| Basic Information | |
|---|---|
| Family ID | F081126 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MALHATHRDAGKVTVVDLSGRITLGDGSALLRKTVRGL |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.86 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.86 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.316 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.719 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.035 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.12% β-sheet: 0.00% Coil/Unstructured: 87.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF13581 | HATPase_c_2 | 89.47 |
| PF13335 | Mg_chelatase_C | 6.14 |
| PF04011 | LemA | 0.88 |
| PF08241 | Methyltransf_11 | 0.88 |
| PF00583 | Acetyltransf_1 | 0.88 |
| PF08713 | DNA_alkylation | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG4912 | 3-methyladenine DNA glycosylase AlkD | Replication, recombination and repair [L] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_106135051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 582 | Open in IMG/M |
| 3300001593|JGI12635J15846_10661615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 604 | Open in IMG/M |
| 3300001686|C688J18823_11110593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 501 | Open in IMG/M |
| 3300002912|JGI25386J43895_10092977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 788 | Open in IMG/M |
| 3300004268|Ga0066398_10175910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300004631|Ga0058899_12252353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 647 | Open in IMG/M |
| 3300004972|Ga0072325_1280108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 605 | Open in IMG/M |
| 3300005179|Ga0066684_10305161 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300005437|Ga0070710_11080106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 588 | Open in IMG/M |
| 3300005538|Ga0070731_11108390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 523 | Open in IMG/M |
| 3300005541|Ga0070733_10435926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300005575|Ga0066702_10321933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
| 3300005598|Ga0066706_10071081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2434 | Open in IMG/M |
| 3300005610|Ga0070763_10260204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 943 | Open in IMG/M |
| 3300005764|Ga0066903_101425794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1303 | Open in IMG/M |
| 3300006796|Ga0066665_10321043 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300007265|Ga0099794_10099633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1449 | Open in IMG/M |
| 3300007265|Ga0099794_10479914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300009148|Ga0105243_12745534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300009764|Ga0116134_1159224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300010048|Ga0126373_10706079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300010339|Ga0074046_10846252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300010343|Ga0074044_10143992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1595 | Open in IMG/M |
| 3300010359|Ga0126376_12100862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300010360|Ga0126372_10549454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
| 3300010360|Ga0126372_12914856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300010361|Ga0126378_11842274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300010362|Ga0126377_10767939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
| 3300011120|Ga0150983_14334062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300011120|Ga0150983_15582094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300011270|Ga0137391_10243181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1561 | Open in IMG/M |
| 3300012201|Ga0137365_10663489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300012361|Ga0137360_10559406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
| 3300012917|Ga0137395_10356527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
| 3300012944|Ga0137410_10638717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300012948|Ga0126375_10203142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1303 | Open in IMG/M |
| 3300012948|Ga0126375_10537708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300012977|Ga0134087_10769810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300015053|Ga0137405_1114033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300015053|Ga0137405_1341545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300015054|Ga0137420_1355133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
| 3300016319|Ga0182033_10031474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis → Granulicella mallensis MP5ACTX8 | 3395 | Open in IMG/M |
| 3300017975|Ga0187782_11135743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300017999|Ga0187767_10055728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
| 3300018043|Ga0187887_10595836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300018058|Ga0187766_10880360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300018088|Ga0187771_10175662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1771 | Open in IMG/M |
| 3300019275|Ga0187798_1194977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300019278|Ga0187800_1088022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300019278|Ga0187800_1569707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300019284|Ga0187797_1491938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300020199|Ga0179592_10090276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1406 | Open in IMG/M |
| 3300020580|Ga0210403_11077430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300020582|Ga0210395_11208042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300021046|Ga0215015_10426020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300021086|Ga0179596_10505794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300021181|Ga0210388_11085451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300021403|Ga0210397_10482555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300021433|Ga0210391_10708582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300021477|Ga0210398_10917569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300021478|Ga0210402_10714504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300021479|Ga0210410_11518877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300021559|Ga0210409_10256258 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300021559|Ga0210409_10946031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300021559|Ga0210409_11194029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300022501|Ga0242645_1017645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300022508|Ga0222728_1065879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300022510|Ga0242652_1016987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300022512|Ga0242676_1033413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300022531|Ga0242660_1153475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300022532|Ga0242655_10172190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300022724|Ga0242665_10219280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300022726|Ga0242654_10148869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300022726|Ga0242654_10290618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300024178|Ga0247694_1022154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300024288|Ga0179589_10018133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2274 | Open in IMG/M |
| 3300024290|Ga0247667_1011804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1760 | Open in IMG/M |
| 3300024323|Ga0247666_1021059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1394 | Open in IMG/M |
| 3300025905|Ga0207685_10137950 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300025915|Ga0207693_10839754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300025922|Ga0207646_10825850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
| 3300025922|Ga0207646_10985714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300026498|Ga0257156_1068535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300026515|Ga0257158_1082440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300026547|Ga0209156_10017191 | All Organisms → cellular organisms → Bacteria | 4441 | Open in IMG/M |
| 3300026557|Ga0179587_10431281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300027371|Ga0209418_1068337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300027376|Ga0209004_1002499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2283 | Open in IMG/M |
| 3300027567|Ga0209115_1136316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300027645|Ga0209117_1097548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300027824|Ga0209040_10185489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1092 | Open in IMG/M |
| 3300028536|Ga0137415_11272194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300028906|Ga0308309_11773342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300030490|Ga0302184_10277731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 678 | Open in IMG/M |
| 3300030589|Ga0210255_10276290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300030629|Ga0210268_1208494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300030741|Ga0265459_13139748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300030935|Ga0075401_11813768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300031057|Ga0170834_108418254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300031057|Ga0170834_111091278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300031122|Ga0170822_10282599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300031128|Ga0170823_11579881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300031446|Ga0170820_12329817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1410 | Open in IMG/M |
| 3300031720|Ga0307469_11091370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 749 | Open in IMG/M |
| 3300031744|Ga0306918_10933008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300031879|Ga0306919_11539722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300031890|Ga0306925_11583408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300031945|Ga0310913_10210430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1360 | Open in IMG/M |
| 3300031962|Ga0307479_11460177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300032205|Ga0307472_101933174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300032892|Ga0335081_11743412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300032955|Ga0335076_10083704 | All Organisms → cellular organisms → Bacteria | 3128 | Open in IMG/M |
| 3300033158|Ga0335077_10117152 | All Organisms → cellular organisms → Bacteria | 3104 | Open in IMG/M |
| 3300033805|Ga0314864_0094487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.32% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.02% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.39% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 4.39% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.51% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.51% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.63% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.75% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.88% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004972 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030589 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030629 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030935 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1061350511 | 3300000955 | Soil | MSLHATYRDSGIVTVVDLGGRIVLGDGSALLRKTVRQLLDENR |
| JGI12635J15846_106616152 | 3300001593 | Forest Soil | MALHATPRDAGGVTVVDLSGRITLGEGSALLRKTI |
| C688J18823_111105932 | 3300001686 | Soil | MDLRATYRDAGVVTVVDIGGRITLGEGSALLRKTIREL |
| JGI25386J43895_100929771 | 3300002912 | Grasslands Soil | MFLRATHRDAGQVTVVDFSGRITLGDGSALLRKMIRGLLDDQRK |
| Ga0066398_101759102 | 3300004268 | Tropical Forest Soil | MALHATYRDVGQVTVVDLGGRIVLGDGSALLRKTVKQLLDD |
| Ga0058899_122523531 | 3300004631 | Forest Soil | MPSLFATTREYSGISLVDLSGRISLGDGSALLRKTVRDLL |
| Ga0072325_12801081 | 3300004972 | Peatlands Soil | MPALYATTREVGVITLVDLSGRIALGEGSALLRKTIRDLLDGG |
| Ga0066684_103051611 | 3300005179 | Soil | VCAMSLHATYRDSGDVTVVDLGGRIVLGDGSALLRKTVRQLLDD |
| Ga0070710_110801062 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MALHLTPRDSGAITVVDASGRITLGDGSANLRKTIRQLVEEAHCKIV |
| Ga0070731_111083902 | 3300005538 | Surface Soil | MPSLFATTREYSGITLVDLSGRISLGDGSALLRKTVRDLL |
| Ga0070733_104359263 | 3300005541 | Surface Soil | MALRATHRDAGETTVVELGGRIILGEGSALLRKTVRGLLEDN |
| Ga0066702_103219331 | 3300005575 | Soil | MSLHATHRDAGQVTLVDLSGRIVLGDGSALLRKTIRGLLDDQ |
| Ga0066706_100710815 | 3300005598 | Soil | MALHLTPRDSGLITVVDASGRITLGDGSAMLRKTIRQLVEEAHTN |
| Ga0070763_102602043 | 3300005610 | Soil | MAALFLTSRDDGPITLVDLSGRIALGEGSALLRKTIRDLV |
| Ga0066903_1014257941 | 3300005764 | Tropical Forest Soil | MALRATNREAGQVTVVELGGRITLGDGSALLRKTIRGLL |
| Ga0066665_103210434 | 3300006796 | Soil | MSLHATHRDAGQVTVVDLSGRIVLGDGSALLRKTIRG |
| Ga0099794_100996333 | 3300007265 | Vadose Zone Soil | MSLHATHRDAGKVTVVELSGRITLGEGSALLRKTIRG |
| Ga0099794_104799141 | 3300007265 | Vadose Zone Soil | MALHATHRDAGKVTVVDLSGRITLGDGSALLRKTVRG |
| Ga0105243_127455342 | 3300009148 | Miscanthus Rhizosphere | MALHATYRDVGQVTVVDLGGRITLGDGSALLRKTV |
| Ga0116134_11592242 | 3300009764 | Peatland | MPALYATTREVGIIALVDLSGRIALGEGSALLRKTIRDLLDSGN |
| Ga0126373_107060791 | 3300010048 | Tropical Forest Soil | MELRVTYRDVGVITVVDLGGRITLGEGSSLLRKTIRE |
| Ga0074046_108462521 | 3300010339 | Bog Forest Soil | MHLRATHRDAGQSTVVDLSGKITLGEGSALLRKTVR |
| Ga0074044_101439923 | 3300010343 | Bog Forest Soil | MQALYATTREVGVITLVDLSGRIALGEGSALLRKTIRELL |
| Ga0126376_121008622 | 3300010359 | Tropical Forest Soil | MALHATYRDVGQVTVVDLGGRIVLGDGSALLRKTVK |
| Ga0126372_105494541 | 3300010360 | Tropical Forest Soil | MVMRATYRDAGAVTVVDIGGRITLGEGSALLRTTIK |
| Ga0126372_129148561 | 3300010360 | Tropical Forest Soil | MALHLTPRDSGAITIVDASGRITLGDGSANLRKTI |
| Ga0126378_118422742 | 3300010361 | Tropical Forest Soil | MALRATHRDAGPITVVDLSGRITLGDGSALLRKTI |
| Ga0126377_107679393 | 3300010362 | Tropical Forest Soil | MALHATYRDVGQVTVVDMGGRITLGDGSALLRKTVRQLLDD |
| Ga0150983_143340622 | 3300011120 | Forest Soil | MALRATHRDAGQSTVVDLSGKITLGEGSALLRKTVRGLL |
| Ga0150983_155820941 | 3300011120 | Forest Soil | MPALYATAREDGVITVVDLSGRIALGEGSALLRKTIR |
| Ga0137391_102431813 | 3300011270 | Vadose Zone Soil | MSLHATNRDVGQVTVVELSGRITLGDGSALLRKTIRGLLEEQ |
| Ga0137365_106634892 | 3300012201 | Vadose Zone Soil | MSLHATYRDSGDVTVVDFGGRIVLGDGSALLRKTVRELI |
| Ga0137360_105594061 | 3300012361 | Vadose Zone Soil | MALHATHRDAGKVTVVDLSGRITLGDGSALLRKTVRGL |
| Ga0137395_103565273 | 3300012917 | Vadose Zone Soil | MALRATYREAAGVTVVDISGRITLGEGSALLRKTI |
| Ga0137410_106387172 | 3300012944 | Vadose Zone Soil | MPSLFATTRENSGITLVDLSGRISLGDGSALLRKTVRD |
| Ga0126375_102031421 | 3300012948 | Tropical Forest Soil | MALHATYRDVGQVTVVDLGGRITLGDGSALLRKTVKQLLDDNR |
| Ga0126375_105377081 | 3300012948 | Tropical Forest Soil | MALHATYRDVGQVTVVDLGGRIVLGDGSALLRKTV |
| Ga0134087_107698101 | 3300012977 | Grasslands Soil | MALHLTPRDSGLITVVDASGRITLGDGSAMLRKTIRQLV |
| Ga0137405_11140331 | 3300015053 | Vadose Zone Soil | MALHLTPRDSGLITVVDASGRITLGDGSAMLRKTIRQLVEE |
| Ga0137405_13415451 | 3300015053 | Vadose Zone Soil | MDLRATYRDADAGVVTVVDIGGRITLGEGSALLRKTIRELLEDS |
| Ga0137420_13551331 | 3300015054 | Vadose Zone Soil | MALRATYREAAGVTVVDIGGLDIGGRITLGEGSALLRKT |
| Ga0182033_100314744 | 3300016319 | Soil | MALHATYRDVGQVTVVELGGRITLGDGSALLRKTVRQLLDDNRTR |
| Ga0187782_111357431 | 3300017975 | Tropical Peatland | MPALFLTLREVGPVTIVDLSGKIALGEGSALLRKTIRDLLD |
| Ga0187767_100557283 | 3300017999 | Tropical Peatland | MPALFLTLREDGQVTIVDLSGRISLGEGSALLRKTIRD |
| Ga0187887_105958361 | 3300018043 | Peatland | MPALYATTREVGVITLIDLSGRIALGEGSALLRKTIRDLL |
| Ga0187766_108803601 | 3300018058 | Tropical Peatland | MPALYMTLREDGPVTIVDVSGRISLGEGSAMLRKTIRDLLES |
| Ga0187771_101756623 | 3300018088 | Tropical Peatland | MPALFATCREVGPVTIIDLSGKISLGEGSALLRRTIRELLD |
| Ga0187798_11949772 | 3300019275 | Peatland | MAPALFLTQREVGPVTIVDLSGRISLGEGSALLRK |
| Ga0187800_10880221 | 3300019278 | Peatland | MPALFLTLREDGRVTIVDLSGRIALGEGSALLRKT |
| Ga0187800_15697072 | 3300019278 | Peatland | MPALYATTREVGAITLIDLSGRISLGEGSALLRKTIRDLLENE |
| Ga0187797_14919381 | 3300019284 | Peatland | MPALYATTREVGVITLVDLSGRIALGEGSALLRKTIRDLLD |
| Ga0179592_100902761 | 3300020199 | Vadose Zone Soil | MSLHATHRDAGKVTVVDLSGRIVLGDGSALLRTTIR |
| Ga0210403_110774301 | 3300020580 | Soil | MPLRATHRDAGQSTVVDLSGKITLGEGSALLRKTIRGLLDDKR |
| Ga0210395_112080422 | 3300020582 | Soil | MVMRATYRDAGEVTVVDIGGRITLGEGSALLRSTIK |
| Ga0215015_104260201 | 3300021046 | Soil | MFLRANHRDAGQVTVDDFSARITLADGSALLRKMIRGFLDCLL |
| Ga0179596_105057941 | 3300021086 | Vadose Zone Soil | MALHLTPRDSGLITVVDASGRITLGDGSAMLRKTI |
| Ga0210388_110854511 | 3300021181 | Soil | MPSLYSTTRETGSIILVDLSGRIALGEGSALLRKT |
| Ga0210397_104825553 | 3300021403 | Soil | MVMRATYRDAGEVTVVDIGGRITLGEGSALLRSTI |
| Ga0210391_107085821 | 3300021433 | Soil | MPLRATHRDASQATVVDLSGKITLGEGSALLRKTIRGLLDDKRI |
| Ga0210398_109175691 | 3300021477 | Soil | MRATYRDAGVATVVDIGGRITLGEGSALLRTTIKD |
| Ga0210402_107145042 | 3300021478 | Soil | MPSLFATTREHSGITLVDLSGRISLGDGSALLRKTVRDLLE |
| Ga0210410_115188772 | 3300021479 | Soil | MSLHATHRDAGEVTVVDLSGRIILGDGSALLRKTIRGLLE |
| Ga0210409_102562581 | 3300021559 | Soil | MPSLFATTREYSGITLVDLSGRISLGDGSALLRKTVRDLLD |
| Ga0210409_109460313 | 3300021559 | Soil | MALRATYREAEGVTVVDIGGRITLGEGSALLRKTIR |
| Ga0210409_111940292 | 3300021559 | Soil | MPSLYSTTRETGSIILVDLSGRIALGEGSALLRKTVRDILDSGH |
| Ga0242645_10176451 | 3300022501 | Soil | MALRATHRDAGQSTVVDLSGKITLGEGSALLRKTVR |
| Ga0222728_10658791 | 3300022508 | Soil | MALRATYREAAGVTVVDIGGRITLGEGSALLRKTIR |
| Ga0242652_10169871 | 3300022510 | Soil | MPSLFATTREYSGITLVDLSGRISLGDGSALLRKTVRDLLEE |
| Ga0242676_10334131 | 3300022512 | Soil | MPLRATHRDASQATVVDLSGKITLGEGSALLRKTIRGLL |
| Ga0242660_11534751 | 3300022531 | Soil | MPSLFATTREHSGITLVDLSGRISLGDGSALLRKTVRDLLEE |
| Ga0242655_101721901 | 3300022532 | Soil | MHLRATHRDAGQSTVVDLSGKITLGEGSALLRKTVRGLLDDKR |
| Ga0242665_102192801 | 3300022724 | Soil | MPSLFATTREYSGITLVDLSGRISLGDGSALLRKTV |
| Ga0242654_101488693 | 3300022726 | Soil | MALHATHREAGIVTVVDLSGRIVLGDGSALLRKTIR |
| Ga0242654_102906182 | 3300022726 | Soil | MALHATHREAGIVTVVDLSGRIVLGDGSALLRKTIRGLL |
| Ga0247694_10221541 | 3300024178 | Soil | MPLHATHRDAGQATVVDLSGKITLGEGSALLRKTVR |
| Ga0179589_100181335 | 3300024288 | Vadose Zone Soil | MALHATHRDAGIVTVVDLSGRIVLGDGSALLRKTIRGLLDDE |
| Ga0247667_10118041 | 3300024290 | Soil | MALRATHRDAGQATVVDLSGKITLGEGSALLRKTVR |
| Ga0247666_10210591 | 3300024323 | Soil | MALHLTPRDSGLITVVDASGRITLGDGSAMLRKTIRQLVDEA |
| Ga0207685_101379501 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLHATYRDSGDVTVVDLGGRIVLGDGSALLRKTV |
| Ga0207693_108397542 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPALYATAREDGVITVVDLSGRIALGEGSALLRKTIRDLL |
| Ga0207646_108258502 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLQVTYRDSGTVTVVDFGGRIVLGDGSALLRKTVRQLLDDNRM |
| Ga0207646_109857142 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VCAMSLHATYRDSGSVTVVDMGGRIVLGDGSALLRKTIGQL |
| Ga0257156_10685351 | 3300026498 | Soil | MALHLTPRDSGIITVVDASGRITLGDGSAMLRKTIRQLLE |
| Ga0257158_10824401 | 3300026515 | Soil | MALHATHREAGIVTVVDLSGRIVLGDGSALLRKTI |
| Ga0209156_100171917 | 3300026547 | Soil | MSLHATHRDAGPVTVVDLSGRIVLGDGSALLRKTIR |
| Ga0179587_104312813 | 3300026557 | Vadose Zone Soil | MSLQCTVRDAGSVTVVDFSGKITLGEGSALSARRF |
| Ga0209418_10683371 | 3300027371 | Forest Soil | MAALFATIREVDEITIVDLSGRISLGEGSALLRKTVRDLLE |
| Ga0209004_10024993 | 3300027376 | Forest Soil | MPSLFATTREYSGITLVDLSGRISLGDGSALLRKT |
| Ga0209115_11363161 | 3300027567 | Forest Soil | MALRATHRDAGQSTIVDLSGKITLGEGSALLRKTV |
| Ga0209117_10975481 | 3300027645 | Forest Soil | VCAMSLHATYRDSGSVTVVDMGGRIVLGDGSALLRKTIGQLLDDER |
| Ga0209040_101854893 | 3300027824 | Bog Forest Soil | MPSLFATTREFSGITLVDLSGRISLGDGSALLRKTVR |
| Ga0137415_112721942 | 3300028536 | Vadose Zone Soil | VCALSLHATYRDAGAVTVVDLGGRIVLGDGSALLRKTIRSLMDSDRTKI |
| Ga0308309_117733422 | 3300028906 | Soil | MPLRATHRDASQATVVDLSGKITLGEGSALLRKTIRGLLDD |
| Ga0302184_102777311 | 3300030490 | Palsa | MDLRVTYRDAGPITVVDIGGRITLGEGSALLRKTIRDLLEDQRV |
| Ga0210255_102762901 | 3300030589 | Soil | MALRATHRDAGQATVVDLSGKITLGEGSALLRKTV |
| Ga0210268_12084941 | 3300030629 | Soil | MALRATYRDAGQSTVVDLSGKITLGEGSALLRKTVRGLL |
| Ga0265459_131397482 | 3300030741 | Soil | MALRATHRDAAQATVVDLSGKITLGEGSALLRKTIRGLLDDKRIH |
| Ga0075401_118137682 | 3300030935 | Soil | VCAMSLHATYRDSGSVTVVDMGGRIVLGDGSALLRKTIGQLLDDQRTKIL |
| Ga0170834_1084182542 | 3300031057 | Forest Soil | MALLQATYRDAGAVTVLDLSGRITLGEGSALLRSTIR |
| Ga0170834_1110912781 | 3300031057 | Forest Soil | MALHATHRDAGIVTVVDLSGRIVLGDGSALLRKTIRGLLDDQRKL |
| Ga0170822_102825991 | 3300031122 | Forest Soil | MALRATHRDAAQATVVDLSGKITLGEGSALLRKRIKE |
| Ga0170823_115798811 | 3300031128 | Forest Soil | MSAMSLHATYRDSGDVTVVDLGGRIVLGDGSALLRNTVRKLLEEKN |
| Ga0170820_123298173 | 3300031446 | Forest Soil | MPSLFATTREYSGITLVDLSGRISLGDGSALLRKTVRDLLE |
| Ga0307469_110913701 | 3300031720 | Hardwood Forest Soil | MSLHATYRDSGDVTVVDLGGRIVLGDGSALLRKTVRELIDDNR |
| Ga0306918_109330082 | 3300031744 | Soil | MAALYATIREVERITIVDLSGRISLGEGSALLRKTVRD |
| Ga0306919_115397221 | 3300031879 | Soil | MAVLYATIREVDVITIVDLSGRISLGEGSALLRKTVRDLLE |
| Ga0306925_115834082 | 3300031890 | Soil | MPTLFMTLREEGAVTIVDVSGRISLGEGSALLRKTIRDLLDSGQ |
| Ga0310913_102104303 | 3300031945 | Soil | MALHATYRDSGSVTVVDLGGRIVLGDGSALLRKTVRELL |
| Ga0307479_114601771 | 3300031962 | Hardwood Forest Soil | MMSLHATHRDAGQVTVVDLSGRITLGDGSALLRKTIR |
| Ga0307472_1019331741 | 3300032205 | Hardwood Forest Soil | MALHLTPRDSGTITVVDASGRITLGDGSANLRKTI |
| Ga0335081_117434122 | 3300032892 | Soil | MSLRATHRDAGPVIVVDLSGRIILGEGSALLRKTV |
| Ga0335076_100837041 | 3300032955 | Soil | MALHATPREVGRITVVDLGGRITLGEGSALLRKTIRALLEDE |
| Ga0335077_101171521 | 3300033158 | Soil | MAVLFATCREVGPVTIVDLSGKISLGEGSALLRKTVRELLDGGQ |
| Ga0314864_0094487_606_725 | 3300033805 | Peatland | MPTLFATCREVGSEVGSVAIVDLSGRISLGDGSALLRKTV |
| ⦗Top⦘ |