| Basic Information | |
|---|---|
| Family ID | F081057 |
| Family Type | Metagenome |
| Number of Sequences | 114 |
| Average Sequence Length | 42 residues |
| Representative Sequence | FTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.75 % |
| % of genes near scaffold ends (potentially truncated) | 93.86 % |
| % of genes from short scaffolds (< 2000 bps) | 89.47 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.877 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.175 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.439 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.123 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.84% β-sheet: 0.00% Coil/Unstructured: 67.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF10099 | RskA | 6.14 |
| PF01548 | DEDD_Tnp_IS110 | 2.63 |
| PF02371 | Transposase_20 | 1.75 |
| PF01565 | FAD_binding_4 | 1.75 |
| PF13538 | UvrD_C_2 | 1.75 |
| PF08002 | DUF1697 | 0.88 |
| PF13419 | HAD_2 | 0.88 |
| PF13700 | DUF4158 | 0.88 |
| PF13424 | TPR_12 | 0.88 |
| PF17032 | zinc_ribbon_15 | 0.88 |
| PF13683 | rve_3 | 0.88 |
| PF00069 | Pkinase | 0.88 |
| PF02817 | E3_binding | 0.88 |
| PF12697 | Abhydrolase_6 | 0.88 |
| PF00361 | Proton_antipo_M | 0.88 |
| PF14667 | Polysacc_synt_C | 0.88 |
| PF10686 | YAcAr | 0.88 |
| PF01527 | HTH_Tnp_1 | 0.88 |
| PF05103 | DivIVA | 0.88 |
| PF00296 | Bac_luciferase | 0.88 |
| PF03160 | Calx-beta | 0.88 |
| PF12900 | Pyridox_ox_2 | 0.88 |
| PF13671 | AAA_33 | 0.88 |
| PF01850 | PIN | 0.88 |
| PF00589 | Phage_integrase | 0.88 |
| PF13006 | Nterm_IS4 | 0.88 |
| PF00872 | Transposase_mut | 0.88 |
| PF00392 | GntR | 0.88 |
| PF01494 | FAD_binding_3 | 0.88 |
| PF09586 | YfhO | 0.88 |
| PF00903 | Glyoxalase | 0.88 |
| PF00583 | Acetyltransf_1 | 0.88 |
| PF13359 | DDE_Tnp_4 | 0.88 |
| PF02567 | PhzC-PhzF | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 4.39 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.51 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.75 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.88 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.88 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.88 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.88 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.88 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.88 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.88 |
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.88 % |
| All Organisms | root | All Organisms | 49.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459023|GZGNO2B01AR1Q1 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata obscuriglobus | 500 | Open in IMG/M |
| 3300004268|Ga0066398_10002753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1901 | Open in IMG/M |
| 3300004479|Ga0062595_102690787 | Not Available | 501 | Open in IMG/M |
| 3300004633|Ga0066395_10301689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis balhimycina | 876 | Open in IMG/M |
| 3300005186|Ga0066676_10227729 | Not Available | 1209 | Open in IMG/M |
| 3300005435|Ga0070714_100445239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1230 | Open in IMG/M |
| 3300005436|Ga0070713_101968801 | Not Available | 567 | Open in IMG/M |
| 3300005439|Ga0070711_101661818 | Not Available | 559 | Open in IMG/M |
| 3300005518|Ga0070699_101132160 | Not Available | 718 | Open in IMG/M |
| 3300005540|Ga0066697_10639210 | Not Available | 587 | Open in IMG/M |
| 3300005602|Ga0070762_10302311 | Not Available | 1008 | Open in IMG/M |
| 3300005713|Ga0066905_101277379 | Not Available | 659 | Open in IMG/M |
| 3300006804|Ga0079221_10189674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1116 | Open in IMG/M |
| 3300006903|Ga0075426_10658522 | Not Available | 784 | Open in IMG/M |
| 3300006954|Ga0079219_12109553 | Not Available | 540 | Open in IMG/M |
| 3300009038|Ga0099829_10496250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1013 | Open in IMG/M |
| 3300009094|Ga0111539_11108431 | Not Available | 920 | Open in IMG/M |
| 3300009101|Ga0105247_10379393 | Not Available | 1002 | Open in IMG/M |
| 3300009683|Ga0116224_10380760 | Not Available | 671 | Open in IMG/M |
| 3300010048|Ga0126373_13082500 | Not Available | 519 | Open in IMG/M |
| 3300010333|Ga0134080_10625016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300010341|Ga0074045_10349679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 964 | Open in IMG/M |
| 3300010358|Ga0126370_10451016 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300010359|Ga0126376_10288030 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300010360|Ga0126372_13219526 | Not Available | 507 | Open in IMG/M |
| 3300010361|Ga0126378_10808380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1047 | Open in IMG/M |
| 3300010361|Ga0126378_12857645 | Not Available | 551 | Open in IMG/M |
| 3300010398|Ga0126383_10517377 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300010398|Ga0126383_11749374 | Not Available | 710 | Open in IMG/M |
| 3300010398|Ga0126383_12345583 | Not Available | 619 | Open in IMG/M |
| 3300012198|Ga0137364_10103753 | All Organisms → cellular organisms → Bacteria | 2006 | Open in IMG/M |
| 3300012199|Ga0137383_11208955 | Not Available | 543 | Open in IMG/M |
| 3300012201|Ga0137365_10414224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. PSKA30 | 994 | Open in IMG/M |
| 3300012208|Ga0137376_11421534 | Not Available | 584 | Open in IMG/M |
| 3300012210|Ga0137378_10623761 | Not Available | 988 | Open in IMG/M |
| 3300012211|Ga0137377_10667303 | Not Available | 975 | Open in IMG/M |
| 3300012211|Ga0137377_11078519 | Not Available | 733 | Open in IMG/M |
| 3300012360|Ga0137375_10236970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1696 | Open in IMG/M |
| 3300012363|Ga0137390_10467827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → unclassified Bacillus (in: Bacteria) → Bacillus sp. AZ43 | 1236 | Open in IMG/M |
| 3300012917|Ga0137395_10980560 | Not Available | 607 | Open in IMG/M |
| 3300012917|Ga0137395_11294683 | Not Available | 504 | Open in IMG/M |
| 3300012922|Ga0137394_10794772 | Not Available | 793 | Open in IMG/M |
| 3300012971|Ga0126369_13511298 | Not Available | 514 | Open in IMG/M |
| 3300012971|Ga0126369_13564095 | Not Available | 510 | Open in IMG/M |
| 3300014166|Ga0134079_10096321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1123 | Open in IMG/M |
| 3300014493|Ga0182016_10437465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. IgraMP-1 | 767 | Open in IMG/M |
| 3300015373|Ga0132257_102086675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 732 | Open in IMG/M |
| 3300016270|Ga0182036_10627394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 864 | Open in IMG/M |
| 3300016341|Ga0182035_11739105 | Not Available | 564 | Open in IMG/M |
| 3300016387|Ga0182040_11558336 | Not Available | 562 | Open in IMG/M |
| 3300016445|Ga0182038_11000204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 740 | Open in IMG/M |
| 3300016445|Ga0182038_11702711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300017822|Ga0187802_10031209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1891 | Open in IMG/M |
| 3300017926|Ga0187807_1004781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4150 | Open in IMG/M |
| 3300017927|Ga0187824_10367382 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300017932|Ga0187814_10072059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1267 | Open in IMG/M |
| 3300017946|Ga0187879_10793906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 528 | Open in IMG/M |
| 3300017959|Ga0187779_10317488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1000 | Open in IMG/M |
| 3300017993|Ga0187823_10125740 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300017995|Ga0187816_10158329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 981 | Open in IMG/M |
| 3300018001|Ga0187815_10093470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1267 | Open in IMG/M |
| 3300018007|Ga0187805_10207536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 895 | Open in IMG/M |
| 3300018085|Ga0187772_10997370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glauciniger | 612 | Open in IMG/M |
| 3300021404|Ga0210389_10031545 | Not Available | 4072 | Open in IMG/M |
| 3300021439|Ga0213879_10120666 | Not Available | 746 | Open in IMG/M |
| 3300021474|Ga0210390_10883120 | Not Available | 736 | Open in IMG/M |
| 3300021477|Ga0210398_10153974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1871 | Open in IMG/M |
| 3300021560|Ga0126371_10054074 | All Organisms → cellular organisms → Bacteria | 3850 | Open in IMG/M |
| 3300025527|Ga0208714_1018655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1714 | Open in IMG/M |
| 3300025527|Ga0208714_1033989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea solani | 1176 | Open in IMG/M |
| 3300025906|Ga0207699_10082873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1993 | Open in IMG/M |
| 3300025917|Ga0207660_10634972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 870 | Open in IMG/M |
| 3300025922|Ga0207646_10019207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6354 | Open in IMG/M |
| 3300025981|Ga0207640_12058476 | Not Available | 517 | Open in IMG/M |
| 3300026291|Ga0209890_10017875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2789 | Open in IMG/M |
| 3300027775|Ga0209177_10003676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter | 3006 | Open in IMG/M |
| 3300027874|Ga0209465_10646150 | Not Available | 521 | Open in IMG/M |
| 3300027908|Ga0209006_11074920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300028742|Ga0302220_10028079 | Not Available | 2562 | Open in IMG/M |
| 3300028773|Ga0302234_10323858 | Not Available | 661 | Open in IMG/M |
| 3300028773|Ga0302234_10347944 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300028787|Ga0307323_10383709 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Hymenobacter | 503 | Open in IMG/M |
| 3300028793|Ga0307299_10391317 | Not Available | 521 | Open in IMG/M |
| 3300028828|Ga0307312_10028448 | All Organisms → cellular organisms → Bacteria | 3240 | Open in IMG/M |
| 3300028871|Ga0302230_10280899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 645 | Open in IMG/M |
| 3300029944|Ga0311352_10335466 | Not Available | 1252 | Open in IMG/M |
| 3300030399|Ga0311353_10901115 | Not Available | 747 | Open in IMG/M |
| 3300031027|Ga0302308_10743210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
| 3300031546|Ga0318538_10150683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1229 | Open in IMG/M |
| 3300031561|Ga0318528_10238653 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300031564|Ga0318573_10710436 | Not Available | 540 | Open in IMG/M |
| 3300031572|Ga0318515_10766637 | Not Available | 509 | Open in IMG/M |
| 3300031720|Ga0307469_12116267 | Not Available | 547 | Open in IMG/M |
| 3300031747|Ga0318502_10535543 | Not Available | 703 | Open in IMG/M |
| 3300031751|Ga0318494_10333365 | Not Available | 877 | Open in IMG/M |
| 3300031765|Ga0318554_10628522 | Not Available | 604 | Open in IMG/M |
| 3300031768|Ga0318509_10169593 | Not Available | 1209 | Open in IMG/M |
| 3300031770|Ga0318521_10213438 | Not Available | 1118 | Open in IMG/M |
| 3300031779|Ga0318566_10458693 | Not Available | 625 | Open in IMG/M |
| 3300031805|Ga0318497_10453552 | Not Available | 718 | Open in IMG/M |
| 3300031819|Ga0318568_10909712 | Not Available | 544 | Open in IMG/M |
| 3300031860|Ga0318495_10147285 | Not Available | 1062 | Open in IMG/M |
| 3300031879|Ga0306919_11539049 | Not Available | 500 | Open in IMG/M |
| 3300031910|Ga0306923_11535987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 695 | Open in IMG/M |
| 3300031946|Ga0310910_11494016 | Not Available | 518 | Open in IMG/M |
| 3300031954|Ga0306926_12567657 | Not Available | 557 | Open in IMG/M |
| 3300032010|Ga0318569_10025073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2439 | Open in IMG/M |
| 3300032041|Ga0318549_10324804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 693 | Open in IMG/M |
| 3300032044|Ga0318558_10409145 | Not Available | 675 | Open in IMG/M |
| 3300032064|Ga0318510_10053163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1439 | Open in IMG/M |
| 3300032067|Ga0318524_10751873 | Not Available | 515 | Open in IMG/M |
| 3300032090|Ga0318518_10618944 | Not Available | 552 | Open in IMG/M |
| 3300032261|Ga0306920_100248268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2655 | Open in IMG/M |
| 3300033134|Ga0335073_10172107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2719 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.18% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.02% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.75% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.88% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.88% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.88% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.88% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.88% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FA3_04252150 | 2170459023 | Grass Soil | SDTDTRFRDLGPDWHDRLNPQRRARSLRHELERLTGQKVTLTPATGAPAA |
| Ga0066398_100027531 | 3300004268 | Tropical Forest Soil | AHFSDLGPDWHDRIAPLRRKRQLIAELERLSGRKVLLQEAA* |
| Ga0062595_1026907871 | 3300004479 | Soil | PGARFTDLGPGWHDRLTPLRRRRQLIAELERLSGQKVILQEAA* |
| Ga0066395_103016892 | 3300004633 | Tropical Forest Soil | FTDLGPDWHDRLAPIRRKRQLIAELERLSGKKVLLQEEAA* |
| Ga0066676_102277294 | 3300005186 | Soil | FADLGPDWHDRIAPLRRKRQLIAELERLSGKKVTLQEAAA* |
| Ga0070714_1004452393 | 3300005435 | Agricultural Soil | DPAAHFTDLGPGWHDRLAPQRRKRQLITELERLSGQKVTLTSAT* |
| Ga0070713_1019688012 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LFTVAAATGSDWHDRIASLRRKRQLIAELERLSGKKVLLQETAA* |
| Ga0070711_1016618181 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ARFTDLGPNWHDRITPIRRKRQLIAEPERLSGRKVLLQEEAAT* |
| Ga0070699_1011321601 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | SDPGTRFTDLGPYWHDHLAPLRRKRQLIAELERLSGMKVTLQQPA* |
| Ga0066697_106392102 | 3300005540 | Soil | FTDLGPDWHDRLAPQRRKRQLIAELERLSGKKVLLQQETAA* |
| Ga0070762_103023112 | 3300005602 | Soil | TDLGPDWHDRLTPLRRKHHLIAELERLSGKKVTLHDAS* |
| Ga0066905_1012773793 | 3300005713 | Tropical Forest Soil | GPDWHDRLAPLRRKRQLVAELERLSGKKVVLQEAAA* |
| Ga0079221_101896741 | 3300006804 | Agricultural Soil | LLSDPGARFTDLGPDWPDRLAPIRRKRQLIAELERLSGKKVVLQEEAAA* |
| Ga0075426_106585222 | 3300006903 | Populus Rhizosphere | FTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA* |
| Ga0079219_121095531 | 3300006954 | Agricultural Soil | AAHFTDLGPYWHDRIAPLRRKRQLIAELERLSGKKVLLEDAAA* |
| Ga0099829_104962502 | 3300009038 | Vadose Zone Soil | DLGPDWHDRLAPQRRKRQLITELERLSGQKVTLTNAA* |
| Ga0111539_111084311 | 3300009094 | Populus Rhizosphere | DLGVDFHDRLHPQRRTHQLIRELEHLSGKKVTLHTAA* |
| Ga0105247_103793932 | 3300009101 | Switchgrass Rhizosphere | PAAHFTDLGPGWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA* |
| Ga0116224_103807601 | 3300009683 | Peatlands Soil | GAHFTDLGPDWHDRIAPQRRKHQLIAELERLSGKKVTLNDAA* |
| Ga0126373_130825001 | 3300010048 | Tropical Forest Soil | RFTDLGPTWHDHLAPLRRKRQLIAELERLSGMKVTLQQSA* |
| Ga0134080_106250161 | 3300010333 | Grasslands Soil | TDLGPDWHDRIAPLRRKRQLIAELERLSGKKVLLQQETAA* |
| Ga0074045_103496792 | 3300010341 | Bog Forest Soil | FTDLGPGWHDRLAPLRRKRQLVAELERLSGKKVLLQEATA* |
| Ga0126370_104510163 | 3300010358 | Tropical Forest Soil | FADLGPDWHDRLAPLRRKRQLIAELERLSGKKVLLQEAA* |
| Ga0126376_102880301 | 3300010359 | Tropical Forest Soil | DLGPDWHDRLAPQRRKRQLIAELERLSGKKITLNDAA* |
| Ga0126372_132195261 | 3300010360 | Tropical Forest Soil | LGPDWHDRIAPIRRKRQLIAELERLSGKKVLLQEEAA* |
| Ga0126378_108083801 | 3300010361 | Tropical Forest Soil | PDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAV* |
| Ga0126378_128576453 | 3300010361 | Tropical Forest Soil | DAHFSDLGPYWHDRIAPLRRKRQLIAKLERLSGKKVLLHDATT* |
| Ga0126383_105173772 | 3300010398 | Tropical Forest Soil | FTDLGPDWHDRLAPQRRKRQLIAELERLSGKKVLLQEATA* |
| Ga0126383_117493742 | 3300010398 | Tropical Forest Soil | FTDLGPDWHDRLAPQRRKRQLIAELERLSGKKVTLNDAA* |
| Ga0126383_123455831 | 3300010398 | Tropical Forest Soil | HRLLSDPAAHFSDLGPDWHDRIAPLRRKRQLIAELERLSGRKVLLQEAA* |
| Ga0137364_101037531 | 3300012198 | Vadose Zone Soil | FTDLGPDWHDRLVPQRRKRQLLAELERLSGKKVTLHDAA* |
| Ga0137383_112089552 | 3300012199 | Vadose Zone Soil | DLGPDWHDRLAPQRRKHQLIAELERLSGKKVTLNDAA* |
| Ga0137365_104142243 | 3300012201 | Vadose Zone Soil | GPDWHDRLAPLRRKRQLIAELERISGKKVTLHDAA* |
| Ga0137376_114215341 | 3300012208 | Vadose Zone Soil | LSDPGAHFTDLGPDWHDRLAPQRRKRQLIAELERLSGKKVTLNDAA* |
| Ga0137378_106237612 | 3300012210 | Vadose Zone Soil | FTDLGPDWHDRLAPQRRKRQLITELERLSGQKVTLTNAA* |
| Ga0137377_106673031 | 3300012211 | Vadose Zone Soil | GPDWHDRLAPQRRKHQLIAELERLSGKKVTLNDAA* |
| Ga0137377_110785191 | 3300012211 | Vadose Zone Soil | FTDLGPDWHDRLAPIRRKRQLIAELERLSGKKVTLQHTV* |
| Ga0137375_102369703 | 3300012360 | Vadose Zone Soil | PAARFTDLGPDWHDRLAPLRPKRQLIAELERISGKKVTLHDAA* |
| Ga0137390_104678272 | 3300012363 | Vadose Zone Soil | GPDWHDRLAPQRRKHQLIAELERLSGKKVTLHDAA* |
| Ga0137395_109805601 | 3300012917 | Vadose Zone Soil | RFTDLGPYWHDHLAPLRCKRQLIAELERLSGMKVTLQQSA* |
| Ga0137395_112946831 | 3300012917 | Vadose Zone Soil | HFTDLGPDWHDRLAPQRRKHQLIAELERLSGKKVTLHDAA* |
| Ga0137394_107947721 | 3300012922 | Vadose Zone Soil | PAAHFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLNDAA* |
| Ga0126369_135112981 | 3300012971 | Tropical Forest Soil | RFADLGPTWHDRLTPQRRKRQLIAELERLSGMKVTLQEAA* |
| Ga0126369_135640952 | 3300012971 | Tropical Forest Soil | LSGPDARFAGLGPHWHDRIAPLRRKRQLIAELERLSGKKVILQEAAA* |
| Ga0134079_100963212 | 3300014166 | Grasslands Soil | DLGPDWHDRIAPLRRKRQLIAELERLSGKKVLLQEETAA* |
| Ga0182016_104374651 | 3300014493 | Bog | TDLGPDWHDRLAPLRRKHQLIAELERLSGKKVTLHDGA* |
| Ga0132257_1020866752 | 3300015373 | Arabidopsis Rhizosphere | RFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA* |
| Ga0182036_106273942 | 3300016270 | Soil | FADLGPDWHDRLAPLRRKRQLVVKLERLSGKKVLLQEAA |
| Ga0182035_117391051 | 3300016341 | Soil | AAHFADLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA |
| Ga0182040_115583361 | 3300016387 | Soil | DFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAV |
| Ga0182038_110002043 | 3300016445 | Soil | ARFTDLGPDWHDRLAPIRRKRQLIAELERLSGKKVTLNDAA |
| Ga0182038_117027111 | 3300016445 | Soil | PAAHFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTFHDAA |
| Ga0187802_100312091 | 3300017822 | Freshwater Sediment | DPAAHFTDLGPDWHDRLAPLRRKRQLIAEIERLTGKKVTLHDAA |
| Ga0187807_10047817 | 3300017926 | Freshwater Sediment | FADLGPDWHDRLAPLRRKRQLIAELERLSGKKVLLQEAA |
| Ga0187824_103673821 | 3300017927 | Freshwater Sediment | TDLGPGWHDRLAPLRRKRQLIAELERLSGKKVTLQDAI |
| Ga0187814_100720591 | 3300017932 | Freshwater Sediment | PAAHFTDLGPDWHDRLAPLRRKRQLIAEIERLTGKKVTLHDAA |
| Ga0187879_107939062 | 3300017946 | Peatland | GPGWHDRLAPLRRKRQLVAELERLSGKKVLLQEATA |
| Ga0187779_103174882 | 3300017959 | Tropical Peatland | GPDWHDRIAPLRRKRQLIAELERMSGKKVLLQDAA |
| Ga0187823_101257402 | 3300017993 | Freshwater Sediment | AHFTDLGPDWHDKIAPIRRKRQLIAELERLSGKKVLLQEETAA |
| Ga0187816_101583291 | 3300017995 | Freshwater Sediment | AAHFTDLGPDWHDRLAPLRRKRQLIAEIERLTGKKVTLHDAA |
| Ga0187815_100934701 | 3300018001 | Freshwater Sediment | PAAHFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA |
| Ga0187805_102075363 | 3300018007 | Freshwater Sediment | FADLGPDWHDRLAPLRRERQLIAELERLSGKKVLLQEAA |
| Ga0187772_109973701 | 3300018085 | Tropical Peatland | ARFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLQEAAA |
| Ga0210389_100315451 | 3300021404 | Soil | HFTDLGPDWHDRLTPLRRKHHLIAELERLSGKKVTLHDAS |
| Ga0213879_101206661 | 3300021439 | Bulk Soil | VWLLADVGARFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLQEAAA |
| Ga0210390_108831203 | 3300021474 | Soil | QLSDPDSRFADLGPDWHDRLAPLRRKRQLIAELERLSGKKVLLQEAA |
| Ga0210398_101539741 | 3300021477 | Soil | SDPDSRFADLGPDWHDRLAPLRRKRQLIAELERLSGKKVLLQEAA |
| Ga0126371_100540741 | 3300021560 | Tropical Forest Soil | DPDAHFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLQDDAA |
| Ga0208714_10186553 | 3300025527 | Arctic Peat Soil | DTSGRLGPDWHDRLTPIRRKRQLIAELERLSGKKVLLKEEAA |
| Ga0208714_10339891 | 3300025527 | Arctic Peat Soil | MTWTRFSAPTRFTDLGSDWHDRLTPIRRKRQLITELERLSGKKVVLQDEAA |
| Ga0207699_100828732 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GPHWHDRIAPLRRKRQLIAELERLSGKKVLLQEGAA |
| Ga0207660_106349721 | 3300025917 | Corn Rhizosphere | PDWHDRIAPLRRKRQLITELERLSGKKVQLQEAAA |
| Ga0207646_100192071 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GPDWHARLAPLRRKRQLIAELERLSGKKVTLQDTV |
| Ga0207640_120584761 | 3300025981 | Corn Rhizosphere | DLAPGWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA |
| Ga0209890_100178751 | 3300026291 | Soil | GPNWHDRLAPLRRKRQLVAELERLSGKKVLLQEATA |
| Ga0209177_100036761 | 3300027775 | Agricultural Soil | MGPDWHDRLAPLRRKRHFIAELERLSGKKVTLHDAA |
| Ga0209465_106461502 | 3300027874 | Tropical Forest Soil | RFTDLGPTWHDHLAPLRRKRQLIAELERLSGMKVTLHQTG |
| Ga0209006_110749202 | 3300027908 | Forest Soil | LSDPAAHFTDLGPDWHDRLTPLRRKHHLIAELERLSGKKVTLHDAS |
| Ga0302220_100280792 | 3300028742 | Palsa | DPEARFADLGPDWHDRIAPLRRKRQLIAGLGQRMSGKKVLLQEAAV |
| Ga0302234_103238581 | 3300028773 | Palsa | DLGPNWHDRLAPLRRKRQLVAELERLSGKKVLLQEATA |
| Ga0302234_103479441 | 3300028773 | Palsa | LSDAAAHFTDLGRDWHDRLAPLRRKRQLIAELERLSGKKVTLNDAA |
| Ga0307323_103837091 | 3300028787 | Soil | HFTDLGPDWHDRLAPQRRKHQLIAELERLSGKKVTLNDAA |
| Ga0307299_103913171 | 3300028793 | Soil | PGAHFTDLGPDWHDRLAPQRRKHQLIAELERLSGKKVTLNDAA |
| Ga0307312_100284484 | 3300028828 | Soil | GPDWHDRLAPLRRKRQLIAELERLSGKKVTLNDAA |
| Ga0302230_102808991 | 3300028871 | Palsa | PDARFTDLGPNWHDRLAPLRRKRQLVAELERLSGKKVLLQEAAA |
| Ga0311352_103354662 | 3300029944 | Palsa | DAHFTDLGPGWHDRLAPLRPKRQLVAELERLSGKKVLLQEATA |
| Ga0311353_109011151 | 3300030399 | Palsa | FTDLGPNWHDRLAPLRRKRQLVAELERLSGKKVLLQEATA |
| Ga0302308_107432102 | 3300031027 | Palsa | DPAAAFTDLGPDWYDRLSPLRRKRQLIAELERLSGKKVLLQEAAA |
| Ga0318538_101506832 | 3300031546 | Soil | GSDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAT |
| Ga0318528_102386531 | 3300031561 | Soil | DLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA |
| Ga0318573_107104361 | 3300031564 | Soil | LSDPGTRFTDLGPYWHDHLAPLRRKRQLIAELERLSGMKVTLQQSA |
| Ga0318515_107666372 | 3300031572 | Soil | VGPDARFADLGPDWHDRIAPLRRKRQLIAELERLSGKKVTLQEAAA |
| Ga0307469_121162671 | 3300031720 | Hardwood Forest Soil | AAHFTDLGPGWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA |
| Ga0318502_105355431 | 3300031747 | Soil | DDARPGNTHLGPDWHGRLAPLRRKRQLIAKLERLSGIKVNLQESAA |
| Ga0318494_103333652 | 3300031751 | Soil | VRGYDDARPGNTHLGPDWHGRLAPLRRKRQLIAKLERLSGIKVNLQESAA |
| Ga0318554_106285222 | 3300031765 | Soil | LGPDWHGRLAPLRRKRQLIAKLERLSGIKVNLQESAA |
| Ga0318509_101695932 | 3300031768 | Soil | EARFTDLGPDWHDRLAPIRRKRQLIAELERLSGKKVTLQDAAA |
| Ga0318521_102134382 | 3300031770 | Soil | VRGYYDARPGNTDLGPDWHGRLAPLRRKRQLIAKLERLSGIKVNLQESAA |
| Ga0318566_104586931 | 3300031779 | Soil | ARFADPGPDWHDRIAPLHRKRQLIAELERLSGKKVTLQEAAA |
| Ga0318497_104535522 | 3300031805 | Soil | YYDARPGNTDLGPDWHGRLAPLRRKRQLIAKLERLSGIKVNLQESAA |
| Ga0318568_109097121 | 3300031819 | Soil | ARFTDLGPDWHDRLAPVRRKRQLIAELERLSGKKVTLQEAAA |
| Ga0318495_101472852 | 3300031860 | Soil | VRGYDDARPGNTDLGPDWHGRLSPLRRKRQLIAKLERLSGIKVNLQESAA |
| Ga0306919_115390491 | 3300031879 | Soil | SDPAAHFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLQDTV |
| Ga0306923_115359872 | 3300031910 | Soil | DPAARFTDLGPDWHDRLAPIRRKRQLIAELERLSGKKVTLNDAA |
| Ga0310910_114940162 | 3300031946 | Soil | IAHRLLSDPGTRFSDLGPDWHDRIAPLRRKRQLIAELERLSGRKVVLQESAA |
| Ga0306926_125676571 | 3300031954 | Soil | DPGPDWHDRIAPLHRKRQLIAELERLSGKKVTLQEAAA |
| Ga0318569_100250735 | 3300032010 | Soil | GARFADLGPTWHDRLTPQRRKRQLIAELERLSGMKVTLEAA |
| Ga0318549_103248041 | 3300032041 | Soil | FTDLGPDWHDRLAPIRRKRQLIAELERLSGKKVLLQEAAA |
| Ga0318558_104091452 | 3300032044 | Soil | RLLSDPGTRFSDLGPDWHDRIAPLRRKRQLIAELERLSGRKVLLQDAAA |
| Ga0318510_100531631 | 3300032064 | Soil | LLSDPDAHFTDLGPYWHDRIAPLRRKRQLIAELERLSGKKVLLEDAAA |
| Ga0318524_107518731 | 3300032067 | Soil | FSDLGPDWHDRIAPLRRKRQLIAELERLSGKKVLLQDAAA |
| Ga0318518_106189441 | 3300032090 | Soil | LLSDPAAHFADLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA |
| Ga0306920_1002482684 | 3300032261 | Soil | VRGYDDARPGNTDLGPDWHGRLAPLRRKRQLIAKLERLSGIKVNLQESAA |
| Ga0335073_101721074 | 3300033134 | Soil | LTDLGPDWHDRIAPIRRKRQLIAELERLSGKKVLLHEEAAA |
| ⦗Top⦘ |