| Basic Information | |
|---|---|
| Family ID | F081182 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MAADVSKHLERAKRFLEKNRVEDAIEAYLAVLDEAPQH |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 90.35 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.47 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.596 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.807 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.070 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.45% β-sheet: 0.00% Coil/Unstructured: 54.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF00009 | GTP_EFTU | 21.93 |
| PF12704 | MacB_PCD | 6.14 |
| PF00591 | Glycos_transf_3 | 4.39 |
| PF13847 | Methyltransf_31 | 3.51 |
| PF07690 | MFS_1 | 3.51 |
| PF03144 | GTP_EFTU_D2 | 3.51 |
| PF06421 | LepA_C | 2.63 |
| PF02885 | Glycos_trans_3N | 2.63 |
| PF00679 | EFG_C | 1.75 |
| PF12867 | DinB_2 | 1.75 |
| PF11340 | DUF3142 | 1.75 |
| PF16864 | Dimerisation2 | 0.88 |
| PF02629 | CoA_binding | 0.88 |
| PF01066 | CDP-OH_P_transf | 0.88 |
| PF06762 | LMF1 | 0.88 |
| PF01135 | PCMT | 0.88 |
| PF13742 | tRNA_anti_2 | 0.88 |
| PF14106 | DUF4279 | 0.88 |
| PF03606 | DcuC | 0.88 |
| PF08308 | PEGA | 0.88 |
| PF04773 | FecR | 0.88 |
| PF02698 | DUF218 | 0.88 |
| PF17189 | Glyco_hydro_30C | 0.88 |
| PF01546 | Peptidase_M20 | 0.88 |
| PF02055 | Glyco_hydro_30 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0481 | Translation elongation factor EF-4, membrane-bound GTPase | Translation, ribosomal structure and biogenesis [J] | 2.63 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.88 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.88 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.88 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.88 |
| COG5520 | O-Glycosyl hydrolase | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.60 % |
| Unclassified | root | N/A | 11.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10456373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300004082|Ga0062384_100279161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300005167|Ga0066672_10231117 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300005178|Ga0066688_10917035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 539 | Open in IMG/M |
| 3300005434|Ga0070709_11380566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300005445|Ga0070708_100280094 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300005531|Ga0070738_10321752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 639 | Open in IMG/M |
| 3300005542|Ga0070732_10212606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1156 | Open in IMG/M |
| 3300005568|Ga0066703_10313189 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300005574|Ga0066694_10218468 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300005586|Ga0066691_10327700 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300005586|Ga0066691_10798389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300006755|Ga0079222_11337626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300006854|Ga0075425_100585688 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300009090|Ga0099827_10539147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 1004 | Open in IMG/M |
| 3300009090|Ga0099827_10724186 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300009137|Ga0066709_100931369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 1268 | Open in IMG/M |
| 3300009518|Ga0116128_1025855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1972 | Open in IMG/M |
| 3300009545|Ga0105237_12002018 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300009549|Ga0116137_1109741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 798 | Open in IMG/M |
| 3300009634|Ga0116124_1038147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1457 | Open in IMG/M |
| 3300010048|Ga0126373_10520371 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300010339|Ga0074046_10634993 | Not Available | 630 | Open in IMG/M |
| 3300010359|Ga0126376_10246689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1516 | Open in IMG/M |
| 3300010361|Ga0126378_13277298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300010376|Ga0126381_100872292 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300010864|Ga0126357_1284935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300011269|Ga0137392_10872540 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300011271|Ga0137393_10523965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 1017 | Open in IMG/M |
| 3300011271|Ga0137393_10816414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
| 3300012096|Ga0137389_10065537 | All Organisms → cellular organisms → Bacteria | 2792 | Open in IMG/M |
| 3300012096|Ga0137389_10885315 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300012096|Ga0137389_11560379 | Not Available | 556 | Open in IMG/M |
| 3300012189|Ga0137388_10043083 | All Organisms → cellular organisms → Bacteria | 3611 | Open in IMG/M |
| 3300012189|Ga0137388_11318351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300012189|Ga0137388_11637085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300012202|Ga0137363_11019386 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300012205|Ga0137362_11036213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300012362|Ga0137361_11645098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300012363|Ga0137390_11629437 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300012582|Ga0137358_10195295 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300012918|Ga0137396_10719065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300012922|Ga0137394_10547094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300012927|Ga0137416_10262073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1417 | Open in IMG/M |
| 3300012989|Ga0164305_11045681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300014151|Ga0181539_1001694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 23776 | Open in IMG/M |
| 3300015052|Ga0137411_1143829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 797 | Open in IMG/M |
| 3300015241|Ga0137418_10166525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1930 | Open in IMG/M |
| 3300016404|Ga0182037_10011637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5119 | Open in IMG/M |
| 3300016422|Ga0182039_11253314 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300017955|Ga0187817_10097112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1851 | Open in IMG/M |
| 3300017966|Ga0187776_10702194 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300017995|Ga0187816_10585423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300017999|Ga0187767_10027070 | Not Available | 1290 | Open in IMG/M |
| 3300018018|Ga0187886_1061865 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300018060|Ga0187765_10298532 | Not Available | 965 | Open in IMG/M |
| 3300018085|Ga0187772_10055649 | All Organisms → cellular organisms → Bacteria | 2444 | Open in IMG/M |
| 3300018085|Ga0187772_10179901 | All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium | 1412 | Open in IMG/M |
| 3300020140|Ga0179590_1181363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300020579|Ga0210407_10520173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300020579|Ga0210407_10902876 | Not Available | 677 | Open in IMG/M |
| 3300020580|Ga0210403_10400034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1121 | Open in IMG/M |
| 3300020582|Ga0210395_10346789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
| 3300021170|Ga0210400_10432685 | Not Available | 1085 | Open in IMG/M |
| 3300021170|Ga0210400_10916164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 715 | Open in IMG/M |
| 3300021403|Ga0210397_10748348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300021433|Ga0210391_11015336 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300021474|Ga0210390_10282760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1405 | Open in IMG/M |
| 3300021478|Ga0210402_10114094 | Not Available | 2437 | Open in IMG/M |
| 3300021559|Ga0210409_10860129 | Not Available | 780 | Open in IMG/M |
| 3300021560|Ga0126371_12617286 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300024186|Ga0247688_1062312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300025916|Ga0207663_10031470 | All Organisms → cellular organisms → Bacteria | 3141 | Open in IMG/M |
| 3300026285|Ga0209438_1160976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300026298|Ga0209236_1120126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1160 | Open in IMG/M |
| 3300026313|Ga0209761_1047978 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
| 3300026446|Ga0257178_1021668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300026490|Ga0257153_1054309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300026547|Ga0209156_10130827 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300026557|Ga0179587_10103899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1723 | Open in IMG/M |
| 3300026847|Ga0207802_1001503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2187 | Open in IMG/M |
| 3300027000|Ga0207803_1022194 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300027063|Ga0207762_1038956 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300027565|Ga0209219_1085679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300027633|Ga0208988_1088367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300027698|Ga0209446_1077556 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300027729|Ga0209248_10015006 | Not Available | 2435 | Open in IMG/M |
| 3300027767|Ga0209655_10287196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300027875|Ga0209283_10354218 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300027882|Ga0209590_10479230 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300027884|Ga0209275_10179049 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300028536|Ga0137415_10881049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300031474|Ga0170818_100310748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300031640|Ga0318555_10050262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium ADurb.Bin325 | 2112 | Open in IMG/M |
| 3300031708|Ga0310686_119757081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300031720|Ga0307469_10790610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300031798|Ga0318523_10331088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300031879|Ga0306919_10106920 | Not Available | 1979 | Open in IMG/M |
| 3300031946|Ga0310910_10254180 | Not Available | 1375 | Open in IMG/M |
| 3300031962|Ga0307479_10110761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2671 | Open in IMG/M |
| 3300032010|Ga0318569_10519824 | Not Available | 554 | Open in IMG/M |
| 3300032160|Ga0311301_12303200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300032180|Ga0307471_101297111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 890 | Open in IMG/M |
| 3300032180|Ga0307471_101467034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
| 3300032180|Ga0307471_102814533 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300032180|Ga0307471_102849465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300032180|Ga0307471_104116612 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300032782|Ga0335082_11415354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300032782|Ga0335082_11584688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300032783|Ga0335079_10352247 | Not Available | 1597 | Open in IMG/M |
| 3300033158|Ga0335077_11977133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300033405|Ga0326727_10494139 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300033412|Ga0310810_10302936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1716 | Open in IMG/M |
| 3300033803|Ga0314862_0112378 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.14% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.39% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.39% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.51% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.88% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.88% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.88% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.88% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027000 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_104563733 | 3300001593 | Forest Soil | MAADISKHLDRAKRFLEKNRVEDAIEAYLAVLDEM |
| Ga0062384_1002791612 | 3300004082 | Bog Forest Soil | MAVDVSKNLERAKKFLEKNKVEDAIEAYLAVLEGAPHHIEASQA |
| Ga0066672_102311172 | 3300005167 | Soil | MAGDVNKHLERAKRFLEKNRVEDAIQAYLAVLEEAPQHQEATQAL |
| Ga0066688_109170352 | 3300005178 | Soil | MAADVNKHLERAKRFLEKNRVEDAIQAYLEVLDEAPQHQEATQAL |
| Ga0070709_113805662 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAADISKHLERAKRFLEKNRVEDAIEAYLAVIEAAPNHQEA |
| Ga0070708_1002800941 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDVNKQLERAKKFLEKNRIEDAIDAYLAVLEEAPAHPEA |
| Ga0070738_103217521 | 3300005531 | Surface Soil | MAADVSKNLERAKKFLEKNRVEDAIEAYLAVLDEAPGHQEATQALG |
| Ga0070732_102126061 | 3300005542 | Surface Soil | MAADVSKHLERAKRFLEKNRAEDAIQAYLAVLDEAPQHQEAT |
| Ga0066703_103131891 | 3300005568 | Soil | MAADVSKNLDRAKRFLEKNRVEDAIEAYLAVLDESP |
| Ga0066694_102184681 | 3300005574 | Soil | MAADVSKHLDRAKRFLEKNRVEDAIVAYLAVLDES |
| Ga0066691_103277001 | 3300005586 | Soil | MAADVSKHLDRAKRFLEKNRVEDAIVAYLAVLDESPQH |
| Ga0066691_107983891 | 3300005586 | Soil | MTPDVTKHLERAKRCLEKNRVEDAIEAYQAVLEAA |
| Ga0079222_113376263 | 3300006755 | Agricultural Soil | MAADVSKQLERAKKFLEKNRVEDAIEAYLAVLDGSPD |
| Ga0075425_1005856882 | 3300006854 | Populus Rhizosphere | MAADVSKQLERAKKFLEKNRVEDAIEAYLGVLELAP |
| Ga0099827_105391472 | 3300009090 | Vadose Zone Soil | MAADVSKHLERAKRFLEKNRVEDAIEAYLAVLDEAPQH |
| Ga0099827_107241861 | 3300009090 | Vadose Zone Soil | MTPDVTKHLERAKRCLEKNRVEDAIEAYQAVLEAAPTHQEAMQAL |
| Ga0066709_1009313692 | 3300009137 | Grasslands Soil | MAADVSKHLERAKRFLEKNRVEDAIQAYLAVLDEAPQHQEAT |
| Ga0116128_10258552 | 3300009518 | Peatland | VNKHLERAKKFLEKNRVEDAIEAYLAVLDEAPLHA* |
| Ga0105237_120020181 | 3300009545 | Corn Rhizosphere | MASDIHKHLDRAKRFLEKNRVEDAIEAYLAVLDEA |
| Ga0116137_11097412 | 3300009549 | Peatland | MASDVNKHLERAKKFLEKNRVEDAIEAYLAVLDEAPLH |
| Ga0116124_10381471 | 3300009634 | Peatland | MASDVNKHLERAKKFLEKNRVEDAIEAYLAVLDEAP |
| Ga0126373_105203711 | 3300010048 | Tropical Forest Soil | MAADVSKNLERAKKFLEKNRVEDAIEAYLSVLEGAPQHLEATQA |
| Ga0074046_106349932 | 3300010339 | Bog Forest Soil | MADVSKNLERAKKFLEKNRFEDAIEAYLAVLQESPQN |
| Ga0126376_102466891 | 3300010359 | Tropical Forest Soil | MAADVSKHLERAKRFLEKNRLEDAIEAYLAALDESPQNQEATQ |
| Ga0126378_132772981 | 3300010361 | Tropical Forest Soil | MAPDVSKHLERAKRFLEKNRVEDAIEAYLAVIEEAPQHQEATQA |
| Ga0126381_1008722923 | 3300010376 | Tropical Forest Soil | MAADVSKHLERAKKFLEKNRVEDAIEAYLAALDAAPQNLESA |
| Ga0126357_12849352 | 3300010864 | Boreal Forest Soil | MAADLTKNLDRAKRFLEKNRVEDAIEAYLAVLDEAPQH |
| Ga0137392_108725402 | 3300011269 | Vadose Zone Soil | MAADVNKNLDRAKKLLERNRIEDAIEAYLGVLNDA |
| Ga0137393_105239652 | 3300011271 | Vadose Zone Soil | MATDVSKHLELAKRFLEKNRVEDAIQAYLAVLDEAPQHQ |
| Ga0137393_108164141 | 3300011271 | Vadose Zone Soil | MAADVNKQLDRAKRFLEKNRVEDAIQAYLAVLDEAP |
| Ga0137389_100655375 | 3300012096 | Vadose Zone Soil | MAADVSKHLERAKKFLEKNRVEDAISAYLAVLEESPQHA |
| Ga0137389_108853152 | 3300012096 | Vadose Zone Soil | MAADVNKNLDRAKKLLERNRIEDAIEAYLGVLNDAPNHYEATQAL |
| Ga0137389_115603792 | 3300012096 | Vadose Zone Soil | MADVNKQLERAKKFLEKNRTADAIDAYLAVLEEESAH |
| Ga0137388_100430835 | 3300012189 | Vadose Zone Soil | MAADVSKHLDRAKRFLEKNRVEDAIAAYKAVLDEAPQ |
| Ga0137388_113183511 | 3300012189 | Vadose Zone Soil | MAADVSKHLDRAKRFLEKNRVEDAIEAYLAVIDEMPQH |
| Ga0137388_116370852 | 3300012189 | Vadose Zone Soil | MSVDIVKQLDRAKRFIEKNRFEDAIEAYLAVLGEV |
| Ga0137363_110193862 | 3300012202 | Vadose Zone Soil | MAVDVSRHLDRAKRFLERNKVQDAIEAYLAVLEEFPTHQEATQAL |
| Ga0137362_110362132 | 3300012205 | Vadose Zone Soil | MAADVSKNLDRAKRFLEKNRVEDAIEAYLAVLDESPGHQEATQAL |
| Ga0137361_116450982 | 3300012362 | Vadose Zone Soil | MAADVSKHLDRAKRFLEKNRVEDAIEAYLAVLNQAPQHQ |
| Ga0137390_116294372 | 3300012363 | Vadose Zone Soil | MASEIIKHLDRAKRFLEKNRVEDAIEAYLAVIDEAPA |
| Ga0137358_101952952 | 3300012582 | Vadose Zone Soil | MAADISKHLDRAKRFLEKNRVEDAIEAYLAVLDAAPQH |
| Ga0137396_107190651 | 3300012918 | Vadose Zone Soil | MAADVSKHLDRAKRFIEKNRVEDAIEAYLAVLDEM |
| Ga0137394_105470941 | 3300012922 | Vadose Zone Soil | MAGDVSKHLERAKRFLEKNRVEDAIEAYLAVLGEAPQHQEATQAL |
| Ga0137416_102620731 | 3300012927 | Vadose Zone Soil | MAADVSKQLERAKKFLEKNRVEDAIEAYLAVLDGSPQHLE |
| Ga0164305_110456811 | 3300012989 | Soil | MADVNKLLERAKKFLEKNRTEDAIDAYLGVLEEAPAHPE |
| Ga0181539_100169425 | 3300014151 | Bog | MASDVNKHLERAKKFLEKNRVEDAIEAYLAVLDEAPLHA |
| Ga0137411_11438292 | 3300015052 | Vadose Zone Soil | MAGDVSKHLERAKRFLEKNRVEDAIEAYLAVLDEAPQHQEATQALGD |
| Ga0137418_101665251 | 3300015241 | Vadose Zone Soil | MAADVSKHLDRAKRFLEKNRVEDAIEAYLAVLDEVPQH |
| Ga0182037_100116377 | 3300016404 | Soil | MAADVAKNLERAKKFLEKNRFEDAIEAYLAVLEEAPQHVDATQTLGD |
| Ga0182039_112533142 | 3300016422 | Soil | MATDVNKHLDRAKRFLEKSRVEDAIQAYLAVLEEAP |
| Ga0187817_100971122 | 3300017955 | Freshwater Sediment | MAADVSKNLERAKKFLEKNRFEDAIEAYLAVLQES |
| Ga0187776_107021942 | 3300017966 | Tropical Peatland | MAADVNKNLERAKKFLERNRFEDAIEAYLAVLQESPQNVEAA |
| Ga0187816_105854231 | 3300017995 | Freshwater Sediment | MAADVSKQLERAKKYLEKNRLEDAIEAYLAVLDAAPQNLEASQALG |
| Ga0187767_100270702 | 3300017999 | Tropical Peatland | MAADVNKNLERAKKYLEKNRFEDAIEAYLAVIQES |
| Ga0187886_10618652 | 3300018018 | Peatland | MASDVNKHLERAKKFLEKNRVEDAIEAYLAVLDEAPLHAE |
| Ga0187765_102985322 | 3300018060 | Tropical Peatland | MASDISKHLDRAKRFLEKNRVEDAIEAYLTVIDLAPQ |
| Ga0187772_100556491 | 3300018085 | Tropical Peatland | MAADVSKLLERAKKYVEKNRFEDAIESYLAVLDAATQHM |
| Ga0187772_101799011 | 3300018085 | Tropical Peatland | MAADVNKNLERAKKFLERNRLVDAIEAYLAVLDEAPQNVEAAQML |
| Ga0179590_11813632 | 3300020140 | Vadose Zone Soil | MAVDVSKQLERAKKFLEKNRVEDAIEAYLAVLDGSPQH |
| Ga0210407_105201732 | 3300020579 | Soil | MAVDVSKQLERAKKFLEKNRVEDAIEAYLAVLDGSPQHL |
| Ga0210407_109028761 | 3300020579 | Soil | MAGDVSKHLDRAKRFLEKSRVEDAIEAYLAILDEA |
| Ga0210403_104000341 | 3300020580 | Soil | MAANVSKQLERAKKFLEKNRVEDAIEAYLAVLEGA |
| Ga0210395_103467891 | 3300020582 | Soil | MAADISKHLERAKRFLEKNRVEDAIEAYLAVIEAA |
| Ga0210400_104326851 | 3300021170 | Soil | MAADVSKHLDRAKRFLEKNRVEDAIAAYKAVLDEA |
| Ga0210400_109161641 | 3300021170 | Soil | MPADVSKHLERAKRFLEKNRVEDAIEAYLAVLDESPQHQEATQ |
| Ga0210397_107483481 | 3300021403 | Soil | MAADISKQLERAKRFLEKNRVEDAIEAYLAVIEAAPQH |
| Ga0210391_110153362 | 3300021433 | Soil | MAADVSKHLDRAKRFLEKNRVEDAIEAYLAVLDEAPQH |
| Ga0210390_102827602 | 3300021474 | Soil | MAADVSKHLDRAKRFLEKNRVEDAIEAYLAVLDGAPQHQE |
| Ga0210402_101140942 | 3300021478 | Soil | MAADVSKHLDRAKRFLEKNRVEDAIEAYLAVLDDA |
| Ga0210409_108601292 | 3300021559 | Soil | MAADVNKQLERAKKFLEKNRVEDAIEAYLGVLDEAPQPKEA |
| Ga0126371_126172861 | 3300021560 | Tropical Forest Soil | MAADVSKNLERAKKFLEKNRVEDAIEAYLSVLEGAPQHLEATQALGD |
| Ga0247688_10623122 | 3300024186 | Soil | MAADVSKNLDRAKRFLEKNRVEDAIEAYLAVLDEAPGHQEATQAL |
| Ga0207663_100314701 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDVNKQLERAKKFLEKNRTEDAIDAYLAVLEDAPA |
| Ga0209438_11609762 | 3300026285 | Grasslands Soil | MAADVSKQLERAKKFLEKNRVEDAIEAYLAVLDGS |
| Ga0209236_11201262 | 3300026298 | Grasslands Soil | MAGDVSKHLERAKRFLEKNRVEDAIEAYLAVLDEAPQHQEATQA |
| Ga0209761_10479783 | 3300026313 | Grasslands Soil | MAVDVSRHLDRAKRFLERNKVQDAIEAYLAVLEESPTHQEA |
| Ga0257178_10216682 | 3300026446 | Soil | MAADVSKQLERAKKFLEKNRVEDAIEAYLAVLDGSPQH |
| Ga0257153_10543091 | 3300026490 | Soil | MAADVSKNLDRAKRFLEKNRVEEAIEAYLSVLDEAPGHQEATQALGD |
| Ga0209156_101308271 | 3300026547 | Soil | MAADVSKHLDRAKRFLEKNRVEDAIEAYLAVLDEMPQ |
| Ga0179587_101038991 | 3300026557 | Vadose Zone Soil | MAADVSKQLERAKKFLEKNRVEDAIEAYLAVLDGAPQHL |
| Ga0207802_10015031 | 3300026847 | Tropical Forest Soil | MAADVSKNLERAKKFLEKNRVEDAIEAYLSVLEGAPQHLE |
| Ga0207803_10221942 | 3300027000 | Tropical Forest Soil | MAADVSKNLERAKKFLEKNRVEDAIEAYLSVFLTDRK |
| Ga0207762_10389562 | 3300027063 | Tropical Forest Soil | MAADVSKNLERAKKFLEKNRVEDAIEAYLSVLEGAPQ |
| Ga0209219_10856792 | 3300027565 | Forest Soil | MTADVSKHLDRAKRFLEKNRVEDAISAYLAVLGEAPQH |
| Ga0208988_10883671 | 3300027633 | Forest Soil | MAGDVSKHLERAKRFLEKNRVEDAIEAYLAVLGEAPQH |
| Ga0209446_10775562 | 3300027698 | Bog Forest Soil | MAADVNKNMERAKKLLEKNRFEDAIEAYLAVIQDSPQNVEAAQM |
| Ga0209248_100150062 | 3300027729 | Bog Forest Soil | MAADVSKNLDRAKRFLEKNRVEDAIEAYLAVLDESPQHQEA |
| Ga0209655_102871961 | 3300027767 | Bog Forest Soil | MAVDVSKNLERAKKFLEKNKVEDAIEAYLAVLEGAPHHIEA |
| Ga0209283_103542182 | 3300027875 | Vadose Zone Soil | MTPDVTKHLERAKRCLEKNRVEDAIEAYQAVLEAAPTHQ |
| Ga0209590_104792301 | 3300027882 | Vadose Zone Soil | MTPDVTKHLERAKRCLEKNRVEDAIEAYQVVLEAAPTHQEAMQALGD |
| Ga0209275_101790492 | 3300027884 | Soil | MAADIGKHLERAKRFLEKNRVEDAIEAYLAVIEAAPQ |
| Ga0137415_108810491 | 3300028536 | Vadose Zone Soil | MAADVSRHLDRAKRFLERNRIEDAISAYLAVLDDAPQHQEATQA |
| Ga0170818_1003107482 | 3300031474 | Forest Soil | MTDVNKQLERAKKFLEKNRTEDAIDAYLAVLEDAPSHPEATQALG |
| Ga0318555_100502621 | 3300031640 | Soil | MAADVSKNLERAKKFLEKNRVEDAIEAYLSVLEGAPQHLEA |
| Ga0310686_1197570812 | 3300031708 | Soil | MAADVSKHLDRAKRFLEKNRVEDAIEAYLAVLDEA |
| Ga0307469_107906102 | 3300031720 | Hardwood Forest Soil | MADVNKHLERAKKFLEKNRIEDAIDAYLAVLEEAPAHPEA |
| Ga0318523_103310882 | 3300031798 | Soil | MADVSKHLDRAKKFLEKNRIEDAIEAYLSVLEEAP |
| Ga0306919_101069201 | 3300031879 | Soil | MAADVSKNLERAKKFLEKNRVEDAIEAYLSVLEGAPQHLEAT |
| Ga0310910_102541802 | 3300031946 | Soil | MAADVSKNLERAKKFLEKNRVEDAIEAYLSVLEGAPQHLEATQ |
| Ga0307479_101107611 | 3300031962 | Hardwood Forest Soil | MAADVSKHLDRAKRFLEKNRVEDAIEAYLAVLDEAP |
| Ga0318569_105198241 | 3300032010 | Soil | MAADVSKNLERAKKFLEKNRVEDAIEAYLSVLEGAPQHL |
| Ga0311301_123032001 | 3300032160 | Peatlands Soil | MAADVSKQLERAKKFLEKNRVEDAIEAYLGVLELSPQHTEASQALGD |
| Ga0307471_1012971112 | 3300032180 | Hardwood Forest Soil | MAADVSKNLDKAKRFLEKNRVQEAIEAYLGVLDEAPGHQE |
| Ga0307471_1014670342 | 3300032180 | Hardwood Forest Soil | MTDVNKQLERAKKFIEKNRIEDAIDAYLAVLEEAPAHPEATQAL |
| Ga0307471_1028145331 | 3300032180 | Hardwood Forest Soil | MAADVSKHLDRAKRFLEKNRVEDAIEAYLAVLDEMP |
| Ga0307471_1028494651 | 3300032180 | Hardwood Forest Soil | MAADVSKHLDRAKRFLEKNRVEDAIEAYLAVLDDAP |
| Ga0307471_1041166121 | 3300032180 | Hardwood Forest Soil | MAADVSKHLERAKRFLEKNRVEDAIEAYLAVLDES |
| Ga0335082_114153542 | 3300032782 | Soil | MAADVSKNLDRAKRFLEKNRVEDAIEAYLSVLDEAPGHQEATQ |
| Ga0335082_115846882 | 3300032782 | Soil | MAADVSKNLDRAKRFLEKNRVEDAIEAYLGVLDDSPNHPEAT |
| Ga0335079_103522472 | 3300032783 | Soil | MAVDVSKNLEKAKKFLEKNRFEDAIEAYLSVLADAPQNV |
| Ga0335077_119771331 | 3300033158 | Soil | MAADVSKHLERAKRFLEKNRVEDAIEAYLAVLDESPQ |
| Ga0326727_104941391 | 3300033405 | Peat Soil | MAADVSKQLERAKKFLEKNRVEDAIEAYLAVLEEAP |
| Ga0310810_103029362 | 3300033412 | Soil | MAADVSKHLDRAKRFLEKNRVEDAIEAYLAVLDEAPQHQ |
| Ga0314862_0112378_2_139 | 3300033803 | Peatland | MAADVSKLLERAKKYVEKNRFEDAIEAYLAVLDAAPQHQEASQALG |
| ⦗Top⦘ |