NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F081054

Metagenome / Metatranscriptome Family F081054

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081054
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 49 residues
Representative Sequence XAVYGLDVAGVGIGKFSSKAPAGIAAKVAKIKQQIVSGKITNIPTTVK
Number of Associated Samples 93
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.37 %
% of genes from short scaffolds (< 2000 bps) 88.60 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.088 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(8.772 % of family members)
Environment Ontology (ENVO) Unclassified
(34.211 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(51.754 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.33%    β-sheet: 0.00%    Coil/Unstructured: 82.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF01243Putative_PNPOx 44.74
PF00202Aminotran_3 12.28
PF00892EamA 7.02
PF01266DAO 5.26
PF02597ThiS 1.75
PF13417GST_N_3 0.88
PF00254FKBP_C 0.88
PF00676E1_dh 0.88
PF13520AA_permease_2 0.88
PF02608Bmp 0.88
PF14559TPR_19 0.88
PF09335SNARE_assoc 0.88
PF04316FlgM 0.88
PF02786CPSase_L_D2 0.88
PF00355Rieske 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG2747Negative regulator of flagellin synthesis (anti-sigma28 factor)Transcription [K] 2.63
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 1.75
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 1.75
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.88
COG05672-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymesEnergy production and conversion [C] 0.88
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.88
COG1071TPP-dependent pyruvate or acetoin dehydrogenase subunit alphaEnergy production and conversion [C] 0.88
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.88
COG1744Lipoprotein Med, regulator of KinD/Spo0A, PBP1-ABC superfamily, includes NupNSignal transduction mechanisms [T] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.09 %
UnclassifiedrootN/A14.91 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908039|B3_v_NODE_111134_len_1859_cov_6_284562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1909Open in IMG/M
2124908043|A2_c1_ConsensusfromContig49608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
2170459007|GJ8XV2H01A9GDEAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
2189573002|GZIGXIF01DZ791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300001538|A10PFW1_11558774Not Available627Open in IMG/M
3300002568|C688J35102_119065139Not Available633Open in IMG/M
3300004153|Ga0063455_100913713All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300004463|Ga0063356_105234621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300005173|Ga0066822_1006455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria688Open in IMG/M
3300005327|Ga0070658_10411410All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300005327|Ga0070658_11743385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300005329|Ga0070683_100024080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5448Open in IMG/M
3300005336|Ga0070680_101266316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300005344|Ga0070661_100877239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales740Open in IMG/M
3300005434|Ga0070709_11301996All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300005434|Ga0070709_11777139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300005436|Ga0070713_100424741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1245Open in IMG/M
3300005436|Ga0070713_102118848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria545Open in IMG/M
3300005439|Ga0070711_100425594All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300005458|Ga0070681_10789459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria866Open in IMG/M
3300005547|Ga0070693_101516553All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300005587|Ga0066654_10381432All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300005614|Ga0068856_100461651All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300005616|Ga0068852_100087146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2785Open in IMG/M
3300005764|Ga0066903_103022202Not Available911Open in IMG/M
3300005764|Ga0066903_106705914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300006804|Ga0079221_10586923Not Available747Open in IMG/M
3300006854|Ga0075425_101836180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300009093|Ga0105240_11817707Not Available635Open in IMG/M
3300009093|Ga0105240_12406722Not Available545Open in IMG/M
3300009137|Ga0066709_100430662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1839Open in IMG/M
3300009148|Ga0105243_11367221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria728Open in IMG/M
3300009545|Ga0105237_11908788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300009551|Ga0105238_10122419All Organisms → cellular organisms → Bacteria2581Open in IMG/M
3300010040|Ga0126308_10708015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300010329|Ga0134111_10461787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300010333|Ga0134080_10146567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium998Open in IMG/M
3300010366|Ga0126379_11290497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria836Open in IMG/M
3300012010|Ga0120118_1017377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1982Open in IMG/M
3300012011|Ga0120152_1099002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp.830Open in IMG/M
3300012210|Ga0137378_11489003Not Available588Open in IMG/M
3300012955|Ga0164298_10430299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria862Open in IMG/M
3300012955|Ga0164298_10473489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria830Open in IMG/M
3300012957|Ga0164303_11561789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300012984|Ga0164309_11242873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300012985|Ga0164308_11054840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria726Open in IMG/M
3300012989|Ga0164305_11475448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300013104|Ga0157370_10116867All Organisms → cellular organisms → Bacteria2492Open in IMG/M
3300013104|Ga0157370_10222651All Organisms → cellular organisms → Bacteria1747Open in IMG/M
3300013104|Ga0157370_12058524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300013105|Ga0157369_12525259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300013296|Ga0157374_12588008Not Available535Open in IMG/M
3300013307|Ga0157372_11277901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria847Open in IMG/M
3300013765|Ga0120172_1097971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria713Open in IMG/M
3300013772|Ga0120158_10057003All Organisms → cellular organisms → Bacteria2640Open in IMG/M
3300014058|Ga0120149_1225798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300014325|Ga0163163_11076335All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300015171|Ga0167648_1004659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3499Open in IMG/M
3300015245|Ga0137409_11439806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300015374|Ga0132255_100265771All Organisms → cellular organisms → Bacteria2457Open in IMG/M
3300015374|Ga0132255_104352027Not Available600Open in IMG/M
3300016404|Ga0182037_11716616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300018431|Ga0066655_10860207Not Available618Open in IMG/M
3300018468|Ga0066662_12830306Not Available515Open in IMG/M
3300020070|Ga0206356_10530626All Organisms → cellular organisms → Bacteria1920Open in IMG/M
3300020078|Ga0206352_10744985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300020081|Ga0206354_10072590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1091Open in IMG/M
3300021384|Ga0213876_10377832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae754Open in IMG/M
3300021384|Ga0213876_10606051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300022467|Ga0224712_10253931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria813Open in IMG/M
3300022467|Ga0224712_10424452Not Available636Open in IMG/M
3300022756|Ga0222622_10615151All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300025321|Ga0207656_10287351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria812Open in IMG/M
3300025906|Ga0207699_11470718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300025911|Ga0207654_10854088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300025912|Ga0207707_10616426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae917Open in IMG/M
3300025913|Ga0207695_10491822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1109Open in IMG/M
3300025913|Ga0207695_10497680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1101Open in IMG/M
3300025913|Ga0207695_11125744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300025917|Ga0207660_11043922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300025928|Ga0207700_10437821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1150Open in IMG/M
3300025928|Ga0207700_10947656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria770Open in IMG/M
3300025928|Ga0207700_11842521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300025929|Ga0207664_10740052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria884Open in IMG/M
3300025931|Ga0207644_11308673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300025944|Ga0207661_10433399Not Available1195Open in IMG/M
3300025944|Ga0207661_10580105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1028Open in IMG/M
3300025945|Ga0207679_12170884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300026041|Ga0207639_10357129All Organisms → cellular organisms → Bacteria1307Open in IMG/M
3300026078|Ga0207702_10080222All Organisms → cellular organisms → Bacteria2831Open in IMG/M
3300026142|Ga0207698_10072148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2743Open in IMG/M
3300026142|Ga0207698_12264082Not Available556Open in IMG/M
3300026529|Ga0209806_1016448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3856Open in IMG/M
3300026550|Ga0209474_10736465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300028563|Ga0265319_1168091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria677Open in IMG/M
3300028577|Ga0265318_10100464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1064Open in IMG/M
3300030010|Ga0302299_10642400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300031251|Ga0265327_10119184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1252Open in IMG/M
3300031251|Ga0265327_10148882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1088Open in IMG/M
3300031564|Ga0318573_10286844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium880Open in IMG/M
3300031668|Ga0318542_10429294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium684Open in IMG/M
3300031680|Ga0318574_10616701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium636Open in IMG/M
3300031712|Ga0265342_10046096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2621Open in IMG/M
3300031726|Ga0302321_100814607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1054Open in IMG/M
3300031939|Ga0308174_10133248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1829Open in IMG/M
3300031981|Ga0318531_10536537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300031996|Ga0308176_11814779Not Available651Open in IMG/M
3300031996|Ga0308176_12944811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300032035|Ga0310911_10653212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300032074|Ga0308173_11238906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
3300032126|Ga0307415_100942344All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300032829|Ga0335070_10263317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1685Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere7.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.14%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere6.14%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere6.14%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost5.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere4.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.39%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.39%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere4.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.51%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.63%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.75%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.75%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots1.75%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.88%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.88%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.88%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.88%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.88%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.88%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.88%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.88%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908039Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4EnvironmentalOpen in IMG/M
2124908043Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2EnvironmentalOpen in IMG/M
2170459007Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cmEnvironmentalOpen in IMG/M
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005173Soil and rhizosphere microbial communities from Laval, Canada - mgHMAEnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300012010Permafrost microbial communities from Nunavut, Canada - A7_35cm_12MEnvironmentalOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015171Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300028563Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaGHost-AssociatedOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300030010Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4EnvironmentalOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B3_v_008452602124908039SoilXAVYGLDVAGVGIGKFSSKAPAGIAAKVAKIKQQIVSGKITNIPTTVK
A2_c1_007522502124908043SoilGNFSPKTPKGIEAKTKQIEQQIVAGKIKNIPTTVK
L02_000917002170459007Grass SoilVGIGKFSPKTPAGIAAKVAVIKQQIASGKITNIPTTVK
FE1_006409702189573002Grass SoilLDIGGVGIGKFSPKTPAGIAAKVAVIKQQIASGKITNIPTTVK
A10PFW1_1155877433300001538PermafrostGVGLGKFSPKAPKGIEAKVKQIEQQIIDGKIANIPTTVK*
C688J35102_11906513913300002568SoilDAQSGNFKGGQDAVYGLDKKGVGLGKFSPNAPAGIEAKVKKIQQQITSGAIKNIPTTVQ*
C688J35102_12065931513300002568SoilDAQAGKFKGGQDAVYGIKDDGVGIGKFSSDAPKGIPASVATVKQHIVGGKINDIPTIVK*
Ga0063455_10091371313300004153SoilVFLSIKDAQAGNFKGGQDAVYGLDKKGVGLGKFSPDTPAGIEAKVKKIQQDITSGKIKNIPTVVP*
Ga0063356_10523462113300004463Arabidopsis Thaliana RhizosphereAQNGVGLGKFSPKTPAGIPAKVKAIRQQIIDGKIKHIPTEIAG*
Ga0066822_100645513300005173SoilEQKGVGLGKFSAKAPAGIEQKVLQIEQQIIDGKIPNIPTTVK*
Ga0070658_1041141023300005327Corn RhizosphereNFKGGQDAVYGLDVDGVGIGKFSAKAPAGIADKVAQIKQQIADGKIKNIPTIVK*
Ga0070658_1174338513300005327Corn RhizosphereGGQDAVYGIKDEGVGIGKFSTKTPKGIAAKVDAIKAQIVSGKITNIPTTVVK*
Ga0070683_10002408063300005329Corn RhizosphereDAVYGLDVNGVGIGKFSAKAPAGIADKVAQIKQQIADGKIKNIPTIVK*
Ga0070680_10126631623300005336Corn RhizosphereIDVNGVGIGKFSPKAPKGIAAKVAKVKQQIASGKIANIPTTVK*
Ga0070661_10087723913300005344Corn RhizosphereDGVGIGKFSPKTPKGIAAKVAAIKAQILSGKITNIPTTVK*
Ga0070709_1130199623300005434Corn, Switchgrass And Miscanthus RhizosphereDAKDGHFKGGQDAVYGLDVNGVGIGKFSPKAPAGIAAKVAQIREQIADGKIKNIPTIVK*
Ga0070709_1177713913300005434Corn, Switchgrass And Miscanthus RhizosphereLSIKDAHAGHFKGGQDSVYGLEQNGVGLGKFSAKAPPGIERKVSQIERQIIAGKITNIPTTVK*
Ga0070713_10042474133300005436Corn, Switchgrass And Miscanthus RhizosphereLDVGGVGIGKFSPKTPAGVAAKVAAIKQQIAAGKIANIPTTVK*
Ga0070713_10211884823300005436Corn, Switchgrass And Miscanthus RhizosphereDDGVGIGKFSPNAPKDIAAQVDKVKQQIVSGKITNIPTVVK*
Ga0070711_10042559433300005439Corn, Switchgrass And Miscanthus RhizosphereFKGGQDSVYGLEQNGVGLGKFSAKAPPGIERKVSQIERQIIAGKITNIPTTVK*
Ga0070681_1078945923300005458Corn RhizosphereQDAVYGLDVNGVGIGKFSAKAPAGIADKVAQIKQQIADGKIKNIPTIVK*
Ga0070693_10151655323300005547Corn, Switchgrass And Miscanthus RhizosphereKGGQDAVYGLEVNGVGIGKFSAKAPAGIADKVEQIKQQIADGKIKNIPTTVS*
Ga0066654_1038143223300005587SoilFDSIRDAKSGHFKGGQDAVYGLKDQGVGIGKFSPAAPKGIAAKVAAVKQQIVSGKIADIPTIVK*
Ga0068856_10046165133300005614Corn RhizosphereQDAVYGLDVNGVGIGKFSSKTPAGIAAKVAQVKQQIADGKIKNIPTIVK*
Ga0068852_10008714613300005616Corn RhizosphereGKFKGGTDAVYGLDVDGVGIGKFSPKAPAGIAAKVAAVKQQIAAGKIKNIPTIVK*
Ga0066903_10302220213300005764Tropical Forest SoilEQNGVGLGKFSPKTPKGIEAKVDQIRQDIVSGKIKNIPTTVP*
Ga0066903_10670591433300005764Tropical Forest SoilIGKFSPKAPAGIEDKVNAVKQQIKDGKITNIPTTVK*
Ga0079221_1058692313300006804Agricultural SoilKGGQDAVYGLEQKGVGLGKFSPKAPKSIRPDVEKIEQQIISGKIKNIPTTLK*
Ga0075425_10183618013300006854Populus RhizosphereGKFSSAAPKGIQAKVNAVKQQILDGKITDIPTTVQ*
Ga0105240_1181770723300009093Corn RhizosphereEGKFKGGTDATYGLKQGGVGLGKFSPQTPAGIEAKVEKIRQQIVAGTITGIPTTVK*
Ga0105240_1240672213300009093Corn RhizosphereKGGTDAVYGLDKHGVGLGKFSPKAPAGIEAKVKQIEQQIVSGKIKNIPTIVP*
Ga0066709_10043066233300009137Grasslands SoilVDTAVFLAIKDAKEGHFKGGQDAVYGLEQKGVGVGTFSPKAPKTIKPKVLEIEKEIINGKIKNIPTTVK*
Ga0105243_1136722123300009148Miscanthus RhizosphereGLNQQGVGLVVFSPKTPAGIEAKVKKIQADITSRKIKNIPTTVQ*
Ga0105237_1190878813300009545Corn RhizosphereKGGQDAVYGIKDDGVGIGKFSPKTPKGIAAKVAAIKAQIISGKITNIPTIVK*
Ga0105238_1012241933300009551Corn RhizosphereGIGKFSPKAPAGIAAKVAQIRQQIADGKIKNIPTIVK*
Ga0126308_1070801523300010040Serpentine SoilYGLGQKGVGLGKFSPKAPPGLAQKVKAVQQQIVAGKITNIPTEIGT*
Ga0134111_1046178713300010329Grasslands SoilGVGLGKFSRKAAKGIEAKTKRIEQQIISGKIKNIPTTVK*
Ga0134080_1014656723300010333Grasslands SoilLKGVDRAVFLAIKDAQSGKFKGGQDAIYGLDKKGVGLGKFSPKAPAGIEAKVKQIQQQITSGKITNIPTTVK*
Ga0126379_1129049713300010366Tropical Forest SoilGGKDTVYGLDVDGVGIGKFSPKAPAGIEDKVNAVKQQIKDGKITNIPTTVK*
Ga0120118_101737743300012010PermafrostGVGLGKFSPKAPKGIEAKTKQIEQQIIDGKIANIPTTVK*
Ga0120152_109900233300012011PermafrostEQKGVGLGKFSPKAPKGIEAKTKQIEQQIIDGKIGNIPTTVK*
Ga0137378_1148900313300012210Vadose Zone SoilGVGLGKFSRKAPKGIETKVKRIEQQIIDGKIANIPTTVK*
Ga0164298_1043029933300012955SoilGGQDAVYGLKDEGVGIGKFSTKTPKGVAAKVDAIKAQIVSGKITNIPTTVLK*
Ga0164298_1047348913300012955SoilGGRDAVYGLDVNGVGIGKFSAKAPAGIADKVAQIKQQIADGKIKNIPTIVK*
Ga0164303_1146365023300012957SoilGQDTVYGLQDDGVGIGKFSVEAAAVIDDKVEAVKQQIIDGKITNIPTTVK*
Ga0164303_1156178913300012957SoilQQGVGLGVFSPKAPAGIEAKVKKIQADISSGKIKNIPTTVQ*
Ga0164309_1124287323300012984SoilYLSIKDAHAGHFKGGQDSVYGLEQNGVGLGKFSAKAPPGIERKVSQIERQIIAGKITNIPTTVK*
Ga0164308_1105484023300012985SoilLKDEGVGIGKFSTKTPKGVAAKVDAIKAQIVSGKITNIPTTVLK*
Ga0164305_1147544823300012989SoilEQKGVGLGKFSPKAPKDIEAKVLKIEQQIVDGKITNIPTTVK*
Ga0157370_1011686733300013104Corn RhizosphereGKFSPKAPAGIAAKVAQIRQQIADGKIKNIPTIVK*
Ga0157370_1022265113300013104Corn RhizosphereGIGKFSPKTPAGIAAKVAQVKQQIARGKIKDIPTIVK*
Ga0157370_1205852413300013104Corn RhizosphereDAVYGLDVNGVGIGKFSPKAPAGIAAKVQQVKQQIADGKIKNIPTIVK*
Ga0157369_1252525913300013105Corn RhizosphereDAVYGIKDEGVGIGKFSTKTPKGIAAKVDAIKAQIVSGKITNIPTTVVK*
Ga0157374_1258800813300013296Miscanthus RhizosphereYAVYGLTQDGVGIGKFSANAPAGIAAKVAAIKSQIASGKIANIPTVVK*
Ga0157372_1127790123300013307Corn RhizosphereDVNGVGIGKFSPKAPAGIAAKVAQIRQQIADGKIKNIPTIVK*
Ga0120172_109797113300013765PermafrostFKGGHDAVYGLAQKGVGLGKFSPKAPKGIEAKTKQIEQQIVDGKITNIPTTVK*
Ga0120158_1005700343300013772PermafrostFKGGTDAVYGLDIAGVGIGKFSSKAPKGIAAKVLQIKQQIASGKITNIPTTVK*
Ga0120149_122579823300014058PermafrostYGLDIAGVGIGKFSSKAPKGIAAKVLQIKQQIASGKITNIPTTVK*
Ga0163163_1107633533300014325Switchgrass RhizosphereDKKGVGLGKFSPKTPAGIEAKTKKILHDIVSGKIKNIPTTVQ*
Ga0167648_100465913300015171Glacier Forefield SoilFKGGQDAVYGLKDEGVGIGKFSTKAPKGVAAKVAAIKAKIVSGKFANIATTVK*
Ga0137409_1143980623300015245Vadose Zone SoilGKFSPRAPKGIPAKVQQIKAQIIAGKIKNIPTTVK*
Ga0132255_10026577113300015374Arabidopsis RhizosphereQEGVGLGKFSPAAPKDIEPKVREIEQQIKDGKIKSIPTTVS*
Ga0132255_10435202713300015374Arabidopsis RhizosphereQDAVYGLDQKGVGLGKFSPNAPAGIEAKVKKIQHDIVSGKITNIPTTVQ*
Ga0182037_1171661613300016404SoilIGKFSRFAPKGIEEKVQQVKADIVSGKITNIPTVVK
Ga0066655_1086020713300018431Grasslands SoilVYGLEQKGVGVGTFSPNAPKTIKPKVLEIEKEIINGKIKNIPTTVK
Ga0066662_1283030613300018468Grasslands SoilTDEESDAVYDAIRDAKTGHFKGGKDAVYGLSVDGVGIGKFSSRAPKGIAAKVGAVRQRIADGKLEHIPTTVK
Ga0206356_1053062613300020070Corn, Switchgrass And Miscanthus RhizosphereYGLDVNGVGIGKFSPKAPAGIAAKVAQIRQQIADGKIKNIPTIVR
Ga0206352_1074498513300020078Corn, Switchgrass And Miscanthus RhizosphereIKSAKAGKFKGGTDAVYGLDVDGVGIGKFSPKAPAGIAAKVAAVKQQIAAGKIKNIPTIV
Ga0206354_1007259023300020081Corn, Switchgrass And Miscanthus RhizosphereKEGHFKGGTDAVYGLDKHGVGLGKFSPKAPAGIEAKVKQIEQQIVSGKIKNIPTIVP
Ga0213876_1037783233300021384Plant RootsKFKGGQDAVYGLDVDGVGIGKFSSKAPAGIAQKVAQVKQQIASGKIKNIPTTVK
Ga0213876_1060605113300021384Plant RootsGIGKFSSKAPAGIAQKVAQVRQEIASGKIKNIPTTVK
Ga0224712_1025393133300022467Corn, Switchgrass And Miscanthus RhizosphereVGLGKFSSKTPAGIEIKVDQIRKQIIDGKISNIPTTVK
Ga0224712_1042445213300022467Corn, Switchgrass And Miscanthus RhizosphereVYGLDKGGVGLGKFSPKTPAGIEIKVDQIRKQIVDGKIKDIPTTVK
Ga0222622_1061515133300022756Groundwater SedimentLDQKGVGLGKFSPNAPAGIEAKVKKIQQDITSGKITNIPTTVQ
Ga0207656_1028735123300025321Corn RhizosphereDVNGVGIGKFSAKAPAGIADKVAQIKQQIADGKIKNIPTIVK
Ga0207699_1147071823300025906Corn, Switchgrass And Miscanthus RhizosphereLSIKDAHAGHFKGGQDSVYGLEQNGVGLGKFSAKAPPGIERKVSQIERQIIAGKITNIPTTVK
Ga0207654_1085408823300025911Corn RhizosphereGGEDAVYGLDVDGVGIGKFSAKTPAGIADKVQQIKQQIADGKIKNIPTIVK
Ga0207707_1061642633300025912Corn RhizosphereKDAKAGNFKGGTDAVYGLDVDGVGIGKFSPKAPTGMAAKVAAVKKQIADGTIKNIPTIVK
Ga0207695_1049182213300025913Corn RhizosphereGVGLVKFSPKTPAGIESKVKKVEQQIISGKIKNIPTIVP
Ga0207695_1049768013300025913Corn RhizosphereVNGVGIGKFSPKAPAGIAAKVAQIREQIADGKIKNIPTIVK
Ga0207695_1112574413300025913Corn RhizosphereLDVDGVGIGKFSPKTPAGIAAKVAQVKQQIAGGKIKDIPTIVK
Ga0207660_1104392233300025917Corn RhizosphereDAVYGIDVNGVGIGKFSPKAPKGIAAKVAKVKQQIASGKIANIPTTVK
Ga0207700_1043782133300025928Corn, Switchgrass And Miscanthus RhizosphereDTAVYDSIRDAKAGKFKGGTDSIYVLDVGGVGIGKFSPKTPAGVAAKVAAIKQQIAAGKIANIPTTVK
Ga0207700_1094765613300025928Corn, Switchgrass And Miscanthus RhizosphereGLKDDGVGIGKFSPNAPKDIAAQVDKVKQQIVSGKITNIPTVVK
Ga0207700_1184252123300025928Corn, Switchgrass And Miscanthus RhizosphereYGLDQKGVGLGKFSPKAPAGIEAKVKKIQQDITSGKIKNIPTTVQ
Ga0207664_1074005233300025929Agricultural SoilNGVALGKFSPKTPAGIAAKVNKIRDEIVSGKITNIPTTVK
Ga0207644_1130867313300025931Switchgrass RhizosphereYGLNQQGVGLGVFSPKTPAGIEAKVKKIQADITSRKIKNIPTTVQ
Ga0207661_1043339913300025944Corn RhizosphereVGIGKFSAKAPAGIADKVAQIKQQIADGKIKNIPTIVK
Ga0207661_1058010513300025944Corn RhizosphereAKAGNFKGGTDAVYGLDVDGVGIGKFSPKAPTGMAAKVAAVKKQIADGTIKNIPTIVK
Ga0207679_1217088423300025945Corn RhizosphereVYGLDVNGVGIGKFSSKTPAGIAAKVAQVKQQIADGKIKNIPTIVK
Ga0207639_1035712913300026041Corn RhizosphereGGEDAVYGLDVDGVGIGKFSPKTPAGIAAKVAQVKQQIAGGKIKDIPTIVK
Ga0207702_1008022243300026078Corn RhizosphereDVDGVGIGKFSPKTPAGIAAKVAQVKQQIAGGKIKDIPTIVK
Ga0207698_1007214853300026142Corn RhizosphereVDGVGIGKFSPKAPAGIAAKVAAVKQQIAAGKIKNIPTIVK
Ga0207698_1226408213300026142Corn RhizosphereLSIKDAQSGNFKGGQDAIYGLDQKGVGLGKFSPNAPAGIEAKVKKVQQDITSGKITDIPTTVQ
Ga0209806_101644853300026529SoilSIKDAKDGHFKGGQDSVYGLKVSGVGIGKFSPNAPKNIPSAVAKVEQEIVSGKISNIPTVVK
Ga0209474_1073646513300026550SoilKSGQFKGGQDAVYGLDQNGVGLGKFSPKAPKDIKPKVEAIERQIISGKIKNIPTIVK
Ga0265319_116809133300028563RhizosphereIGKFSPKAPKGIAAKVAKIKQEIVSGKITNIPTTVK
Ga0265318_1010046433300028577RhizosphereKGGQDSVYGLDVNGVGIGKFSPKAPKGIAAKVAKIKQEIVSGKITNIPTTVK
Ga0302299_1064240023300030010FenAKAGKFRGGTDSVYGLDVGGVGIGKFSVKAPAGIAAKVAAIKQQIASGKITNIPTTVK
Ga0265327_1011918433300031251RhizosphereDSVYGLDVAGVGIGKFSPKAPKGIAAKVAKIKQEIVSGKITNIPTTVK
Ga0265327_1014888233300031251RhizosphereRDAKAGKFKGGQDSVYGLDVNGVGIGKFSPKAPKGIAAKVAKIKQEIVSGKITNIPTTVK
Ga0318573_1028684423300031564SoilVYGLTQDGVGIGKFSRFAPKGIEEKVQQVKADIVSGKITNIPTVVK
Ga0318542_1042929423300031668SoilGKFSRFAPKGIEEKVQQVKADIVSGKITNIPTVVK
Ga0318574_1061670123300031680SoilGKFQGGRDTVYGLTQDGVGIGKFSRFAPKGIEEKVQQVKADIVSGKITNIPTVVK
Ga0265342_1004609613300031712RhizosphereGKFKGGQDSVYGLDVNGVGIGKFSPKAPKGIAAKVAKIKQEIVSGKITNIPTTVK
Ga0302321_10081460713300031726FenRGGTDSVYGLDVGGVGIGKFSVKAPAGIAAKVAAIKQQIASGKITNIPTTVK
Ga0308174_1013324813300031939SoilTDAVYGLDVNGVGIGRFSPKAPKGIAAKVAKVKQEIGSGKIKNIPTTVK
Ga0318531_1053653713300031981SoilRDTVYGLTQDGVGIGKFSRFAPKGIEEKVQQVKADIVSGKITNIPTVVK
Ga0308176_1181477913300031996SoilGKFSKKTPAGIEQKVEKIRRQIVSGKISNIPTTVK
Ga0308176_1294481123300031996SoilDAKAGNFKGGQDATYGLDVNGVGIGKFSSKTPAGIAAKVAQVKQQIASGKITDIPSVVK
Ga0310911_1065321223300032035SoilRDTVYGLTQDGVGIGRFSRFAPKGIEEKVQQVKADIVSGKITNIPTVVK
Ga0308173_1123890613300032074SoilDFKGGTDAVYGIDVNGVGIGKFSPKTPAGIAQKVAAVKQQVASGKIKNIPTIVK
Ga0307415_10094234433300032126RhizosphereAEADRFRGGSDAVYGLGQKGVGLGKFSAKAPAGIESKARAVQQQIVDGTITNIPTELGT
Ga0335070_1026331713300032829SoilHFTGGTDVTYGLQQNGVGIGVFSPKAPKGIAAKVNQVKVDIINGKITNIPTIVPGNG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.