| Basic Information | |
|---|---|
| Family ID | F081128 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRVILALAVLILGSTGGEIAITHGMKATGEPARLRPRAL |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.17 % |
| % of genes near scaffold ends (potentially truncated) | 94.74 % |
| % of genes from short scaffolds (< 2000 bps) | 86.84 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.614 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (34.210 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.211 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.78% β-sheet: 0.00% Coil/Unstructured: 55.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF04055 | Radical_SAM | 29.82 |
| PF00892 | EamA | 11.40 |
| PF13536 | EmrE | 7.89 |
| PF05653 | Mg_trans_NIPA | 1.75 |
| PF13432 | TPR_16 | 0.88 |
| PF02321 | OEP | 0.88 |
| PF00282 | Pyridoxal_deC | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.75 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.61 % |
| Unclassified | root | N/A | 4.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101733637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300002558|JGI25385J37094_10031031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum | 1883 | Open in IMG/M |
| 3300003352|JGI26345J50200_1033811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300004633|Ga0066395_10878454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300005167|Ga0066672_10021532 | All Organisms → cellular organisms → Bacteria | 3385 | Open in IMG/M |
| 3300005176|Ga0066679_10202065 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300005180|Ga0066685_10671578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300005184|Ga0066671_10040299 | All Organisms → cellular organisms → Bacteria | 2280 | Open in IMG/M |
| 3300005332|Ga0066388_104883047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300005538|Ga0070731_10202719 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300005552|Ga0066701_10143409 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300005552|Ga0066701_10643867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300005554|Ga0066661_10009521 | All Organisms → cellular organisms → Bacteria | 4774 | Open in IMG/M |
| 3300005586|Ga0066691_10656882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300006796|Ga0066665_10075112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2411 | Open in IMG/M |
| 3300006806|Ga0079220_11649616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300009012|Ga0066710_104062101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300009038|Ga0099829_10860001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 753 | Open in IMG/M |
| 3300009088|Ga0099830_11043891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300009088|Ga0099830_11804297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300009090|Ga0099827_10249809 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300009792|Ga0126374_11068763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300010335|Ga0134063_10100145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1315 | Open in IMG/M |
| 3300010337|Ga0134062_10057990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1591 | Open in IMG/M |
| 3300010366|Ga0126379_10318894 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300010366|Ga0126379_11302514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300011269|Ga0137392_11389982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300012189|Ga0137388_10320414 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300012200|Ga0137382_10270844 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300012202|Ga0137363_10149959 | All Organisms → cellular organisms → Bacteria | 1831 | Open in IMG/M |
| 3300012202|Ga0137363_10497435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1024 | Open in IMG/M |
| 3300012203|Ga0137399_10525360 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300012207|Ga0137381_10413928 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300012351|Ga0137386_10249689 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300012356|Ga0137371_10902399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300012361|Ga0137360_11322747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300012363|Ga0137390_11520828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300012582|Ga0137358_10062333 | All Organisms → cellular organisms → Bacteria | 2494 | Open in IMG/M |
| 3300012685|Ga0137397_11278397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300012918|Ga0137396_10316016 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300012918|Ga0137396_11048553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300012922|Ga0137394_10512155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300012922|Ga0137394_11204230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300012922|Ga0137394_11341030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300012924|Ga0137413_10894725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300012925|Ga0137419_11344000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300012927|Ga0137416_10714237 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300012927|Ga0137416_10911137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 782 | Open in IMG/M |
| 3300012929|Ga0137404_10291213 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300012930|Ga0137407_10695805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
| 3300012930|Ga0137407_12100743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300012931|Ga0153915_10843808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
| 3300014150|Ga0134081_10071924 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300014166|Ga0134079_10603200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300015241|Ga0137418_10289116 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300015358|Ga0134089_10132118 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300016371|Ga0182034_11173828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300016371|Ga0182034_12058675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300017930|Ga0187825_10168931 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300017966|Ga0187776_10515579 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300018431|Ga0066655_10107682 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300020199|Ga0179592_10003163 | All Organisms → cellular organisms → Bacteria | 6925 | Open in IMG/M |
| 3300020579|Ga0210407_10838433 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300020580|Ga0210403_10634818 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300021088|Ga0210404_10065639 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
| 3300021088|Ga0210404_10224230 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300021168|Ga0210406_10175394 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300021180|Ga0210396_10947863 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300021403|Ga0210397_10895286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300021405|Ga0210387_11749258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300021406|Ga0210386_10427876 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300021420|Ga0210394_11035981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300021478|Ga0210402_10179244 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300021479|Ga0210410_10918448 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300021559|Ga0210409_11230078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300022533|Ga0242662_10032924 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300026295|Ga0209234_1037568 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
| 3300026296|Ga0209235_1129029 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300026304|Ga0209240_1023957 | All Organisms → cellular organisms → Bacteria | 2336 | Open in IMG/M |
| 3300026551|Ga0209648_10067020 | All Organisms → cellular organisms → Bacteria | 3031 | Open in IMG/M |
| 3300026557|Ga0179587_11186285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300027061|Ga0209729_1050066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300027605|Ga0209329_1017192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1435 | Open in IMG/M |
| 3300027671|Ga0209588_1075419 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300027729|Ga0209248_10070233 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Brocadia → Candidatus Brocadia sapporoensis | 1064 | Open in IMG/M |
| 3300027812|Ga0209656_10322496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300027857|Ga0209166_10024174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3750 | Open in IMG/M |
| 3300027862|Ga0209701_10405679 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300027862|Ga0209701_10465086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300027867|Ga0209167_10401813 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300027879|Ga0209169_10645858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300027894|Ga0209068_10255004 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300028047|Ga0209526_10319786 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300030520|Ga0311372_10244024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2921 | Open in IMG/M |
| 3300031122|Ga0170822_15453085 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300031231|Ga0170824_107750661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300031718|Ga0307474_10244251 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300031720|Ga0307469_11746165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300031720|Ga0307469_12087048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300031720|Ga0307469_12516788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300031723|Ga0318493_10746574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300031754|Ga0307475_11080921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300031795|Ga0318557_10540670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300031795|Ga0318557_10583466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300031820|Ga0307473_10126289 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300031823|Ga0307478_10808528 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300032515|Ga0348332_12192022 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300032770|Ga0335085_10633679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1198 | Open in IMG/M |
| 3300032783|Ga0335079_10397383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1487 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 34.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.14% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.14% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.39% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.51% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.63% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.75% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.88% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.88% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1017336371 | 3300002245 | Forest Soil | MIRTVLLLALLIFGSTAGEIAITFGMRATGEPARLRPKALLEFLRRAL |
| JGI25385J37094_100310313 | 3300002558 | Grasslands Soil | MRVILALAVLVLGSTGGEIAITHGMKATGEPAKLRPRALLQFLARAVC |
| JGI26345J50200_10338111 | 3300003352 | Bog Forest Soil | MHVVLFLSFLIFGSTGGEIAITYGMKATGEPERLRPRELLRFL |
| Ga0066395_108784542 | 3300004633 | Tropical Forest Soil | MRIVIGLAILILGSTGGEIAITHGMKSVGEPAQLRPLAVLQF |
| Ga0066672_100215324 | 3300005167 | Soil | MRVILALAVLILGSTGGEIAITRGMKATGEPARLRPMALL |
| Ga0066679_102020653 | 3300005176 | Soil | MRVIVALAVLILGSTGGEIAITYGMKATGEPARLRPRALFQFLGR |
| Ga0066685_106715781 | 3300005180 | Soil | MIGTILLLAVLICGSTGGEIAMTYGMKATGEPARLRPKALLIF |
| Ga0066685_110457171 | 3300005180 | Soil | MRVILALAVLVLGSTGGEIAITHGMKATGEPARLRPRALLQFLGRAVQN |
| Ga0066671_100402993 | 3300005184 | Soil | MRVFLGLAALILGSTCGEIAITHGMKSVGEPARLRPKAVLRFLARTVRN |
| Ga0066388_1048830471 | 3300005332 | Tropical Forest Soil | MIGTILLLAVLICGSTFGEIAMTYGMKATGEPARLRPKALLI |
| Ga0070731_102027191 | 3300005538 | Surface Soil | VIRVALLLGVLILGSTGGEIAITFGMKATGEPAQLRPIALLKFLGK |
| Ga0066701_101434091 | 3300005552 | Soil | MRVILALAVLILGSTGGEIAITHGMKATGEPARLRPRALLQFL |
| Ga0066701_106438673 | 3300005552 | Soil | MYVRVVVGLAVLILGSTGGEIAITHGMKSVGEPARLRP |
| Ga0066661_100095211 | 3300005554 | Soil | MRVILALAVLILGSTGGEIAITHGMKATGEPTRLRPMALLQFLG |
| Ga0066691_106568822 | 3300005586 | Soil | MRIIIGLAILILGSTGGEIAITHGMKSVGEPARLRPRAVLL |
| Ga0066665_100751121 | 3300006796 | Soil | MRVIVALAVLILGSTGGEIAITYGMKATGEPARLRPRALFQFLG |
| Ga0079220_116496161 | 3300006806 | Agricultural Soil | MIRVAVFLGLLIFGSTGGEIAITRGMKATGEPERL |
| Ga0066710_1040621011 | 3300009012 | Grasslands Soil | MRIIMGLAILILGSTGGEIAITHGMKSVGEPARLRPRAVLLFLG |
| Ga0099829_108600013 | 3300009038 | Vadose Zone Soil | MIRVVLALAVLILGSTGGEIAVTYGMKATGEPTRLRPR |
| Ga0099830_110438911 | 3300009088 | Vadose Zone Soil | MMRVILALAVLILGSTGGEIAITHGMKATGEPARLRPRELL |
| Ga0099830_118042971 | 3300009088 | Vadose Zone Soil | MIRDILMLAVFIFGTTGGEIAVTYGLKATGEPARLRPK |
| Ga0099827_102498093 | 3300009090 | Vadose Zone Soil | MRVILALAVLILGSTGGEIAVTHGMKATGEPARLRPRALL |
| Ga0126374_110687632 | 3300009792 | Tropical Forest Soil | MIRVALLLAVLICASTGGEIAITHGMKATGEPQRL |
| Ga0134063_101001453 | 3300010335 | Grasslands Soil | MRVILALAVLILGSTGGEIAITRGMKATGEPARLRPR |
| Ga0134062_100579901 | 3300010337 | Grasslands Soil | MRVIVGLAILILGSTGGEIAITHGMKSAGEPARLRPREVLQ |
| Ga0126379_103188943 | 3300010366 | Tropical Forest Soil | MIRVVLALAVLVLGSTGGEIAITHGMKSVGEPARLRP |
| Ga0126379_113025143 | 3300010366 | Tropical Forest Soil | MRVILALAVLVLGSTGGEIAITHGMKSVGEPARLR |
| Ga0137392_113899822 | 3300011269 | Vadose Zone Soil | MRVILALAVLILGSTGGEIAITHGMKATGEPARLRPLALLQFLGRAVR |
| Ga0137388_103204143 | 3300012189 | Vadose Zone Soil | MRVILALAVLILGSTGGEIAITHGMKATGEPARLRPLALL |
| Ga0137382_102708441 | 3300012200 | Vadose Zone Soil | MRVILALAVLILGSTGGEIAITHGMKATGEPTRLRPM |
| Ga0137363_101499593 | 3300012202 | Vadose Zone Soil | MIRVALLLAVLILCSTGGEIAITHGMKATGEPARLRPRQIL |
| Ga0137363_104974351 | 3300012202 | Vadose Zone Soil | MIGTILLLAVLICGSTGGEIAMTYGMKATGEPARLR |
| Ga0137399_105253601 | 3300012203 | Vadose Zone Soil | MRVILALAVLILGSTGGEIAITRGMKATGEPARLRPW |
| Ga0137362_107883513 | 3300012205 | Vadose Zone Soil | MRRVILALAVLILGSTGGEIAITYGMKATGEPARLRPRALLQFLGRALR |
| Ga0137381_104139281 | 3300012207 | Vadose Zone Soil | MRVILALAVLILGSTGGEIAITHGMKATGEPARLRPRALLQF |
| Ga0137381_117655362 | 3300012207 | Vadose Zone Soil | MRVVRALAVLILGSTGGEIAITHGMKATGEPARLRPLELLQFLGRAVR |
| Ga0137378_101820791 | 3300012210 | Vadose Zone Soil | MRVIIGLAILILGSTGGEIAITHGMKSVGEPARLRPRAVLQFLARAVRNG |
| Ga0137386_102496891 | 3300012351 | Vadose Zone Soil | MRVILALAVLILGSTGGEIAITHGMKATGEPARLR |
| Ga0137371_109023991 | 3300012356 | Vadose Zone Soil | MRVILALAVLILGSTGGEIAITHGMKATGEPTRLRPMALLQF |
| Ga0137360_113227472 | 3300012361 | Vadose Zone Soil | MSGGTIILLAVLICGSTFGEIAMTYGMKATGEPARLRPKPLL |
| Ga0137390_115208281 | 3300012363 | Vadose Zone Soil | MSGTIILLAVLICGSTFGEIAMTYGMKATGEPARLRPKPLLIF |
| Ga0137358_100623334 | 3300012582 | Vadose Zone Soil | MRVILALAILILGSTGGEIAITHGMKATGEPTRLR |
| Ga0137397_112783972 | 3300012685 | Vadose Zone Soil | MIRIALFLGVLILGTTAGEIAMTLGMKATGEPARLRPREILIFLGR |
| Ga0137396_103160161 | 3300012918 | Vadose Zone Soil | MSGTILLLAVLICGSTFGEIAMTYGMKATGEPARLRPKALLI |
| Ga0137396_110485531 | 3300012918 | Vadose Zone Soil | MRVILALAVLILGSTGGEIAITHGMKATGEPARLRPRAL |
| Ga0137394_105121551 | 3300012922 | Vadose Zone Soil | MMRVILALAVLILGSTGGEIAITYGMKATGEPARLRPRALLQFL |
| Ga0137394_112042301 | 3300012922 | Vadose Zone Soil | MIRVALFLGVLILGTTGGEIAMTLGMKATGEPARLRPREILIFLGR |
| Ga0137394_113410301 | 3300012922 | Vadose Zone Soil | MMRVILALVVLILGSTGGEIAITYGMKATGEPARLRPRALLQFLGRA |
| Ga0137413_108947253 | 3300012924 | Vadose Zone Soil | MIGVALLLGLQILCSTGGEIALTHGMKATGEPARLRP |
| Ga0137419_113440001 | 3300012925 | Vadose Zone Soil | MMRVALLLAVLILGSTGGEIAITHGMKAAGEPARLRPREVLAFL |
| Ga0137416_107142373 | 3300012927 | Vadose Zone Soil | MRVILALAVLILGSTGGEIAITHGMKTTGEPARLRP |
| Ga0137416_109111371 | 3300012927 | Vadose Zone Soil | MRVILALAVLIFGSTGGEIAITLGMKATGEPTRMRPLELLQFMG |
| Ga0137404_102912131 | 3300012929 | Vadose Zone Soil | MIRIALFLGVLILGTTAGEIAMTLGMKATGEPARLRPREILIFLGRA |
| Ga0137407_106958051 | 3300012930 | Vadose Zone Soil | MTRVILALAVLILGSTGGEIAITYGMKATGEPARLRP |
| Ga0137407_121007431 | 3300012930 | Vadose Zone Soil | VIGTILLLAVLICGSTGGEIAMTYGMKATGEPARLRPKA |
| Ga0153915_108438081 | 3300012931 | Freshwater Wetlands | MMRSMGMLGVLILSSTGGEIAITHGMKAVGEPERL |
| Ga0134081_100719243 | 3300014150 | Grasslands Soil | MRIIIGLAILILGSTGGEIAITHGMKSVGEPARLRP |
| Ga0134079_106032002 | 3300014166 | Grasslands Soil | MRVILALAVLILGSTGGEIAITHGMKATGEPARLRPMALLQFLGRAV |
| Ga0137418_102891161 | 3300015241 | Vadose Zone Soil | MHVILALAVLILGSTGGEIAITYGMKATGEPARLRP |
| Ga0134089_101321183 | 3300015358 | Grasslands Soil | MRVILALAVLILGSTGGEIAITHGMKATGEPTRLRPMA |
| Ga0182034_111738282 | 3300016371 | Soil | MIRVAFMVGVLVFGSTGGEIAITYGMKATGEPERIAPRAILQFL |
| Ga0182034_120586751 | 3300016371 | Soil | MRVVLALAVLVLGSTGGELAITHGMKTTGEPARLR |
| Ga0187825_101689311 | 3300017930 | Freshwater Sediment | MRVVLALAILILGSTGGEIAITHGMKATGEPARLRPHALLQFL |
| Ga0187776_105155791 | 3300017966 | Tropical Peatland | MRVILVLAVLILGSTGGEIAITHGMKSTGEPARLRPRALLQ |
| Ga0066655_101076823 | 3300018431 | Grasslands Soil | MRVIVGLAILILGSAGGEIAITHGMKSAGEPARLRPREVLQFLG |
| Ga0179592_100031631 | 3300020199 | Vadose Zone Soil | LTRVILALAVLILGSTGGEIAITRGMKATGEPARLRPWALLQ |
| Ga0210407_108384333 | 3300020579 | Soil | MTPVILALCVLVFGSTGGEIAMTCGMKATGEPARLRPR |
| Ga0210403_106348181 | 3300020580 | Soil | MRVILALAVLILGSTGGEIAITYGMKATGEPTRLRPLELLQFLGR |
| Ga0210404_100656393 | 3300021088 | Soil | MMRVALLLAVLILGSTGGEIAITYGMKATGEPARLRP |
| Ga0210404_102242301 | 3300021088 | Soil | MTRVILALCVLIFGSTGGEIAITYGMKATGEPAQLRPRALL |
| Ga0210406_101753943 | 3300021168 | Soil | MTRVALLLAVLILGSTGGEIAITHGMKATGEPARLRPRELWAFL |
| Ga0210396_109478633 | 3300021180 | Soil | MMHVAVFLCLLIFGSTGGEIAITRGMKATGEPERLRPRELLR |
| Ga0210397_108952861 | 3300021403 | Soil | MTHVALFLSFLIFGSTGGEIAITRGMKATGEPGRLRP |
| Ga0210387_117492582 | 3300021405 | Soil | MSGTILLLAVLICGSTFGEIAMTYGMKATGEPARLRPKP |
| Ga0210386_104278763 | 3300021406 | Soil | MMHVALFLAFLILGSTGGEIAITRGMKATGEPERLRPREL |
| Ga0210394_110359813 | 3300021420 | Soil | MMHVALFLGFLIFGSTGGEIAITRGMKATGEPERLRPRELLRFLVR |
| Ga0210402_101792443 | 3300021478 | Soil | MTRVIFALCVLIFGSTGGEIAITYGMKATGEPARLRPRAL |
| Ga0210410_109184483 | 3300021479 | Soil | MMRVALLLAVLIVGSTGGEIAITHGMKATGEPARLRPRELLA |
| Ga0210409_112300782 | 3300021559 | Soil | MMHVAVFLAFLILGSTGGEIAITRGMKATGEPERLRPKEL |
| Ga0242662_100329241 | 3300022533 | Soil | MIRVALLLAVLILCSTGGEIAITHGMKATGEPARLRPRQIWAFLA |
| Ga0209234_10375681 | 3300026295 | Grasslands Soil | MRVILALAVLILGSTGGEIAITHGMKASGEPARLRPRALLQF |
| Ga0209235_11290293 | 3300026296 | Grasslands Soil | MRVILALAVLVLGSTGGEIAITHGMKATGEPAKLRPRAL |
| Ga0209240_10239573 | 3300026304 | Grasslands Soil | MIRDVFVLAVLVFGSTGGEIAITHGMKATGEPAKLCPMAVLQ |
| Ga0209648_100670201 | 3300026551 | Grasslands Soil | MTRVIFALVVLVLGSTGGEIAITHGMKATGEPARLRPR |
| Ga0179587_111862851 | 3300026557 | Vadose Zone Soil | MRVILALAVLILGSTGGEIAVTHGMKATGEPARLRPR |
| Ga0209729_10500661 | 3300027061 | Forest Soil | MRVMLALAVLILGSTGGEIAITHGMKATGEPARLR |
| Ga0209329_10171921 | 3300027605 | Forest Soil | MRVILALTVLILGSTGGEIAVTHGMKATGEPARLRPRALL |
| Ga0209588_10303423 | 3300027671 | Vadose Zone Soil | MRVIFALAVLILGSTGGEIAITHGMKATGEPTQLRPRALLQFLGRAVRNG |
| Ga0209588_10754193 | 3300027671 | Vadose Zone Soil | MTRVILALAVLILGSTGGEIAITYGMKATGEPARLRPRALLQFLGR |
| Ga0209248_100702331 | 3300027729 | Bog Forest Soil | MMRFAIVLGLLILGSTGGEIAITYGMKATGEPARLRPKEIL |
| Ga0209656_103224963 | 3300027812 | Bog Forest Soil | MTHVALFLSFLIFGSTGGEIAITRGMKATGEPERLRPREMLQFLG |
| Ga0209166_100241741 | 3300027857 | Surface Soil | MMHVALFLAFLIFGSTGGEIAITLGMKATGEPARL |
| Ga0209701_104056791 | 3300027862 | Vadose Zone Soil | MRVILALALLIFGSTGGEIAITHGMKATGEPARLRP |
| Ga0209701_104650863 | 3300027862 | Vadose Zone Soil | MMRVALLLAVLILGSTGGEIAITHGMKATGEPARLRPRE |
| Ga0209167_104018133 | 3300027867 | Surface Soil | MRVALLLGLQILCSTGGEIALTHGMKATGEPARLRPREL |
| Ga0209169_106458582 | 3300027879 | Soil | MMHVGLFLSFLIFGSTGGEIAITRGMKATGEPERLRPKEL |
| Ga0209068_102550043 | 3300027894 | Watersheds | MRVILALAVLIFGSTGGEIAITYGMKATGEPARLRPLALLQFL |
| Ga0209526_103197863 | 3300028047 | Forest Soil | MTRMILALAVLILGSTGGEIAMTYGMKATGEPARLRP |
| Ga0311372_102440244 | 3300030520 | Palsa | LIRSILMLGVLIFASTGGEIAITLGMKTIGEPKRLRPKELAVFLLR |
| Ga0170822_154530853 | 3300031122 | Forest Soil | MSGGTIILLAVLICGSTFGEIAMTYGMKATGEPARLRPK |
| Ga0170824_1077506613 | 3300031231 | Forest Soil | MSGGTIILLAVLICGSTFGEIAMTYGMKTTGDPARLRPKP |
| Ga0307474_102442513 | 3300031718 | Hardwood Forest Soil | MIRVALLLAVLILCSTGGEIAITHGMKATGEPARLRPRQ |
| Ga0307469_117461652 | 3300031720 | Hardwood Forest Soil | MSGGTILLLAVLICGSTFGEIAMTYGMKATGEPARLR |
| Ga0307469_120870482 | 3300031720 | Hardwood Forest Soil | MIRFLFMLAVLVFGSTLGEIAITYGMKATGEPERFTPRAI |
| Ga0307469_125167882 | 3300031720 | Hardwood Forest Soil | MRVILALAVLILGSTGGEIAITYGMKATGEPARLRPLELLQFLG |
| Ga0318493_107465742 | 3300031723 | Soil | MYVHVIVGLAVLILGSTGGEIAITHGMKSVGEPARLRPAAV |
| Ga0307475_110809212 | 3300031754 | Hardwood Forest Soil | MTRVILMLAVLVFGSTGGEIAITHGMKATGEPSRLRPKPLLEFLGR |
| Ga0318557_105406702 | 3300031795 | Soil | MIRVAFMVGVLVFGSTGGEIAITYGMKATGEPERI |
| Ga0318557_105834662 | 3300031795 | Soil | MYVHVIVGLAVLILGSTGGEIAITHGMKSVGEPARL |
| Ga0307473_101262891 | 3300031820 | Hardwood Forest Soil | MRVVLALAVLILGSTGGEIAITYGMKATGEPARLRPRALFQFLGR |
| Ga0307478_108085281 | 3300031823 | Hardwood Forest Soil | MRVIMALAVLVLGSTGGEIAITHGMKATGEPARLRPL |
| Ga0348332_121920223 | 3300032515 | Plant Litter | MMHVALFLSFLIFGSTGGEIAITRGMKASGEPERLRPKEMLQFL |
| Ga0335085_106336793 | 3300032770 | Soil | MIGTLILLAVLVCASTGGEIAITYGMKSVGEPARLRPKQLLVFLGR |
| Ga0335079_103973831 | 3300032783 | Soil | MIRVGVFLCFLIFGSTGGEIAITRGMKATGEPERM |
| ⦗Top⦘ |