| Basic Information | |
|---|---|
| Family ID | F081069 |
| Family Type | Metagenome |
| Number of Sequences | 114 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSDRQWIIFNQLGGAEWLRTFLEKKAPMPKQYYDKLLQEKQND |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 50.00 % |
| % of genes near scaffold ends (potentially truncated) | 6.14 % |
| % of genes from short scaffolds (< 2000 bps) | 9.65 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (92.105 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (33.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.053 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (69.298 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.89% β-sheet: 0.00% Coil/Unstructured: 52.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF11753 | DUF3310 | 28.07 |
| PF00462 | Glutaredoxin | 9.65 |
| PF13640 | 2OG-FeII_Oxy_3 | 6.14 |
| PF12705 | PDDEXK_1 | 3.51 |
| PF08774 | VRR_NUC | 2.63 |
| PF01612 | DNA_pol_A_exo1 | 1.75 |
| PF06048 | DUF927 | 1.75 |
| PF00476 | DNA_pol_A | 1.75 |
| PF01870 | Hjc | 0.88 |
| PF03237 | Terminase_6N | 0.88 |
| PF13489 | Methyltransf_23 | 0.88 |
| PF04545 | Sigma70_r4 | 0.88 |
| PF12728 | HTH_17 | 0.88 |
| PF00271 | Helicase_C | 0.88 |
| PF01096 | TFIIS_C | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 1.75 |
| COG5519 | Predicted ATPase domain of Cch-like helicases, DUF927 family | General function prediction only [R] | 1.75 |
| COG1591 | Holliday junction resolvase Hjc, archaeal type | Replication, recombination and repair [L] | 0.88 |
| COG1594 | DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS | Transcription [K] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 92.11 % |
| All Organisms | root | All Organisms | 7.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003491|JGI25924J51412_1076264 | Not Available | 508 | Open in IMG/M |
| 3300009152|Ga0114980_10005520 | Not Available | 8375 | Open in IMG/M |
| 3300009158|Ga0114977_10088918 | All Organisms → Viruses → Predicted Viral | 1882 | Open in IMG/M |
| 3300009180|Ga0114979_10093039 | All Organisms → Viruses → Predicted Viral | 1866 | Open in IMG/M |
| 3300010160|Ga0114967_10026777 | All Organisms → Viruses → Predicted Viral | 3929 | Open in IMG/M |
| 3300010885|Ga0133913_12558818 | All Organisms → Viruses → Predicted Viral | 1241 | Open in IMG/M |
| 3300011115|Ga0151514_10243 | Not Available | 26824 | Open in IMG/M |
| 3300011334|Ga0153697_1020 | Not Available | 55290 | Open in IMG/M |
| 3300012012|Ga0153799_1100500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 514 | Open in IMG/M |
| 3300013004|Ga0164293_10141419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1798 | Open in IMG/M |
| 3300013372|Ga0177922_10087826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 625 | Open in IMG/M |
| 3300019784|Ga0181359_1000201 | Not Available | 12540 | Open in IMG/M |
| 3300019784|Ga0181359_1245994 | Not Available | 546 | Open in IMG/M |
| 3300027760|Ga0209598_10075898 | Not Available | 1643 | Open in IMG/M |
| 3300027770|Ga0209086_10015857 | All Organisms → Viruses → Predicted Viral | 4886 | Open in IMG/M |
| 3300033996|Ga0334979_0103150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1773 | Open in IMG/M |
| 3300034012|Ga0334986_0047843 | Not Available | 2733 | Open in IMG/M |
| 3300034012|Ga0334986_0223413 | Not Available | 1039 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 33.33% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 17.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.26% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.26% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.51% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.63% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.75% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.75% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.75% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.88% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.88% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.88% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.88% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010233 | Filterable freshwater microbial communities from Conwy River, North Wales, UK. Fraction, filtered through 0.2 um filter. After WGA. | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25924J51412_10762642 | 3300003491 | Freshwater Lake | PLIGRQVRMSDRHWIIFNQLGGAEWLRQMIVKKMPMPKKFYDELLKEKEGAK* |
| Ga0007787_102908283 | 3300004240 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRTIITKKAPMPKQYYDALLQEKPNDSKSR* |
| Ga0068876_106354052 | 3300005527 | Freshwater Lake | MSDRQWIILNQLGGAEWLRAILDKKAPMPKQYYDKLLQEQKND* |
| Ga0049081_103375682 | 3300005581 | Freshwater Lentic | MSDRQWIIFNQLGGAEWLRTIITKKAPMPKQYYDALLQEKSNDSKSR* |
| Ga0070749_104617041 | 3300006802 | Aqueous | MSDRHWLIFKQLGGAEWLREILDKKAPMPKKYYDV |
| Ga0075472_103905773 | 3300006917 | Aqueous | MSDRHWLIFKQLGGAEWLREILDKKAPMPKKYYDVFLKEQK* |
| Ga0102978_13191026 | 3300007177 | Freshwater Lake | MILKQLGGMDWLRSTLDKKAPMPKGYYDKLLQEQKHD* |
| Ga0102828_10055043 | 3300007559 | Estuarine | MFNQIGGADWLRKLVEKKAPMPKQYYDALLKKQNEGV* |
| Ga0105745_11477431 | 3300007972 | Estuary Water | MSDRQWIIFNQLGGAEWLRGFLEKKAPMPKQYYDNELARINNPADAA |
| Ga0105746_10176104 | 3300007973 | Estuary Water | MSDRQWIIFNELGGAEWLRGFLEKKAPMPKQYYDKLLQEKQND* |
| Ga0105746_12144013 | 3300007973 | Estuary Water | MSDRQWIMFNEIGGADWLRKLVEKKAPMPKQYYDALLKKQNEGF* |
| Ga0114343_10088703 | 3300008110 | Freshwater, Plankton | MSDRHWIIFNQLGGAEWLRQMIVKKTPMPKKYYDELLKEKEGAK* |
| Ga0114363_10275945 | 3300008266 | Freshwater, Plankton | MSDRQWIILNQLGGAEWLRNILDKKAPMPKQYYDKLLQEKQND* |
| Ga0114363_12015281 | 3300008266 | Freshwater, Plankton | GRQVRMSDRHWIIFNQLGGAEWLRQMIVKKTPMPKKYYDELLKEKEGAK* |
| Ga0114364_10694411 | 3300008267 | Freshwater, Plankton | MSDRHWIIFNQLGGAEWLRQTIVKKTPMPKKFYDELLKEKESAK* |
| Ga0114876_10921742 | 3300008448 | Freshwater Lake | MFNELGGADWLRKLVEKKAPMPKQYYDKLLQEQKND* |
| Ga0114876_11027684 | 3300008448 | Freshwater Lake | MSDRQWIILNQLGGAEWLRAILDKKAPMPKKYYDKLLQEQKK* |
| Ga0102831_10528733 | 3300008996 | Estuarine | MSDRQWIMFNEIGGADWLRKLVEKKAPMPKQYYDALLKKQNEGV* |
| Ga0114980_100055209 | 3300009152 | Freshwater Lake | MSDRHWIIFNQLGGAEWLRQMIVKKTPMPKKYYDDLLKEKEGAK* |
| Ga0114968_103416791 | 3300009155 | Freshwater Lake | RMSDRQWIMFNQLGGADWLRKLVEKKAPMSKQYYDAILNKEKLND* |
| Ga0114977_100889186 | 3300009158 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRTIITKKAPMPKQYYDKLLQEKLND* |
| Ga0114978_101148422 | 3300009159 | Freshwater Lake | MSDRQWMIFNQLGGADWLRGLLEKKAPMPKKYYATFLKQRKGEIND* |
| Ga0114978_108618592 | 3300009159 | Freshwater Lake | MSDRQWIILNQLGGAEWLRGLLDKKAPMPKKYYDKLLQGEKND* |
| Ga0114966_100206164 | 3300009161 | Freshwater Lake | MGKQVRMSDRHWIIFNHLGGAQWLRELLDKKDPFPKKYYDKLLQEKQND* |
| Ga0114970_100709762 | 3300009163 | Freshwater Lake | MSDRQWIMFNELGGADWLRKFVEKKAPMPKQYYDKLLQEQQNERT* |
| Ga0114979_100930391 | 3300009180 | Freshwater Lake | MSDRQWIILNQLGGAEWLRGLLDKKAPMPKQYYDALLK |
| Ga0114972_100537151 | 3300009187 | Freshwater Lake | MSDRHWMILQQLGGAEWLRNILDKKAPMPKKYYLKESKD* |
| Ga0114964_104855621 | 3300010157 | Freshwater Lake | WIMFNELGGADWLRKFVEKKAPMPKQYYDKLLQEQQNERT* |
| Ga0114967_100187899 | 3300010160 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRDILDKKAPMPKQYYDKLLQEKQND* |
| Ga0114967_100267773 | 3300010160 | Freshwater Lake | MFNQLGGADWLRKLVEKKAPMSKQYYDAILNKEKLND* |
| Ga0136235_10291201 | 3300010233 | Freshwater | ARYVRLADNHWLIFKQLGGAEWLRTTLDKKAPMPKQYYDVFTGETK* |
| Ga0133913_1050096310 | 3300010885 | Freshwater Lake | MSDRQWIIFNQLGGADWLRTIITKKAPMPKQYYDALLQEKPNDSKSR* |
| Ga0133913_105079923 | 3300010885 | Freshwater Lake | MSDRQWIILNQLGGAEWLRGLLDKKAPMPKQYYDALLKEQTNGSNT* |
| Ga0133913_123829601 | 3300010885 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRTIITKKAPMPKQYYDAL |
| Ga0133913_125588181 | 3300010885 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRTIITKKAPMPKQYYDALLQEKTK* |
| Ga0133913_135870052 | 3300010885 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRGFLEKKAPMPKQYYDALLKEQNERT* |
| Ga0139557_100036712 | 3300011010 | Freshwater | MSDRQWIMFNEIGGANWLRKLVEKKAPMPKQYYDALLKKQNEGV* |
| Ga0139556_10301002 | 3300011011 | Freshwater | MSDRHWIIFNQLGGAEWLRQMIVKKMPMPKKFYDELLKEKEGAK* |
| Ga0151514_1024311 | 3300011115 | Freshwater | MFNELGGADWLRKLVEKKALMPKQYYDKLLQEQKND* |
| Ga0151620_12087353 | 3300011268 | Freshwater | MSDRHWLILQQLGGAEWLRTILDKKAPMPKQYYDNELARM |
| Ga0153697_102048 | 3300011334 | Freshwater | MSDRQWIILNQLGGAEWLRNILDKKAPMPKQYYDKLLQEQKND* |
| Ga0153799_11005002 | 3300012012 | Freshwater | MSDRQWIIFNELGGAEWLRGFLEKKAPMPKQYYDKLLQEKRND* |
| Ga0164293_101414195 | 3300013004 | Freshwater | MSDRQWIIFNQLGGAEWLRTFLEKKAPMPKQYYDNELARI |
| Ga0164293_104402723 | 3300013004 | Freshwater | SDRHWIIFNQLGGAEWLRQMIVKKTPMPKKFYDELLKEKEGAK* |
| Ga0177922_100878263 | 3300013372 | Freshwater | MSDRQWIIFNELGGAEWLRGFLEKKAPMPKQYYDKLLQEQQNH* |
| Ga0177922_107720606 | 3300013372 | Freshwater | MSDRQWIIFNQLGGAEWLRGFLEKKAPLPKKYYDELLKEQNERT* |
| Ga0119960_10265661 | 3300014811 | Aquatic | MSDRQWIIFNQLGGAEWLRTFLEKKAPMPKQYYDNELARLQDPADRDWE |
| Ga0181338_10235752 | 3300015050 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRGFLEKKTPMPKQYYDALLKEQNERT* |
| Ga0181338_10391331 | 3300015050 | Freshwater Lake | MSDRQWIIFNELGGAEWLREFLEKKAPMPKQYYDKLLQEKQND* |
| Ga0181338_10487794 | 3300015050 | Freshwater Lake | MSDRQWIILNHLGGAEWLRELLDKKDPFPKKYYDAVL |
| Ga0181338_10597162 | 3300015050 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRGFLEKKAPMPKKYYDELLKEQNERT* |
| Ga0181339_10075894 | 3300017700 | Freshwater Lake | GRQIRMSDRQWIIFNQLGGAEWLRGFLEKKAPMPKQYYDALLKEQNERT |
| Ga0181339_10242663 | 3300017700 | Freshwater Lake | GRQVRMSDRQWIIFNQLGGAEWLRQMIVKKMPMPKKFYDELLKEKEGAK |
| Ga0181339_10362551 | 3300017700 | Freshwater Lake | GRQVRMSDRQWIIFNQLGGAEWLRQMIVKKTPMPKKYYDELLKEKGGAN |
| Ga0181364_10150245 | 3300017701 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRTIITKKAPMPKQYSFP |
| Ga0181350_10365275 | 3300017716 | Freshwater Lake | WIILNQLGGAEWLRAILDKKAPMPKQYYDKLLQEQKND |
| Ga0181347_10432465 | 3300017722 | Freshwater Lake | MSDRQWIILNHLGGAEWLRELLDKKDPFPKKYYDAVLKTG |
| Ga0181362_10050951 | 3300017723 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRTIITKKAPMPKQYSSS |
| Ga0181362_10286671 | 3300017723 | Freshwater Lake | RMSDRQWIIFNELGGAEWLRGFLEKKAPMPKQYYDKLLQEKQND |
| Ga0181365_11437143 | 3300017736 | Freshwater Lake | EPITFRNIRMSDRQWIIFNELGGAEWLREFLEKKAPMPKQYYDKLLQEKQND |
| Ga0181352_11114481 | 3300017747 | Freshwater Lake | RMSDRQWIIFNQLGGAEWLRTIITKKAPMPKQYYDALLQEKPNDSKSR |
| Ga0181344_11629102 | 3300017754 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRQIITKKAPMPKQYYDQLLKEQNERT |
| Ga0181356_11483971 | 3300017761 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRGFLEKKAPMPKQYYDALLKEQNERT |
| Ga0181356_12285331 | 3300017761 | Freshwater Lake | HWIIFNQLGGAEWLRQMIVKKMPMPKKFYDELLKEKEGAK |
| Ga0181357_11702692 | 3300017777 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRGFLEKKTPMPKQYYDALLKEQNERT |
| Ga0181349_11608774 | 3300017778 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRQMIVKKTPMPKKFYDELLKEKEGAK |
| Ga0181346_11190571 | 3300017780 | Freshwater Lake | MSDRQWIIFNQLGGADWLRTTITKKAPMPKQYYDALLQEKPNDSKSR |
| Ga0181346_13387543 | 3300017780 | Freshwater Lake | IIFNELGGAEWLRGFLEKKAPMPKQYYDKLLQEKQND |
| Ga0181348_10703574 | 3300017784 | Freshwater Lake | IILNQLGGAEWLRGFLEKKAPMPKQYYDKLLQEKQND |
| Ga0181348_12623932 | 3300017784 | Freshwater Lake | MSDRQWIIFNQLGGADWLRTTITKKAPMPKQYYDALLKEQSHGSNT |
| Ga0181359_100020110 | 3300019784 | Freshwater Lake | MSDRQWIIFNELGGAEWLREFLEKKAPMPKQYYDKLLQEKQND |
| Ga0181359_10518375 | 3300019784 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRTIITKKAPMPKQYSLTHY |
| Ga0181359_12459943 | 3300019784 | Freshwater Lake | EPLVGRQVRMSDRQWLIFNQLGGAEWLRCTLNKKAPMPKQYYDALLQEKTK |
| Ga0211731_102761051 | 3300020205 | Freshwater | RQWIIFNQLGGAEWLREFLEKKAPMPKQYYDKLFQEQKND |
| Ga0222715_105933331 | 3300021960 | Estuarine Water | SDRQWIILNQLGGAEWLRAILDKKAPMPKQYYDKLLQEQKND |
| Ga0181353_11215413 | 3300022179 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRQMIVKKTPMPKKYYDELLKEKGGAN |
| Ga0181354_10002474 | 3300022190 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRTIITKKAPMPKKYYDALLQEKPNDSKSR |
| Ga0181354_11731853 | 3300022190 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRGFLEKKAPMPKKYYDELLKEQNERT |
| Ga0181351_10679961 | 3300022407 | Freshwater Lake | APLKVRYVRLSDKQWIIFKQLGGLEWLRETLDKKAPMPKQYYDALLQEKQND |
| Ga0181351_12481511 | 3300022407 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRGFLEKKAPMPKQYYDNELARI |
| Ga0209769_11528421 | 3300027679 | Freshwater Lake | IIFNQLGGAEWLRQTIVKKTPMPKKYYDELLKEKESAK |
| Ga0209297_11665372 | 3300027733 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRTIITKKAPMPKQYYDKLLQEKLND |
| Ga0209598_100758985 | 3300027760 | Freshwater Lake | RHWMILQQLGGAEWLRNILDKKAPMPKKYYLKESKD |
| Ga0209134_102329731 | 3300027764 | Freshwater Lake | RMSDRQWIIFNQLGGAEWLRQMIVKKTPMPKKYYDELLKEKGGAN |
| Ga0209086_100158579 | 3300027770 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRDILDKKAPMPKQYYDKLLQEKQND |
| Ga0209229_102207472 | 3300027805 | Freshwater And Sediment | MSDRQWIIFNQLGGAEWLRQMIVKKTPMPKKYYDELLKEKGGAK |
| Ga0209354_101213763 | 3300027808 | Freshwater Lake | MSDRQWIILNQLGGAEWLRAILDKKAPMPKQYYDKLLQEQKND |
| Ga0209990_100088997 | 3300027816 | Freshwater Lake | MSDRQWIIFNQLGGAEWLRTIITKKAPMPKQYYDALLQEKPNDSKSR |
| Ga0247723_11061533 | 3300028025 | Deep Subsurface Sediment | IIFNQLGGAEWLRQMIVKKTPMPKKFYDELLKEKEGAK |
| (restricted) Ga0247843_12441032 | 3300028569 | Freshwater | MSDRQWMIFNQLGGAEWLRGFLEKKAPMPKQYYDKLLQEKQND |
| Ga0307377_109191123 | 3300031673 | Soil | RQFAVLNHLGGAEWLRKLLDKKDPLPRKYYDARKESKE |
| Ga0315297_116793682 | 3300031873 | Sediment | MSDRQWIIFNQLGGAEWLRQIIVKKTPMPKQYYDELLKEQNERT |
| Ga0315901_109499622 | 3300031963 | Freshwater | MSDRQWIILNQLGGAEWLRNILDKKAPMPKQYYDKLLQEKQND |
| Ga0315274_1001008812 | 3300031999 | Sediment | LSDRQWIIFKQLGGLEWLRETLDKKAPMPKQYYDALLEKTK |
| Ga0315289_108588361 | 3300032046 | Sediment | RYVRLSDRQWIIFKQLGGLEWLRETLDKKAPMPKQYYDALLEKTK |
| Ga0315268_121317761 | 3300032173 | Sediment | PIAFRNIRMSDRQWIIFNQLGGADWLRAFLEKKAPMPKQYYDALLQEKTK |
| Ga0315271_116909823 | 3300032256 | Sediment | MSDRQWIIFNQLGGADWLRAFLEKKAPMPKQYYDALLHEKTK |
| Ga0334722_105276441 | 3300033233 | Sediment | MSDRQWIIFNQLGGADWLRTIITKKAPMPKQYYDALLQEKP |
| Ga0334982_0074473_62_196 | 3300033981 | Freshwater | LSDREWLIFKQLGGAEWLRETLDKKAPMPKQYYDNFLQPTKEIK |
| Ga0334994_0413956_474_617 | 3300033993 | Freshwater | MSDRQWIIFNQLGGAEWLRTIITKKTPMPKKYYDALLQEKPNDSKSR |
| Ga0335003_0246003_15_158 | 3300033995 | Freshwater | MSDRQWIIFNQLGGAEWLRTIITKKTPMPKQYYDALLQEKPNDSKSR |
| Ga0334979_0103150_1_132 | 3300033996 | Freshwater | MSDRQWIIFNQLGGAEWLRTFLEKKAPMPKQYYDNELARINNPA |
| Ga0334986_0047843_1167_1295 | 3300034012 | Freshwater | MSDRQWIIFNQLGGADWLRVFLEKKAPMPKQYYDALLKEKTK |
| Ga0334986_0223413_564_692 | 3300034012 | Freshwater | MSDRHWVIFKQLGGAEWLRELLEKKAPMPKQYYDTLLQEKTK |
| Ga0334986_0451820_436_570 | 3300034012 | Freshwater | MSDRHWIIFNQLGGAEWLRQTIVKKTPMPKKYYDELLKEKESAK |
| Ga0335002_0506215_411_542 | 3300034020 | Freshwater | MSDRQWIIFNQLGGAEWLRTFLEKKAPMPKQYYDKLLQEKQND |
| Ga0335005_0255181_506_634 | 3300034022 | Freshwater | MSDRQWIIFNELGGAEWLRGFLEKKAPMPKQYYDKLLQEKLK |
| Ga0335010_0422716_34_165 | 3300034092 | Freshwater | MSDRQWIIFNELGGAEWLRGFLEKKAPMPKQYYDKLLQEKQND |
| Ga0335030_0034614_2516_2659 | 3300034103 | Freshwater | MSDRQWIIFNQLGGAEWLRTIITKKTPMPKQYYDALLQEKSNDSKSR |
| Ga0335063_0420313_549_668 | 3300034111 | Freshwater | MDRQWIIFNQLGGAEWLRTFLEKKAPMPKQYYDNELARI |
| Ga0335056_0079654_2_124 | 3300034120 | Freshwater | MSDRQWIILNQLGGAEWLRGLLDKKAPMPKKYYDNELARLK |
| Ga0335039_0222331_467_601 | 3300034355 | Freshwater | MSDRQWIIFNQLGGAEWLRQMIVKKTPMPKKYYDELLKEKEGAK |
| Ga0335039_0381295_614_727 | 3300034355 | Freshwater | IFNQLGGAEWLRQMIVKKTPMPKKFYDELLKEKEGAK |
| Ga0335048_0301798_696_830 | 3300034356 | Freshwater | RQWIIFNQLGGAEWLRTIITKKTPMPKQYYDALLQEKPNDSKSR |
| ⦗Top⦘ |