Basic Information | |
---|---|
Family ID | F081054 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 114 |
Average Sequence Length | 49 residues |
Representative Sequence | XAVYGLDVAGVGIGKFSSKAPAGIAAKVAKIKQQIVSGKITNIPTTVK |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 114 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 97.37 % |
% of genes from short scaffolds (< 2000 bps) | 88.60 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.088 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (8.772 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.211 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.754 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.33% β-sheet: 0.00% Coil/Unstructured: 82.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 114 Family Scaffolds |
---|---|---|
PF01243 | Putative_PNPOx | 44.74 |
PF00202 | Aminotran_3 | 12.28 |
PF00892 | EamA | 7.02 |
PF01266 | DAO | 5.26 |
PF02597 | ThiS | 1.75 |
PF13417 | GST_N_3 | 0.88 |
PF00254 | FKBP_C | 0.88 |
PF00676 | E1_dh | 0.88 |
PF13520 | AA_permease_2 | 0.88 |
PF02608 | Bmp | 0.88 |
PF14559 | TPR_19 | 0.88 |
PF09335 | SNARE_assoc | 0.88 |
PF04316 | FlgM | 0.88 |
PF02786 | CPSase_L_D2 | 0.88 |
PF00355 | Rieske | 0.88 |
COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
---|---|---|---|
COG2747 | Negative regulator of flagellin synthesis (anti-sigma28 factor) | Transcription [K] | 2.63 |
COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 1.75 |
COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 1.75 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.88 |
COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.88 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.88 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.88 |
COG1744 | Lipoprotein Med, regulator of KinD/Spo0A, PBP1-ABC superfamily, includes NupN | Signal transduction mechanisms [T] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.09 % |
Unclassified | root | N/A | 14.91 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908039|B3_v_NODE_111134_len_1859_cov_6_284562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1909 | Open in IMG/M |
2124908043|A2_c1_ConsensusfromContig49608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
2170459007|GJ8XV2H01A9GDE | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
2189573002|GZIGXIF01DZ791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
3300001538|A10PFW1_11558774 | Not Available | 627 | Open in IMG/M |
3300002568|C688J35102_119065139 | Not Available | 633 | Open in IMG/M |
3300004153|Ga0063455_100913713 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300004463|Ga0063356_105234621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
3300005173|Ga0066822_1006455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
3300005327|Ga0070658_10411410 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
3300005327|Ga0070658_11743385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
3300005329|Ga0070683_100024080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5448 | Open in IMG/M |
3300005336|Ga0070680_101266316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
3300005344|Ga0070661_100877239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 740 | Open in IMG/M |
3300005434|Ga0070709_11301996 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300005434|Ga0070709_11777139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
3300005436|Ga0070713_100424741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1245 | Open in IMG/M |
3300005436|Ga0070713_102118848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
3300005439|Ga0070711_100425594 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300005458|Ga0070681_10789459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 866 | Open in IMG/M |
3300005547|Ga0070693_101516553 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300005587|Ga0066654_10381432 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300005614|Ga0068856_100461651 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
3300005616|Ga0068852_100087146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2785 | Open in IMG/M |
3300005764|Ga0066903_103022202 | Not Available | 911 | Open in IMG/M |
3300005764|Ga0066903_106705914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
3300006804|Ga0079221_10586923 | Not Available | 747 | Open in IMG/M |
3300006854|Ga0075425_101836180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
3300009093|Ga0105240_11817707 | Not Available | 635 | Open in IMG/M |
3300009093|Ga0105240_12406722 | Not Available | 545 | Open in IMG/M |
3300009137|Ga0066709_100430662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1839 | Open in IMG/M |
3300009148|Ga0105243_11367221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
3300009545|Ga0105237_11908788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
3300009551|Ga0105238_10122419 | All Organisms → cellular organisms → Bacteria | 2581 | Open in IMG/M |
3300010040|Ga0126308_10708015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
3300010329|Ga0134111_10461787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
3300010333|Ga0134080_10146567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 998 | Open in IMG/M |
3300010366|Ga0126379_11290497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 836 | Open in IMG/M |
3300012010|Ga0120118_1017377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1982 | Open in IMG/M |
3300012011|Ga0120152_1099002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 830 | Open in IMG/M |
3300012210|Ga0137378_11489003 | Not Available | 588 | Open in IMG/M |
3300012955|Ga0164298_10430299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 862 | Open in IMG/M |
3300012955|Ga0164298_10473489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
3300012957|Ga0164303_11561789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
3300012984|Ga0164309_11242873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
3300012985|Ga0164308_11054840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
3300012989|Ga0164305_11475448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
3300013104|Ga0157370_10116867 | All Organisms → cellular organisms → Bacteria | 2492 | Open in IMG/M |
3300013104|Ga0157370_10222651 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
3300013104|Ga0157370_12058524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
3300013105|Ga0157369_12525259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
3300013296|Ga0157374_12588008 | Not Available | 535 | Open in IMG/M |
3300013307|Ga0157372_11277901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 847 | Open in IMG/M |
3300013765|Ga0120172_1097971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 713 | Open in IMG/M |
3300013772|Ga0120158_10057003 | All Organisms → cellular organisms → Bacteria | 2640 | Open in IMG/M |
3300014058|Ga0120149_1225798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
3300014325|Ga0163163_11076335 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300015171|Ga0167648_1004659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3499 | Open in IMG/M |
3300015245|Ga0137409_11439806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300015374|Ga0132255_100265771 | All Organisms → cellular organisms → Bacteria | 2457 | Open in IMG/M |
3300015374|Ga0132255_104352027 | Not Available | 600 | Open in IMG/M |
3300016404|Ga0182037_11716616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
3300018431|Ga0066655_10860207 | Not Available | 618 | Open in IMG/M |
3300018468|Ga0066662_12830306 | Not Available | 515 | Open in IMG/M |
3300020070|Ga0206356_10530626 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
3300020078|Ga0206352_10744985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
3300020081|Ga0206354_10072590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1091 | Open in IMG/M |
3300021384|Ga0213876_10377832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 754 | Open in IMG/M |
3300021384|Ga0213876_10606051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
3300022467|Ga0224712_10253931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 813 | Open in IMG/M |
3300022467|Ga0224712_10424452 | Not Available | 636 | Open in IMG/M |
3300022756|Ga0222622_10615151 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300025321|Ga0207656_10287351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 812 | Open in IMG/M |
3300025906|Ga0207699_11470718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
3300025911|Ga0207654_10854088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
3300025912|Ga0207707_10616426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 917 | Open in IMG/M |
3300025913|Ga0207695_10491822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1109 | Open in IMG/M |
3300025913|Ga0207695_10497680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1101 | Open in IMG/M |
3300025913|Ga0207695_11125744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
3300025917|Ga0207660_11043922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
3300025928|Ga0207700_10437821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1150 | Open in IMG/M |
3300025928|Ga0207700_10947656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
3300025928|Ga0207700_11842521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300025929|Ga0207664_10740052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 884 | Open in IMG/M |
3300025931|Ga0207644_11308673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
3300025944|Ga0207661_10433399 | Not Available | 1195 | Open in IMG/M |
3300025944|Ga0207661_10580105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
3300025945|Ga0207679_12170884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
3300026041|Ga0207639_10357129 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
3300026078|Ga0207702_10080222 | All Organisms → cellular organisms → Bacteria | 2831 | Open in IMG/M |
3300026142|Ga0207698_10072148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2743 | Open in IMG/M |
3300026142|Ga0207698_12264082 | Not Available | 556 | Open in IMG/M |
3300026529|Ga0209806_1016448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3856 | Open in IMG/M |
3300026550|Ga0209474_10736465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
3300028563|Ga0265319_1168091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 677 | Open in IMG/M |
3300028577|Ga0265318_10100464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1064 | Open in IMG/M |
3300030010|Ga0302299_10642400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
3300031251|Ga0265327_10119184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1252 | Open in IMG/M |
3300031251|Ga0265327_10148882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1088 | Open in IMG/M |
3300031564|Ga0318573_10286844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 880 | Open in IMG/M |
3300031668|Ga0318542_10429294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
3300031680|Ga0318574_10616701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
3300031712|Ga0265342_10046096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2621 | Open in IMG/M |
3300031726|Ga0302321_100814607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1054 | Open in IMG/M |
3300031939|Ga0308174_10133248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1829 | Open in IMG/M |
3300031981|Ga0318531_10536537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
3300031996|Ga0308176_11814779 | Not Available | 651 | Open in IMG/M |
3300031996|Ga0308176_12944811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
3300032035|Ga0310911_10653212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
3300032074|Ga0308173_11238906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 698 | Open in IMG/M |
3300032126|Ga0307415_100942344 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300032829|Ga0335070_10263317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1685 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.77% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 7.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.14% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 6.14% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.14% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 5.26% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 4.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.39% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.39% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 4.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.51% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.63% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.63% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.63% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.75% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.75% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.75% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.75% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.75% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.88% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.88% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.88% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.88% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.88% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.88% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.88% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.88% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.88% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.88% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.88% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908039 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4 | Environmental | Open in IMG/M |
2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005173 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMA | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015171 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B3_v_00845260 | 2124908039 | Soil | XAVYGLDVAGVGIGKFSSKAPAGIAAKVAKIKQQIVSGKITNIPTTVK |
A2_c1_00752250 | 2124908043 | Soil | GNFSPKTPKGIEAKTKQIEQQIVAGKIKNIPTTVK |
L02_00091700 | 2170459007 | Grass Soil | VGIGKFSPKTPAGIAAKVAVIKQQIASGKITNIPTTVK |
FE1_00640970 | 2189573002 | Grass Soil | LDIGGVGIGKFSPKTPAGIAAKVAVIKQQIASGKITNIPTTVK |
A10PFW1_115587743 | 3300001538 | Permafrost | GVGLGKFSPKAPKGIEAKVKQIEQQIIDGKIANIPTTVK* |
C688J35102_1190651391 | 3300002568 | Soil | DAQSGNFKGGQDAVYGLDKKGVGLGKFSPNAPAGIEAKVKKIQQQITSGAIKNIPTTVQ* |
C688J35102_1206593151 | 3300002568 | Soil | DAQAGKFKGGQDAVYGIKDDGVGIGKFSSDAPKGIPASVATVKQHIVGGKINDIPTIVK* |
Ga0063455_1009137131 | 3300004153 | Soil | VFLSIKDAQAGNFKGGQDAVYGLDKKGVGLGKFSPDTPAGIEAKVKKIQQDITSGKIKNIPTVVP* |
Ga0063356_1052346211 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AQNGVGLGKFSPKTPAGIPAKVKAIRQQIIDGKIKHIPTEIAG* |
Ga0066822_10064551 | 3300005173 | Soil | EQKGVGLGKFSAKAPAGIEQKVLQIEQQIIDGKIPNIPTTVK* |
Ga0070658_104114102 | 3300005327 | Corn Rhizosphere | NFKGGQDAVYGLDVDGVGIGKFSAKAPAGIADKVAQIKQQIADGKIKNIPTIVK* |
Ga0070658_117433851 | 3300005327 | Corn Rhizosphere | GGQDAVYGIKDEGVGIGKFSTKTPKGIAAKVDAIKAQIVSGKITNIPTTVVK* |
Ga0070683_1000240806 | 3300005329 | Corn Rhizosphere | DAVYGLDVNGVGIGKFSAKAPAGIADKVAQIKQQIADGKIKNIPTIVK* |
Ga0070680_1012663162 | 3300005336 | Corn Rhizosphere | IDVNGVGIGKFSPKAPKGIAAKVAKVKQQIASGKIANIPTTVK* |
Ga0070661_1008772391 | 3300005344 | Corn Rhizosphere | DGVGIGKFSPKTPKGIAAKVAAIKAQILSGKITNIPTTVK* |
Ga0070709_113019962 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | DAKDGHFKGGQDAVYGLDVNGVGIGKFSPKAPAGIAAKVAQIREQIADGKIKNIPTIVK* |
Ga0070709_117771391 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LSIKDAHAGHFKGGQDSVYGLEQNGVGLGKFSAKAPPGIERKVSQIERQIIAGKITNIPTTVK* |
Ga0070713_1004247413 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LDVGGVGIGKFSPKTPAGVAAKVAAIKQQIAAGKIANIPTTVK* |
Ga0070713_1021188482 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | DDGVGIGKFSPNAPKDIAAQVDKVKQQIVSGKITNIPTVVK* |
Ga0070711_1004255943 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | FKGGQDSVYGLEQNGVGLGKFSAKAPPGIERKVSQIERQIIAGKITNIPTTVK* |
Ga0070681_107894592 | 3300005458 | Corn Rhizosphere | QDAVYGLDVNGVGIGKFSAKAPAGIADKVAQIKQQIADGKIKNIPTIVK* |
Ga0070693_1015165532 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | KGGQDAVYGLEVNGVGIGKFSAKAPAGIADKVEQIKQQIADGKIKNIPTTVS* |
Ga0066654_103814322 | 3300005587 | Soil | FDSIRDAKSGHFKGGQDAVYGLKDQGVGIGKFSPAAPKGIAAKVAAVKQQIVSGKIADIPTIVK* |
Ga0068856_1004616513 | 3300005614 | Corn Rhizosphere | QDAVYGLDVNGVGIGKFSSKTPAGIAAKVAQVKQQIADGKIKNIPTIVK* |
Ga0068852_1000871461 | 3300005616 | Corn Rhizosphere | GKFKGGTDAVYGLDVDGVGIGKFSPKAPAGIAAKVAAVKQQIAAGKIKNIPTIVK* |
Ga0066903_1030222021 | 3300005764 | Tropical Forest Soil | EQNGVGLGKFSPKTPKGIEAKVDQIRQDIVSGKIKNIPTTVP* |
Ga0066903_1067059143 | 3300005764 | Tropical Forest Soil | IGKFSPKAPAGIEDKVNAVKQQIKDGKITNIPTTVK* |
Ga0079221_105869231 | 3300006804 | Agricultural Soil | KGGQDAVYGLEQKGVGLGKFSPKAPKSIRPDVEKIEQQIISGKIKNIPTTLK* |
Ga0075425_1018361801 | 3300006854 | Populus Rhizosphere | GKFSSAAPKGIQAKVNAVKQQILDGKITDIPTTVQ* |
Ga0105240_118177072 | 3300009093 | Corn Rhizosphere | EGKFKGGTDATYGLKQGGVGLGKFSPQTPAGIEAKVEKIRQQIVAGTITGIPTTVK* |
Ga0105240_124067221 | 3300009093 | Corn Rhizosphere | KGGTDAVYGLDKHGVGLGKFSPKAPAGIEAKVKQIEQQIVSGKIKNIPTIVP* |
Ga0066709_1004306623 | 3300009137 | Grasslands Soil | VDTAVFLAIKDAKEGHFKGGQDAVYGLEQKGVGVGTFSPKAPKTIKPKVLEIEKEIINGKIKNIPTTVK* |
Ga0105243_113672212 | 3300009148 | Miscanthus Rhizosphere | GLNQQGVGLVVFSPKTPAGIEAKVKKIQADITSRKIKNIPTTVQ* |
Ga0105237_119087881 | 3300009545 | Corn Rhizosphere | KGGQDAVYGIKDDGVGIGKFSPKTPKGIAAKVAAIKAQIISGKITNIPTIVK* |
Ga0105238_101224193 | 3300009551 | Corn Rhizosphere | GIGKFSPKAPAGIAAKVAQIRQQIADGKIKNIPTIVK* |
Ga0126308_107080152 | 3300010040 | Serpentine Soil | YGLGQKGVGLGKFSPKAPPGLAQKVKAVQQQIVAGKITNIPTEIGT* |
Ga0134111_104617871 | 3300010329 | Grasslands Soil | GVGLGKFSRKAAKGIEAKTKRIEQQIISGKIKNIPTTVK* |
Ga0134080_101465672 | 3300010333 | Grasslands Soil | LKGVDRAVFLAIKDAQSGKFKGGQDAIYGLDKKGVGLGKFSPKAPAGIEAKVKQIQQQITSGKITNIPTTVK* |
Ga0126379_112904971 | 3300010366 | Tropical Forest Soil | GGKDTVYGLDVDGVGIGKFSPKAPAGIEDKVNAVKQQIKDGKITNIPTTVK* |
Ga0120118_10173774 | 3300012010 | Permafrost | GVGLGKFSPKAPKGIEAKTKQIEQQIIDGKIANIPTTVK* |
Ga0120152_10990023 | 3300012011 | Permafrost | EQKGVGLGKFSPKAPKGIEAKTKQIEQQIIDGKIGNIPTTVK* |
Ga0137378_114890031 | 3300012210 | Vadose Zone Soil | GVGLGKFSRKAPKGIETKVKRIEQQIIDGKIANIPTTVK* |
Ga0164298_104302993 | 3300012955 | Soil | GGQDAVYGLKDEGVGIGKFSTKTPKGVAAKVDAIKAQIVSGKITNIPTTVLK* |
Ga0164298_104734891 | 3300012955 | Soil | GGRDAVYGLDVNGVGIGKFSAKAPAGIADKVAQIKQQIADGKIKNIPTIVK* |
Ga0164303_114636502 | 3300012957 | Soil | GQDTVYGLQDDGVGIGKFSVEAAAVIDDKVEAVKQQIIDGKITNIPTTVK* |
Ga0164303_115617891 | 3300012957 | Soil | QQGVGLGVFSPKAPAGIEAKVKKIQADISSGKIKNIPTTVQ* |
Ga0164309_112428732 | 3300012984 | Soil | YLSIKDAHAGHFKGGQDSVYGLEQNGVGLGKFSAKAPPGIERKVSQIERQIIAGKITNIPTTVK* |
Ga0164308_110548402 | 3300012985 | Soil | LKDEGVGIGKFSTKTPKGVAAKVDAIKAQIVSGKITNIPTTVLK* |
Ga0164305_114754482 | 3300012989 | Soil | EQKGVGLGKFSPKAPKDIEAKVLKIEQQIVDGKITNIPTTVK* |
Ga0157370_101168673 | 3300013104 | Corn Rhizosphere | GKFSPKAPAGIAAKVAQIRQQIADGKIKNIPTIVK* |
Ga0157370_102226511 | 3300013104 | Corn Rhizosphere | GIGKFSPKTPAGIAAKVAQVKQQIARGKIKDIPTIVK* |
Ga0157370_120585241 | 3300013104 | Corn Rhizosphere | DAVYGLDVNGVGIGKFSPKAPAGIAAKVQQVKQQIADGKIKNIPTIVK* |
Ga0157369_125252591 | 3300013105 | Corn Rhizosphere | DAVYGIKDEGVGIGKFSTKTPKGIAAKVDAIKAQIVSGKITNIPTTVVK* |
Ga0157374_125880081 | 3300013296 | Miscanthus Rhizosphere | YAVYGLTQDGVGIGKFSANAPAGIAAKVAAIKSQIASGKIANIPTVVK* |
Ga0157372_112779012 | 3300013307 | Corn Rhizosphere | DVNGVGIGKFSPKAPAGIAAKVAQIRQQIADGKIKNIPTIVK* |
Ga0120172_10979711 | 3300013765 | Permafrost | FKGGHDAVYGLAQKGVGLGKFSPKAPKGIEAKTKQIEQQIVDGKITNIPTTVK* |
Ga0120158_100570034 | 3300013772 | Permafrost | FKGGTDAVYGLDIAGVGIGKFSSKAPKGIAAKVLQIKQQIASGKITNIPTTVK* |
Ga0120149_12257982 | 3300014058 | Permafrost | YGLDIAGVGIGKFSSKAPKGIAAKVLQIKQQIASGKITNIPTTVK* |
Ga0163163_110763353 | 3300014325 | Switchgrass Rhizosphere | DKKGVGLGKFSPKTPAGIEAKTKKILHDIVSGKIKNIPTTVQ* |
Ga0167648_10046591 | 3300015171 | Glacier Forefield Soil | FKGGQDAVYGLKDEGVGIGKFSTKAPKGVAAKVAAIKAKIVSGKFANIATTVK* |
Ga0137409_114398062 | 3300015245 | Vadose Zone Soil | GKFSPRAPKGIPAKVQQIKAQIIAGKIKNIPTTVK* |
Ga0132255_1002657711 | 3300015374 | Arabidopsis Rhizosphere | QEGVGLGKFSPAAPKDIEPKVREIEQQIKDGKIKSIPTTVS* |
Ga0132255_1043520271 | 3300015374 | Arabidopsis Rhizosphere | QDAVYGLDQKGVGLGKFSPNAPAGIEAKVKKIQHDIVSGKITNIPTTVQ* |
Ga0182037_117166161 | 3300016404 | Soil | IGKFSRFAPKGIEEKVQQVKADIVSGKITNIPTVVK |
Ga0066655_108602071 | 3300018431 | Grasslands Soil | VYGLEQKGVGVGTFSPNAPKTIKPKVLEIEKEIINGKIKNIPTTVK |
Ga0066662_128303061 | 3300018468 | Grasslands Soil | TDEESDAVYDAIRDAKTGHFKGGKDAVYGLSVDGVGIGKFSSRAPKGIAAKVGAVRQRIADGKLEHIPTTVK |
Ga0206356_105306261 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | YGLDVNGVGIGKFSPKAPAGIAAKVAQIRQQIADGKIKNIPTIVR |
Ga0206352_107449851 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | IKSAKAGKFKGGTDAVYGLDVDGVGIGKFSPKAPAGIAAKVAAVKQQIAAGKIKNIPTIV |
Ga0206354_100725902 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | KEGHFKGGTDAVYGLDKHGVGLGKFSPKAPAGIEAKVKQIEQQIVSGKIKNIPTIVP |
Ga0213876_103778323 | 3300021384 | Plant Roots | KFKGGQDAVYGLDVDGVGIGKFSSKAPAGIAQKVAQVKQQIASGKIKNIPTTVK |
Ga0213876_106060511 | 3300021384 | Plant Roots | GIGKFSSKAPAGIAQKVAQVRQEIASGKIKNIPTTVK |
Ga0224712_102539313 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VGLGKFSSKTPAGIEIKVDQIRKQIIDGKISNIPTTVK |
Ga0224712_104244521 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VYGLDKGGVGLGKFSPKTPAGIEIKVDQIRKQIVDGKIKDIPTTVK |
Ga0222622_106151513 | 3300022756 | Groundwater Sediment | LDQKGVGLGKFSPNAPAGIEAKVKKIQQDITSGKITNIPTTVQ |
Ga0207656_102873512 | 3300025321 | Corn Rhizosphere | DVNGVGIGKFSAKAPAGIADKVAQIKQQIADGKIKNIPTIVK |
Ga0207699_114707182 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LSIKDAHAGHFKGGQDSVYGLEQNGVGLGKFSAKAPPGIERKVSQIERQIIAGKITNIPTTVK |
Ga0207654_108540882 | 3300025911 | Corn Rhizosphere | GGEDAVYGLDVDGVGIGKFSAKTPAGIADKVQQIKQQIADGKIKNIPTIVK |
Ga0207707_106164263 | 3300025912 | Corn Rhizosphere | KDAKAGNFKGGTDAVYGLDVDGVGIGKFSPKAPTGMAAKVAAVKKQIADGTIKNIPTIVK |
Ga0207695_104918221 | 3300025913 | Corn Rhizosphere | GVGLVKFSPKTPAGIESKVKKVEQQIISGKIKNIPTIVP |
Ga0207695_104976801 | 3300025913 | Corn Rhizosphere | VNGVGIGKFSPKAPAGIAAKVAQIREQIADGKIKNIPTIVK |
Ga0207695_111257441 | 3300025913 | Corn Rhizosphere | LDVDGVGIGKFSPKTPAGIAAKVAQVKQQIAGGKIKDIPTIVK |
Ga0207660_110439223 | 3300025917 | Corn Rhizosphere | DAVYGIDVNGVGIGKFSPKAPKGIAAKVAKVKQQIASGKIANIPTTVK |
Ga0207700_104378213 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | DTAVYDSIRDAKAGKFKGGTDSIYVLDVGGVGIGKFSPKTPAGVAAKVAAIKQQIAAGKIANIPTTVK |
Ga0207700_109476561 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GLKDDGVGIGKFSPNAPKDIAAQVDKVKQQIVSGKITNIPTVVK |
Ga0207700_118425212 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | YGLDQKGVGLGKFSPKAPAGIEAKVKKIQQDITSGKIKNIPTTVQ |
Ga0207664_107400523 | 3300025929 | Agricultural Soil | NGVALGKFSPKTPAGIAAKVNKIRDEIVSGKITNIPTTVK |
Ga0207644_113086731 | 3300025931 | Switchgrass Rhizosphere | YGLNQQGVGLGVFSPKTPAGIEAKVKKIQADITSRKIKNIPTTVQ |
Ga0207661_104333991 | 3300025944 | Corn Rhizosphere | VGIGKFSAKAPAGIADKVAQIKQQIADGKIKNIPTIVK |
Ga0207661_105801051 | 3300025944 | Corn Rhizosphere | AKAGNFKGGTDAVYGLDVDGVGIGKFSPKAPTGMAAKVAAVKKQIADGTIKNIPTIVK |
Ga0207679_121708842 | 3300025945 | Corn Rhizosphere | VYGLDVNGVGIGKFSSKTPAGIAAKVAQVKQQIADGKIKNIPTIVK |
Ga0207639_103571291 | 3300026041 | Corn Rhizosphere | GGEDAVYGLDVDGVGIGKFSPKTPAGIAAKVAQVKQQIAGGKIKDIPTIVK |
Ga0207702_100802224 | 3300026078 | Corn Rhizosphere | DVDGVGIGKFSPKTPAGIAAKVAQVKQQIAGGKIKDIPTIVK |
Ga0207698_100721485 | 3300026142 | Corn Rhizosphere | VDGVGIGKFSPKAPAGIAAKVAAVKQQIAAGKIKNIPTIVK |
Ga0207698_122640821 | 3300026142 | Corn Rhizosphere | LSIKDAQSGNFKGGQDAIYGLDQKGVGLGKFSPNAPAGIEAKVKKVQQDITSGKITDIPTTVQ |
Ga0209806_10164485 | 3300026529 | Soil | SIKDAKDGHFKGGQDSVYGLKVSGVGIGKFSPNAPKNIPSAVAKVEQEIVSGKISNIPTVVK |
Ga0209474_107364651 | 3300026550 | Soil | KSGQFKGGQDAVYGLDQNGVGLGKFSPKAPKDIKPKVEAIERQIISGKIKNIPTIVK |
Ga0265319_11680913 | 3300028563 | Rhizosphere | IGKFSPKAPKGIAAKVAKIKQEIVSGKITNIPTTVK |
Ga0265318_101004643 | 3300028577 | Rhizosphere | KGGQDSVYGLDVNGVGIGKFSPKAPKGIAAKVAKIKQEIVSGKITNIPTTVK |
Ga0302299_106424002 | 3300030010 | Fen | AKAGKFRGGTDSVYGLDVGGVGIGKFSVKAPAGIAAKVAAIKQQIASGKITNIPTTVK |
Ga0265327_101191843 | 3300031251 | Rhizosphere | DSVYGLDVAGVGIGKFSPKAPKGIAAKVAKIKQEIVSGKITNIPTTVK |
Ga0265327_101488823 | 3300031251 | Rhizosphere | RDAKAGKFKGGQDSVYGLDVNGVGIGKFSPKAPKGIAAKVAKIKQEIVSGKITNIPTTVK |
Ga0318573_102868442 | 3300031564 | Soil | VYGLTQDGVGIGKFSRFAPKGIEEKVQQVKADIVSGKITNIPTVVK |
Ga0318542_104292942 | 3300031668 | Soil | GKFSRFAPKGIEEKVQQVKADIVSGKITNIPTVVK |
Ga0318574_106167012 | 3300031680 | Soil | GKFQGGRDTVYGLTQDGVGIGKFSRFAPKGIEEKVQQVKADIVSGKITNIPTVVK |
Ga0265342_100460961 | 3300031712 | Rhizosphere | GKFKGGQDSVYGLDVNGVGIGKFSPKAPKGIAAKVAKIKQEIVSGKITNIPTTVK |
Ga0302321_1008146071 | 3300031726 | Fen | RGGTDSVYGLDVGGVGIGKFSVKAPAGIAAKVAAIKQQIASGKITNIPTTVK |
Ga0308174_101332481 | 3300031939 | Soil | TDAVYGLDVNGVGIGRFSPKAPKGIAAKVAKVKQEIGSGKIKNIPTTVK |
Ga0318531_105365371 | 3300031981 | Soil | RDTVYGLTQDGVGIGKFSRFAPKGIEEKVQQVKADIVSGKITNIPTVVK |
Ga0308176_118147791 | 3300031996 | Soil | GKFSKKTPAGIEQKVEKIRRQIVSGKISNIPTTVK |
Ga0308176_129448112 | 3300031996 | Soil | DAKAGNFKGGQDATYGLDVNGVGIGKFSSKTPAGIAAKVAQVKQQIASGKITDIPSVVK |
Ga0310911_106532122 | 3300032035 | Soil | RDTVYGLTQDGVGIGRFSRFAPKGIEEKVQQVKADIVSGKITNIPTVVK |
Ga0308173_112389061 | 3300032074 | Soil | DFKGGTDAVYGIDVNGVGIGKFSPKTPAGIAQKVAAVKQQVASGKIKNIPTIVK |
Ga0307415_1009423443 | 3300032126 | Rhizosphere | AEADRFRGGSDAVYGLGQKGVGLGKFSAKAPAGIESKARAVQQQIVDGTITNIPTELGT |
Ga0335070_102633171 | 3300032829 | Soil | HFTGGTDVTYGLQQNGVGIGVFSPKAPKGIAAKVNQVKVDIINGKITNIPTIVPGNG |
⦗Top⦘ |