%
River	Environmental → Aquatic → Freshwater → River	3.51%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.75%
Lotic	Environmental → Aquatic → Freshwater → Lotic	1.75%
Pond	Environmental → Aquatic → Freshwater → Pond	0.88%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline	0.88%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	32.46%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	15.79%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	9.65%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	7.02%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	7.02%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	7.02%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	6.14%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	5.26%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	3.51%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.75%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	1.75%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.88%
Unclassified	Environmental → Aquatic → Freshwater → Pond → Unclassified	0.88%
Unclassified	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified	0.88%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	12.28%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	9.65%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	9.65%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	7.89%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	7.02%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	6.14%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	5.26%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	5.26%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	5.26%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	4.39%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	4.39%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	3.51%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	3.51%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	2.63%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.75%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	1.75%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	1.75%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	1.75%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	0.88%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.88%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	0.88%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.88%
Pond Fresh Water	Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water	0.88%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	0.88%
Saline Water	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water	0.88%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2199352005	Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion	Environmental	Open in IMG/M
3300000756	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011	Environmental	Open in IMG/M
3300001847	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005528	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005583	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005941	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697	Environmental	Open in IMG/M
3300006030	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA	Environmental	Open in IMG/M
3300006641	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA	Environmental	Open in IMG/M
3300006875	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA	Environmental	Open in IMG/M
3300007546	Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02	Environmental	Open in IMG/M
3300007632	Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3	Environmental	Open in IMG/M
3300007974	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um	Environmental	Open in IMG/M
3300007992	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um	Environmental	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008108	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008114	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA	Environmental	Open in IMG/M
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental	Open in IMG/M
3300008261	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300008953	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4	Environmental	Open in IMG/M
3300008996	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747	Environmental	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009169	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009194	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT	Environmental	Open in IMG/M
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010966	Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016	Environmental	Open in IMG/M
3300012017	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m	Environmental	Open in IMG/M
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020487	Freshwater microbial communities from Lake Mendota, WI - 13AUG2008 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020506	Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020514	Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020515	Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020560	Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes)	Environmental	Open in IMG/M
3300020573	Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022591	Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300024343	Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024348	0.2um to 3um size fraction coassembly	Environmental	Open in IMG/M
3300024496	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h	Environmental	Open in IMG/M
3300025732	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025896	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300027132	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h	Environmental	Open in IMG/M
3300027144	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h	Environmental	Open in IMG/M
3300027365	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes)	Environmental	Open in IMG/M
3300027418	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)	Environmental	Open in IMG/M
3300027621	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027730 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m	Environmental	Open in IMG/M
3300027793	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300027816	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028103	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d	Environmental	Open in IMG/M
3300028178	Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031963	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300033816	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005	Environmental	Open in IMG/M
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental	Open in IMG/M
3300033993	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037	Environmental	Open in IMG/M
3300033994	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034022	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058	Environmental	Open in IMG/M
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental	Open in IMG/M
3300034063	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053	Environmental	Open in IMG/M
3300034092	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069	Environmental	Open in IMG/M
3300034116	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
2200260854	2199352005	Freshwater	MIDFVKQLELENYLSDEEIDPLAKRLDELILKGEYK
JGI12421J11937_101605151	3300000756	Freshwater And Sediment	MIDFVKQLELDNYLSTDEVDPLAKRLDELIKKGEYK*
RCM41_10893053	3300001847	Marine Plankton	MRDFVEKLELENYWSDEKKDPLIEKLDLLISKGEYKNV*
B570J29032_1092592781	3300002408	Freshwater	IDFVKQLELENYLSDEEIDPLAKRLDELISKGEYK**
B570J29032_1098186332	3300002408	Freshwater	MRDFVKNLELENYLADEQIDPLAKMLDELISKGEYK*
B570J40625_10002558513	3300002835	Freshwater	LGALISMDKIQKLELENYLADEQIDPLAKMLDEIIKKGSYTK*
Ga0070374_100704484	3300005517	Freshwater Lake	MIDYVKQIELNNYLADEQIDPLAQMLDELIKKGGYTK*
Ga0068876_102141833	3300005527	Freshwater Lake	MKDFVKNQELENYWSDSEIDPLAKKLDEIIKKGVYSK*
Ga0068872_100274358	3300005528	Freshwater Lake	MRDFVKNQELENYWSDSEIDPLAKKLDEIIKKGVYSK*
Ga0049083_101172963	3300005580	Freshwater Lentic	MINFVKNLELTNYLADEQIDPLAKMLDELILKGEYKYLQ
Ga0049081_103455292	3300005581	Freshwater Lentic	MIDFVKQLELENYLSDEEIDPLAKRLDELILKGEYK*
Ga0049085_103200513	3300005583	Freshwater Lentic	MINFVKDLELTNYLADEQIDPLAKMLDELILKGEYK*
Ga0078894_100506037	3300005662	Freshwater Lake	MDKVTKLELENYLADEQIDPLAKRLDELIKKGSYTK*
Ga0078894_114427802	3300005662	Freshwater Lake	MGYVKSLELEYYLADEPVDELAKTLDELISKGEYK*
Ga0078894_116159082	3300005662	Freshwater Lake	MIDFVKQLELNNYLDENQDELAIKLDELISKGEYK*
Ga0070743_1000371014	3300005941	Estuarine	MIDFVKNSELKNYLDEPQDELVLKLDELISKGEYK*
Ga0070743_102390681	3300005941	Estuarine	MIDFVKQLELENYLADEPIDPLAKMLDELILKGEYK*
Ga0075470_100176402	3300006030	Aqueous	MIDYVKQLELENYLADEPIDPLAKMLDELISKGEYK*
Ga0075471_106615242	3300006641	Aqueous	MIDFVKQLELENYLADEPIDPLAKMLDELISKGEYK*
Ga0075473_101025622	3300006875	Aqueous	VDKLEGIKMIDFVKQLELENYLADEPIDPLAKMLDELISKGEYK*
Ga0102874_12694722	3300007546	Estuarine	MGYVKSLELEYYLADEPKDELAIMLDELISKGEYK*
Ga0102894_10927381	3300007632	Estuarine	MIDFVKNLELENYLADEPIDPLAKMLDELISKGEYK*
Ga0105747_12233482	3300007974	Estuary Water	MIDFVKQLELDNYLSTDEVDPLAKRLDELIKKGKYTK*
Ga0105748_101590642	3300007992	Estuary Water	MIDFVKQLEINNYLSDEEIDPLTKKLDELILKGEYK*
Ga0114340_100059985	3300008107	Freshwater, Plankton	MIDFVKQLELNNYLADEQIDPLAKMLDELIKKGEYK*
Ga0114340_10071219	3300008107	Freshwater, Plankton	MIDFVKQLELENYLADEQVDPLAKMLDELIKKGEYK*
Ga0114340_10453658	3300008107	Freshwater, Plankton	VDKLEGIKMIDFVKQLELNNYLDENQDELAIKLDELISKGEYK*
Ga0114340_12014722	3300008107	Freshwater, Plankton	MDKIQKLELENYLADEQIDPLAKMLDEIIKKGSYIK*
Ga0114341_103026302	3300008108	Freshwater, Plankton	MDKVTKLELENYLADEQIDPLAKMLDEIIKKGSYTK*
Ga0114341_103893701	3300008108	Freshwater, Plankton	MKNYVEKLELDNYLADEQVDPLATMLDALIQKGEYK*
Ga0114343_10626234	3300008110	Freshwater, Plankton	MDKIQKLELENYLADEQIDPLAKMLDEIIKKGSYTK*
Ga0114347_10071397	3300008114	Freshwater, Plankton	MIDYVKQLELKNYLSDEEIDPLAKRLDELISKGEYK*
Ga0114350_100726217	3300008116	Freshwater, Plankton	MRNYVKQLELENYLSDEEIDPLAKRLDELILKGEYK*
Ga0114350_11408782	3300008116	Freshwater, Plankton	MKDFVKNEELENYWSDSEIDPLAKKLDEIIKKGVYSK*
Ga0114336_10836852	3300008261	Freshwater, Plankton	MIDFVKQLELENYLSDEQIDPLAKMLDELISKGEYK*
Ga0114876_10123373	3300008448	Freshwater Lake	MKIYVEKLELDNYLADEQVDPLATMLDALIQKGEYK*
Ga0104241_10099752	3300008953	Freshwater	MKDFVTKLELENYLADEPIDPLAKMLDELISKGEYK*
Ga0102831_11905362	3300008996	Estuarine	MKNFIENLELNNYLADEPIDPLAKMLDELISKGEYK*
Ga0105102_102365271	3300009165	Freshwater Sediment	MIDFVKQLELNNYLADEQVDPLAKMLDELILKGEYK*
Ga0105097_102653431	3300009169	Freshwater Sediment	MVRMESVSMIDYVKQLELNNYLDENQDPLAKMLDELISKGEYK*
Ga0114983_10725822	3300009194	Deep Subsurface	MGYVKSLELEYYLADEPKDELATMLDELISKGEYK*
Ga0114982_10186848	3300009419	Deep Subsurface	MIDFVKQLELNNYLDENQDPLAKMLDELILKGEYK*
Ga0114982_10654004	3300009419	Deep Subsurface	MGYVKSLELEYYLADEPIDELAKTLDELISKGEYK*
Ga0129333_100344942	3300010354	Freshwater To Marine Saline Gradient	MIDFVKQLEVNNYLADEQVDPLAKMLDELISKGEYK*
Ga0137675_10000543	3300010966	Pond Fresh Water	MGYVKSLELEYYLADEPEDSLATMLDELIKKGEYK*
Ga0153801_10451264	3300012017	Freshwater	MIDFVKQLELENYLSDEEIDSLAKRLDELILKGEYK*
Ga0157210_100059523	3300012665	Freshwater	MGYVKSLELEYYLADEPKNELAIMLDELILKGEYK*
Ga0164293_103481213	3300013004	Freshwater	MIDFVKQLELNNYLDESQDELAIKLDSLIKKGEYK*
Ga0181356_11218491	3300017761	Freshwater Lake	MINFVKNLELTNYLADEQIDPLAKMLDELILKGEYKXYLQ
Ga0211732_13839445	3300020141	Freshwater	MIDFVKQLELENYLADEQVDPLAKMLDELIKKGEYK
Ga0211732_156785933	3300020141	Freshwater	MINFVKELEVNNYLADEQVDPLAKMLDELIMKGEYK
Ga0211736_108031103	3300020151	Freshwater	MIDFVKQLEINNYLSDEEIDPLTKKLDELILKGEYK
Ga0211734_101547261	3300020159	Freshwater	RITKMINFVKELEVNNYLADEQVDPLAKMLDELIMKGEYK
Ga0211734_104319791	3300020159	Freshwater	MINFVKELEVNNYLADEQVDPLAKMLDELILKGEYK
Ga0211726_109822052	3300020161	Freshwater	MDKIQKLELENYLADEQIDPLAKMLDEIIKKGSYTKXFYKKKEI
Ga0211729_110015779	3300020172	Freshwater	MIDFVKQLELNNYLADEQIDPLEKMLDELILKGEYK
Ga0211731_115360382	3300020205	Freshwater	MIDFVKQLELSRYLDENKDPLATMLDELISKGKYNND
Ga0208200_1053413	3300020487	Freshwater	MIDYVKQLELENYLSDEEIDPLAKRLDELILKGEYK
Ga0208091_10167852	3300020506	Freshwater	MRDYVKQLELENYLSDEEIDPLAKRLDELILKGEYK
Ga0208091_10169471	3300020506	Freshwater	MIDFVKQLELNNYLADEQIDPLAKMLDELILKGEYK
Ga0208202_10413591	3300020514	Freshwater	MIDYVKQLELKNYLSDEEIDPLAKRLDELILKGEYK
Ga0208234_10194784	3300020515	Freshwater	MNDFVKQLELNNYLADEQIDPLAKMLDELILKGEYK
Ga0208852_10793961	3300020560	Freshwater	MIDFVKQLELENYLSDEEIDPLAKRLDELISKGEYK
Ga0208485_10132602	3300020573	Freshwater	MIDFVKQLELENYLSDEEIDPLAKRLDEIILKGEYK
Ga0222714_1000042547	3300021961	Estuarine Water	MIDFVKQLEVNNYLADEQVDPLAKMLDELISKGEYK
Ga0222714_100372058	3300021961	Estuarine Water	MIDFVKQLEINNYLADEQVDPLAKMLDELISKGEYK
Ga0222714_104858301	3300021961	Estuarine Water	MIDFVKQLELNNYLDENQDELAIKLDELISKGEYK
Ga0222713_100414006	3300021962	Estuarine Water	MGYVKSLELEYYLADEPVDELAKTLDELISKGEYK
Ga0222713_101337141	3300021962	Estuarine Water	MIDFVKQLEVNDYLADEQVDPLAKMLDELISKGEYK
Ga0222712_101764765	3300021963	Estuarine Water	MKDFVTNLELENYLADEQIDPLAKMLDEIIKKGSYTK
Ga0236341_10034515	3300022591	Freshwater	MIDFVKQLEIENYWSDSEIDPLAKKLDELIKKGRYTNDTNTNK
Ga0214921_100690872	3300023174	Freshwater	MINFVKELELNNYLADEQVDPLAKMLDELILKGEYK
Ga0244777_101649214	3300024343	Estuarine	MGYVKSLELEYYLADEPKDELAIMLDELISKGEYK
Ga0244775_1000658735	3300024346	Estuarine	MIDYVKQIELNNYLADEQIDPLAQMLDELIKKGGYTK
Ga0244775_100386863	3300024346	Estuarine	MIDFVKNSELKNYLDEPQDELVLKLDELISKGEYK
Ga0244775_100741099	3300024346	Estuarine	MIDFVKQLELENYLADEPIDPLAKMLDELILKGEYK
Ga0244776_102980323	3300024348	Estuarine	MIDFVKNLELENYLADEPIDPLAKMLDELISKGEYK
Ga0244776_106590641	3300024348	Estuarine	MRDFVKNQELENYWSDSEIDSLAKKLDEIIKKGVYSK
Ga0255151_10602702	3300024496	Freshwater	LERITKMINFVKELELNNYLADEQVDPLAKMLDELIMKGEYK
Ga0208784_10034406	3300025732	Aqueous	MIDYVKQLELENYLADEPIDPLAKMLDELISKGEYK
Ga0208916_103500941	3300025896	Aqueous	MINFVKDLELTNYLADEQIDPLAKMLDELILKGEYK
Ga0255110_10459102	3300027132	Freshwater	MDKVTKLELENYLADEPIDPLAKMLDEIIKKGKYTKXVCF
Ga0255102_100105719	3300027144	Freshwater	MDKVTKLELENYLADEPIDPLAKMLDEIIKKGKYTK
Ga0209300_10598752	3300027365	Deep Subsurface	MGYVKSLELEYYLADEPKDELATMLDELISKGEYK
Ga0208022_10184561	3300027418	Estuarine	MIDFVKQLELENYLADEQVDPLAKMLDELIKKGGYTK
Ga0208951_11159383	3300027621	Freshwater Lentic	MINFVKNLELTNYLADEQIDPLAKMLDELILKGEYK
Ga0209599_1000075335	3300027710	Deep Subsurface	MIDFVKQLELNNYLDENQDPLAKMLDELILKGEYK
Ga0209599_100605541	3300027710	Deep Subsurface	LMGYVKSLELEYYLADEPVDELAKTLDELISKGEYK
(restricted) Ga0247833_11152193	3300027730	Freshwater	MIDFVKQLELENYLADEPIDPLAKMLDELIKKGEYK
Ga0209972_103167332	3300027793	Freshwater Lake	MRDFVKNQELENYWSDSEIDPLAKKLDEIIKKGVYSK
Ga0209229_101467374	3300027805	Freshwater And Sediment	MKDFVEKLELENYLADEPIDPLAKMLDEIIKKGSYTK
Ga0209229_104066842	3300027805	Freshwater And Sediment	MIDFVKQLELNNYLDENQDPLAKMLDELISKGEYK
Ga0209990_102996113	3300027816	Freshwater Lake	MKDFVKNQELENYWSDSEIDPLAKKLDEIIKKGVYSK
Ga0247723_10314756	3300028025	Deep Subsurface Sediment	MGYVKSLELEYYLADEPVDELAKSLDELISKGEYK
Ga0247723_10487791	3300028025	Deep Subsurface Sediment	MGYVKSLELEYYLLDEPVDELAKSLDELILKGEYK
Ga0255172_10217204	3300028103	Freshwater	MINFVKELELNNYLADEQVDPLAKMLDELIMKGEYK
Ga0265593_11042232	3300028178	Saline Water	MKDFVKNLELENYLADSEIDPLAKMLDEIIKKGTYTK
Ga0315907_100131195	3300031758	Freshwater	MRNYVKQLELENYLSDEEIDPLAKRLDELILKGEYK
Ga0315907_1005810812	3300031758	Freshwater	MIDYVKQLELKNYLSDEEIDPLAKRLDELISKGEYK
Ga0315907_101182721	3300031758	Freshwater	MKDFVKNEELENYWSDSEIDPLAKKLDEIIKKGVYSK
Ga0315909_100441438	3300031857	Freshwater	MDKIQKLELENYLADEQIDPLAKMLDEIIKKGSYTK
Ga0315901_108117281	3300031963	Freshwater	MKNYVEKLELDNYLADEQVDPLATMLDALIQKGEYK
Ga0315905_102648185	3300032092	Freshwater	MGYVKSLELEYYLADEPIDPLAKMLDELIKKGEYK
Ga0334980_0000095_41239_41349	3300033816	Freshwater	MRDFVKNLELENYLADEQIDPLAKMLDELISKGEYK
Ga0334980_0421626_150_260	3300033816	Freshwater	MRDYVKQLELENYLSDEKIDPLAKRLDEIILKGEYK
Ga0334992_0069495_1584_1718	3300033992	Freshwater	VDILAGVLMNDFVKQLELNNYLADEQIDPLAKMLDELILKGEYK
Ga0334994_0023694_3726_3833	3300033993	Freshwater	MIDFVKQLELDNYLDESKDELAIKLDSLIKKGEYK
Ga0334996_0132545_1265_1375	3300033994	Freshwater	MINFVKESELNNYLADEQGDSLATMLDELIKKGEYK
Ga0334979_0582130_475_585	3300033996	Freshwater	MIDFVKQLELENYFSDEEIDPLAKRLDELILKGEYK
Ga0335005_0016113_1260_1373	3300034022	Freshwater	MRDFVENLELENYLADEQIDPLAKMLDEAIKKGSYTK
Ga0334987_0678105_370_483	3300034061	Freshwater	MRDFVEKLELENYLADEQIDPLAKMLDELIKKGSYTK
Ga0335000_0608240_444_554	3300034063	Freshwater	MDKIQKLELENYLADEQIDPLAKMLDEAIKKGSYTK
Ga0335010_0082967_1914_2024	3300034092	Freshwater	MIDFVKQLELDNYLSDEEIDPLAKRLDELILKGEYK
Ga0335068_0139536_1049_1159	3300034116	Freshwater	MINFVKELEVNNYLADEQADPLAKMLDELISKGEYK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters