| Basic Information | |
|---|---|
| Family ID | F081049 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MTAADRIIRWSTAGAVIGVAAVAAVASYEHAYDLVRAH |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.71 % |
| % of genes near scaffold ends (potentially truncated) | 80.70 % |
| % of genes from short scaffolds (< 2000 bps) | 77.19 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.789 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (35.088 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.579 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (37.719 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF13408 | Zn_ribbon_recom | 4.39 |
| PF00355 | Rieske | 3.51 |
| PF00589 | Phage_integrase | 2.63 |
| PF01965 | DJ-1_PfpI | 1.75 |
| PF10935 | DUF2637 | 1.75 |
| PF14013 | MT0933_antitox | 1.75 |
| PF00271 | Helicase_C | 1.75 |
| PF03853 | YjeF_N | 1.75 |
| PF01641 | SelR | 1.75 |
| PF08281 | Sigma70_r4_2 | 1.75 |
| PF13474 | SnoaL_3 | 1.75 |
| PF01176 | eIF-1a | 0.88 |
| PF13534 | Fer4_17 | 0.88 |
| PF01872 | RibD_C | 0.88 |
| PF14117 | DUF4287 | 0.88 |
| PF02687 | FtsX | 0.88 |
| PF08241 | Methyltransf_11 | 0.88 |
| PF01548 | DEDD_Tnp_IS110 | 0.88 |
| PF08240 | ADH_N | 0.88 |
| PF12697 | Abhydrolase_6 | 0.88 |
| PF07883 | Cupin_2 | 0.88 |
| PF12051 | DUF3533 | 0.88 |
| PF01527 | HTH_Tnp_1 | 0.88 |
| PF07366 | SnoaL | 0.88 |
| PF13185 | GAF_2 | 0.88 |
| PF01844 | HNH | 0.88 |
| PF04237 | YjbR | 0.88 |
| PF03860 | DUF326 | 0.88 |
| PF13191 | AAA_16 | 0.88 |
| PF00196 | GerE | 0.88 |
| PF13847 | Methyltransf_31 | 0.88 |
| PF04101 | Glyco_tran_28_C | 0.88 |
| PF00175 | NAD_binding_1 | 0.88 |
| PF02945 | Endonuclease_7 | 0.88 |
| PF01402 | RHH_1 | 0.88 |
| PF14362 | DUF4407 | 0.88 |
| PF13450 | NAD_binding_8 | 0.88 |
| PF13466 | STAS_2 | 0.88 |
| PF00872 | Transposase_mut | 0.88 |
| PF00067 | p450 | 0.88 |
| PF07969 | Amidohydro_3 | 0.88 |
| PF00248 | Aldo_ket_red | 0.88 |
| PF13692 | Glyco_trans_1_4 | 0.88 |
| PF13607 | Succ_CoA_lig | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0062 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domain | Nucleotide transport and metabolism [F] | 1.75 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 1.75 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.88 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.88 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.88 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.88 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.88 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.54 % |
| Unclassified | root | N/A | 32.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003219|JGI26341J46601_10224314 | Not Available | 505 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10196376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
| 3300005366|Ga0070659_100399567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1160 | Open in IMG/M |
| 3300005436|Ga0070713_100074536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2875 | Open in IMG/M |
| 3300005437|Ga0070710_11479991 | Not Available | 510 | Open in IMG/M |
| 3300005458|Ga0070681_10093613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2954 | Open in IMG/M |
| 3300005458|Ga0070681_11811800 | Not Available | 537 | Open in IMG/M |
| 3300005577|Ga0068857_102184907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 543 | Open in IMG/M |
| 3300005921|Ga0070766_11322097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 500 | Open in IMG/M |
| 3300006804|Ga0079221_11800733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
| 3300006864|Ga0066797_1004570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4503 | Open in IMG/M |
| 3300009665|Ga0116135_1161259 | Not Available | 842 | Open in IMG/M |
| 3300010048|Ga0126373_11761053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. 852002-50816_SCH5313054-b | 683 | Open in IMG/M |
| 3300010048|Ga0126373_12444605 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300010159|Ga0099796_10208502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 796 | Open in IMG/M |
| 3300010396|Ga0134126_10460020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1471 | Open in IMG/M |
| 3300012096|Ga0137389_11075847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 689 | Open in IMG/M |
| 3300012210|Ga0137378_11446060 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300012361|Ga0137360_11731630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 530 | Open in IMG/M |
| 3300012987|Ga0164307_10946789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 697 | Open in IMG/M |
| 3300013105|Ga0157369_11651397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 651 | Open in IMG/M |
| 3300016357|Ga0182032_10786921 | Not Available | 803 | Open in IMG/M |
| 3300016404|Ga0182037_11230789 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 658 | Open in IMG/M |
| 3300016422|Ga0182039_12210017 | Not Available | 508 | Open in IMG/M |
| 3300017821|Ga0187812_1000427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14835 | Open in IMG/M |
| 3300017821|Ga0187812_1011652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3049 | Open in IMG/M |
| 3300017924|Ga0187820_1213370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 607 | Open in IMG/M |
| 3300017928|Ga0187806_1203589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 671 | Open in IMG/M |
| 3300017933|Ga0187801_10303229 | Not Available | 650 | Open in IMG/M |
| 3300017955|Ga0187817_10372334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 911 | Open in IMG/M |
| 3300018012|Ga0187810_10104561 | Not Available | 1114 | Open in IMG/M |
| 3300018044|Ga0187890_10749730 | Not Available | 552 | Open in IMG/M |
| 3300020075|Ga0206349_1977607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 822 | Open in IMG/M |
| 3300020077|Ga0206351_10435179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1359 | Open in IMG/M |
| 3300020582|Ga0210395_10638676 | Not Available | 798 | Open in IMG/M |
| 3300021088|Ga0210404_10197910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1076 | Open in IMG/M |
| 3300021170|Ga0210400_10979339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii | 688 | Open in IMG/M |
| 3300021178|Ga0210408_11026374 | Not Available | 637 | Open in IMG/M |
| 3300021406|Ga0210386_10419222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1155 | Open in IMG/M |
| 3300021406|Ga0210386_10547293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1000 | Open in IMG/M |
| 3300021406|Ga0210386_11237559 | Not Available | 630 | Open in IMG/M |
| 3300021406|Ga0210386_11736049 | Not Available | 515 | Open in IMG/M |
| 3300021478|Ga0210402_11218908 | Not Available | 680 | Open in IMG/M |
| 3300021478|Ga0210402_11526234 | Not Available | 595 | Open in IMG/M |
| 3300025898|Ga0207692_10410629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 846 | Open in IMG/M |
| 3300025906|Ga0207699_10865229 | Not Available | 666 | Open in IMG/M |
| 3300025908|Ga0207643_10892546 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300025910|Ga0207684_10331602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1311 | Open in IMG/M |
| 3300025912|Ga0207707_11224470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
| 3300025913|Ga0207695_10390649 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15 | 1276 | Open in IMG/M |
| 3300025915|Ga0207693_10096862 | Not Available | 2313 | Open in IMG/M |
| 3300025915|Ga0207693_10099383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2282 | Open in IMG/M |
| 3300025916|Ga0207663_10086961 | All Organisms → cellular organisms → Bacteria | 2063 | Open in IMG/M |
| 3300025917|Ga0207660_10651552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 859 | Open in IMG/M |
| 3300025920|Ga0207649_10620801 | Not Available | 833 | Open in IMG/M |
| 3300025929|Ga0207664_10139325 | All Organisms → cellular organisms → Bacteria | 2050 | Open in IMG/M |
| 3300025939|Ga0207665_11123401 | Not Available | 627 | Open in IMG/M |
| 3300026927|Ga0207744_1004429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1502 | Open in IMG/M |
| 3300027619|Ga0209330_1124598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
| 3300028021|Ga0265352_1005059 | Not Available | 752 | Open in IMG/M |
| 3300028573|Ga0265334_10302554 | Not Available | 547 | Open in IMG/M |
| 3300028742|Ga0302220_10347397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura meyerae | 535 | Open in IMG/M |
| 3300028800|Ga0265338_11008859 | Not Available | 563 | Open in IMG/M |
| 3300028801|Ga0302226_10433237 | Not Available | 549 | Open in IMG/M |
| 3300028879|Ga0302229_10406588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 605 | Open in IMG/M |
| 3300030007|Ga0311338_10831346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 916 | Open in IMG/M |
| 3300030580|Ga0311355_11551290 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300031027|Ga0302308_10842809 | Not Available | 508 | Open in IMG/M |
| 3300031234|Ga0302325_12266473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 658 | Open in IMG/M |
| 3300031543|Ga0318516_10005521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5759 | Open in IMG/M |
| 3300031543|Ga0318516_10054687 | All Organisms → cellular organisms → Bacteria | 2180 | Open in IMG/M |
| 3300031679|Ga0318561_10260838 | Not Available | 945 | Open in IMG/M |
| 3300031715|Ga0307476_10186133 | Not Available | 1503 | Open in IMG/M |
| 3300031723|Ga0318493_10044716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2074 | Open in IMG/M |
| 3300031736|Ga0318501_10018025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2910 | Open in IMG/M |
| 3300031751|Ga0318494_10643122 | Not Available | 620 | Open in IMG/M |
| 3300031778|Ga0318498_10083312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1444 | Open in IMG/M |
| 3300031778|Ga0318498_10253361 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 793 | Open in IMG/M |
| 3300031779|Ga0318566_10002086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6685 | Open in IMG/M |
| 3300031780|Ga0318508_1087773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 856 | Open in IMG/M |
| 3300031798|Ga0318523_10101202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1413 | Open in IMG/M |
| 3300031799|Ga0318565_10086364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1495 | Open in IMG/M |
| 3300031805|Ga0318497_10230218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1026 | Open in IMG/M |
| 3300031805|Ga0318497_10251411 | Not Available | 980 | Open in IMG/M |
| 3300031823|Ga0307478_10577988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 939 | Open in IMG/M |
| 3300031845|Ga0318511_10568794 | Not Available | 527 | Open in IMG/M |
| 3300031879|Ga0306919_10048095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2807 | Open in IMG/M |
| 3300031879|Ga0306919_10515981 | Not Available | 921 | Open in IMG/M |
| 3300031894|Ga0318522_10430463 | Not Available | 500 | Open in IMG/M |
| 3300031910|Ga0306923_10003207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15279 | Open in IMG/M |
| 3300031941|Ga0310912_10358467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1133 | Open in IMG/M |
| 3300031941|Ga0310912_10672093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 804 | Open in IMG/M |
| 3300031942|Ga0310916_10558498 | Not Available | 974 | Open in IMG/M |
| 3300031946|Ga0310910_10041700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3191 | Open in IMG/M |
| 3300031959|Ga0318530_10038372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1756 | Open in IMG/M |
| 3300032009|Ga0318563_10491763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
| 3300032042|Ga0318545_10299875 | Not Available | 578 | Open in IMG/M |
| 3300032044|Ga0318558_10003661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 5234 | Open in IMG/M |
| 3300032044|Ga0318558_10247809 | Not Available | 876 | Open in IMG/M |
| 3300032055|Ga0318575_10093263 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300032065|Ga0318513_10000727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9485 | Open in IMG/M |
| 3300032074|Ga0308173_10231183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1555 | Open in IMG/M |
| 3300032089|Ga0318525_10010066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4241 | Open in IMG/M |
| 3300032089|Ga0318525_10056657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1953 | Open in IMG/M |
| 3300032805|Ga0335078_10684739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1274 | Open in IMG/M |
| 3300032895|Ga0335074_10001382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 32902 | Open in IMG/M |
| 3300032895|Ga0335074_10598200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1102 | Open in IMG/M |
| 3300032895|Ga0335074_11442075 | Not Available | 553 | Open in IMG/M |
| 3300032898|Ga0335072_10005013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 19539 | Open in IMG/M |
| 3300033134|Ga0335073_10026384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8029 | Open in IMG/M |
| 3300033134|Ga0335073_10421656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1552 | Open in IMG/M |
| 3300033290|Ga0318519_10035086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2404 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 35.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.14% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.14% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.26% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.51% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026927 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 56 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028021 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 | Environmental | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26341J46601_102243142 | 3300003219 | Bog Forest Soil | MAADRVIRWTTAGAVAGVAAMASHEHAHALVRAHGEAGRT |
| JGIcombinedJ51221_101963762 | 3300003505 | Forest Soil | VTAADRVIRWTTAVTVIVVAAVAAAAPYDHAYALVRAHGGAGWTA |
| Ga0070659_1003995671 | 3300005366 | Corn Rhizosphere | MAADRLIRWSTALAVLGVAAVGATASYEHAYDLMRAHCKSG* |
| Ga0070713_1000745364 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAADRVIRWSTALAVLGIAVVAAVVSYEHAYALVRAHGE |
| Ga0070710_114799912 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGTDRVIKWSTAFAVLAVAAVASYEHAYDLVRAHGEEGGRRI* |
| Ga0070681_100936133 | 3300005458 | Corn Rhizosphere | MAADRLIGWSTALAVLGVAAVGATASYEHAYDLMRAHCKSG* |
| Ga0070681_118118002 | 3300005458 | Corn Rhizosphere | VTATERIIRWSTAGAVVGVAAVAAVASYDHAYALVSTHVEAGWTGRL |
| Ga0068857_1021849072 | 3300005577 | Corn Rhizosphere | AADRLIGWSTALAVLGVAAVGATASYEHAYDLMRAHCKSG* |
| Ga0070766_113220972 | 3300005921 | Soil | CWWCPVMAADRVIRWTTAVAVISVVAVAAAASYEHA* |
| Ga0079221_118007331 | 3300006804 | Agricultural Soil | MSGAEPIIRWSTAFTVLGVAAVAAVASYEHAYDLVRAH |
| Ga0066797_10045705 | 3300006864 | Soil | MTAVDRITRWTTALAVVGVAAVAAVASYEHAYALVRA* |
| Ga0116135_11612591 | 3300009665 | Peatland | MMAADRVIRWSTALAVLGVAAVAAVASYEHAYDLVRPTVS |
| Ga0126373_117610531 | 3300010048 | Tropical Forest Soil | VTAADRVIRWTTAGAVVGVAAVAAVGSYEHAYDLV |
| Ga0126373_124446052 | 3300010048 | Tropical Forest Soil | MTAADRIMRWTAAVAVIGVAAVAAVVSYEHAYALVRAH |
| Ga0099796_102085022 | 3300010159 | Vadose Zone Soil | MTAADRIIRWSTAGAVIGVAAVAAVASYEHAYDLVRAH |
| Ga0126379_134699681 | 3300010366 | Tropical Forest Soil | MSGADRVIRWSTAGAVLGVAAVAAVASYEHAYDLSWLRLVRI |
| Ga0126381_1012760481 | 3300010376 | Tropical Forest Soil | MSGADRVIRWSTAGAVLGVAAVAAVASYEHAYDLSWLRLVRISVAAGDGF* |
| Ga0134126_104600201 | 3300010396 | Terrestrial Soil | VNVTGRVIAWSTALAVLGVAGVAAVASYEHAYDLVRAHGEAGWTARLV |
| Ga0137389_110758472 | 3300012096 | Vadose Zone Soil | MAADRVIRWTTAGAVAGVAAMASYEHAHALVRAHGEAGRTG |
| Ga0137378_114460601 | 3300012210 | Vadose Zone Soil | MSSGDRLIRWSTAVAVLGVAAVAAVASYEHACRLHS |
| Ga0137360_117316302 | 3300012361 | Vadose Zone Soil | MRGADRVIRWSTAGVVVDVATVAAVASYEHVYALVRAHGE |
| Ga0164307_109467893 | 3300012987 | Soil | IRRATAGAIIVVAAFTAVAPYEHAYDLVHAHGEVG* |
| Ga0157369_116513971 | 3300013105 | Corn Rhizosphere | MNAADRVMRWSTALAVLGVAAIAAVVSYEHAGALVRAH |
| Ga0182032_107869212 | 3300016357 | Soil | MTTTGQIIRWSTAGAVVGVAAVAAVASYEHAYALVRA |
| Ga0182037_112307891 | 3300016404 | Soil | MTAGQIIRWSTAGAVAGVAAVAAVASCEHAYALVRAHGETGWI |
| Ga0182039_122100171 | 3300016422 | Soil | MMAADRVIRWSTAGAVLGVAAVAAVASHEHASDLVLPSKT |
| Ga0187812_100042713 | 3300017821 | Freshwater Sediment | MTSTGQIIRWSTAGAVVGVAAVAAVASYEHAYALVRAH |
| Ga0187812_10116523 | 3300017821 | Freshwater Sediment | MMAADRFIRWTTAGAVPGVAAVAAVASCEHAYDLLRAHGEAG |
| Ga0187820_12133702 | 3300017924 | Freshwater Sediment | MSAADRVVRWSTALAALGVALVAAVVSYEHAGDLVRRMPPHSG |
| Ga0187806_12035891 | 3300017928 | Freshwater Sediment | MTGADRVIRWSTAFAVLGVAAVAAVASYEHAYDLVRAH |
| Ga0187801_103032292 | 3300017933 | Freshwater Sediment | MAADRVIRWTTEGAVAGAAAMASYEHAYALVQAHGE |
| Ga0187817_103723342 | 3300017955 | Freshwater Sediment | MTADRVIRWTTAGAVIGVAALASYEHAYDLVRAHGETGWT |
| Ga0187810_101045611 | 3300018012 | Freshwater Sediment | MAADRVIRWTTAGAVIAVAAMASYEHPSAFVRVHGQAARP |
| Ga0187890_107497301 | 3300018044 | Peatland | MAADRVIRWTTAVAVIAVIAVASYEHAYDLVRAHGEAGWTARLV |
| Ga0206349_19776074 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | MAADRVIRRAIAGAIIVVAAFTAVAPYEHAYDLVHAHGEVG |
| Ga0206351_104351791 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | MMAADRVIRWSTAGVVIGVAAVAAAASYEHACDLVRAHGEAGRR |
| Ga0210395_106386761 | 3300020582 | Soil | MTGTDKAIRWSTAAAVIGVAVVAAVVSYEHAYALV |
| Ga0210404_101979101 | 3300021088 | Soil | MAADRVIRWTTAVAVIGVAAVAAVASYEHAYDLVRA |
| Ga0210400_109793391 | 3300021170 | Soil | MIGADRTIRWSTAAAVIGVAVVAAAVSYEHGYALVRVHGEV |
| Ga0210408_110263742 | 3300021178 | Soil | MAADRVIRWTTAVTVIVVAAVAAAAPYYHAYALVRAHGGAGWTA |
| Ga0210386_104192223 | 3300021406 | Soil | MTAADRIIRWATAGAVIGVAAVAAVASYEHAYALVQVH |
| Ga0210386_105472931 | 3300021406 | Soil | MTAADRVIRWSTALAVIGVAAVAAVVANEHASPLVRAHG |
| Ga0210386_112375592 | 3300021406 | Soil | MNADRVIRWSTALAVVGVDAVAAVVSYEHASALVREHGE |
| Ga0210386_117360491 | 3300021406 | Soil | MNAADRVIRWSTALAVVGVAVVATVVSYEHASDLVREHG |
| Ga0210402_112189082 | 3300021478 | Soil | VTAADRVIRWTTAVAVIGVAAVAAIASYEHAYDLVRAHGEAG |
| Ga0210402_115262342 | 3300021478 | Soil | MTGANRVIRWSIAGAVVGMAAVASCEHAHALMRAHGEIIIA |
| Ga0207692_104106292 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAADRIIRWTTAVAVIGVAAIAAVVSYKHAGDLVRAHG |
| Ga0207699_108652291 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSEDRVIRWSTALAVLGVAAVAAVASYEHAYEFLR |
| Ga0207643_108925462 | 3300025908 | Miscanthus Rhizosphere | MAADRLIRWSTALAVLGVAAVGATASYEHAYDLMRAHCKSG |
| Ga0207684_103316023 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTADRVIQWSTALAVLGIAGVAAVASYEHAYDLVRAHGAA |
| Ga0207707_112244701 | 3300025912 | Corn Rhizosphere | MTGTDKAIRWSTAAAVIGVAAVAAVVSYEHAYDLVHAHSETG |
| Ga0207695_103906491 | 3300025913 | Corn Rhizosphere | MSGDDRVTRWSTAVAVLGVAAVAVVASYEHAYVATTVC |
| Ga0207693_100968625 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MAADWVIRWTTAVTVIVVAAVAAAAPYEHAYALVRAH |
| Ga0207693_100993831 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MAADRVIRWTTAVTVIVVAAVAAAAPYEHAYALVRAH |
| Ga0207663_100869618 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGADPIIRWSTAFTVLGVAAVAAVASYEHAYDLVRAHVS |
| Ga0207660_106515521 | 3300025917 | Corn Rhizosphere | MAADRLIGWSTALAVLGVAAVGATASYEHAYDLMRAHCKSG |
| Ga0207649_106208011 | 3300025920 | Corn Rhizosphere | MSGDDRVTRWSTAVAVLGVAAVAVVASYEHAYVWLRRFAL |
| Ga0207664_101393255 | 3300025929 | Agricultural Soil | MAADRVIWWATAGAVVGVAAVAPYEHAYALVLAHAEAGGRAAGFQ |
| Ga0207665_111234011 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGTDKAIRWSTAAAVIGVAVVAAVVSYEHAYALV |
| Ga0207744_10044293 | 3300026927 | Tropical Forest Soil | MTTGQIIRWSTAGAVAGVAAVAAVASCEHAYALVRAHGETGWIGRL |
| Ga0209330_11245982 | 3300027619 | Forest Soil | MTAADRVIRSTTAVAVIGVAVIAAVVSYEDAGDLVRAHG |
| Ga0265352_10050591 | 3300028021 | Soil | MAADRVIRWTSAAAVIGVAAVTAVASYEHAYHLVRARGAGVDGPA |
| Ga0265334_103025541 | 3300028573 | Rhizosphere | VNDADRVIRWSTALAVLGVAAVAATASYEHAYDLVRDQELG |
| Ga0302220_103473971 | 3300028742 | Palsa | MAADRVIRWTTAVAAIGVAAVASCEHAYDLVRAHGEAGWTAPLVPLTVGGLIYAS |
| Ga0265338_110088592 | 3300028800 | Rhizosphere | MTAADRIIRWSTALAVLGVAAIAAVVSYEHAGDLVRAH |
| Ga0302226_104332371 | 3300028801 | Palsa | MNTADRVIRWSTAVAVLGVAAVAAAASCEDGCDLVRAHGEAGWTA |
| Ga0302229_104065881 | 3300028879 | Palsa | MTADRVIRWTTAGAVVGVAAVAAVASYEHAYALVVAHGEA |
| Ga0311338_108313461 | 3300030007 | Palsa | VNGADRIIRWTTAGAVLGVAAVAAVASYEHAYALVRA |
| Ga0311355_115512901 | 3300030580 | Palsa | MSAADRVIRWSTAGAVIGVAAVAAVVAYEHAYAPV |
| Ga0302308_108428091 | 3300031027 | Palsa | MTADRVIRWTTAGAVVGVAAVAAVASYEHAYALVVA |
| Ga0302325_122664731 | 3300031234 | Palsa | VTAADRVIRWTTAGAVAGVAAVAAVASYEHAYALVR |
| Ga0318516_100055211 | 3300031543 | Soil | MTTGQIIRWSTAGAVIGVAAVAEVASYEHAYAPVRAHGETG |
| Ga0318516_100546871 | 3300031543 | Soil | MTTGQIIRWSTAGAVAGVAAVAAVASCEHAYALVRAHGETGWI |
| Ga0318561_102608382 | 3300031679 | Soil | MTTGQIIRWSTAGAVVGVAAVAAVAPCEHAYALVRAHGETGWI |
| Ga0307476_101861331 | 3300031715 | Hardwood Forest Soil | MTTTEHVIRWSTAGAVLGVAAVAAVASYEHAYDLVRMH |
| Ga0318493_100447161 | 3300031723 | Soil | MTTGQIIRWSTAGAVIGVAAVASYEHAYALVRAHGE |
| Ga0318501_100180254 | 3300031736 | Soil | MTTGQIIRWSTAGAVIGVAAVASYEHACALVRAHGETGW |
| Ga0318494_106431221 | 3300031751 | Soil | MSVADRTIRWSTAGIVLGVAAVAAVASYEPAYDLVRAHGES |
| Ga0318498_100833122 | 3300031778 | Soil | MTTGQIIRWSTAGAVVGVAAVAAVASCEHAYALVRAH |
| Ga0318498_102533611 | 3300031778 | Soil | MTAGQIIRWSTAGAVAGVAAVAAVASCEHAYALVRAHGETGWIGRL |
| Ga0318566_100020861 | 3300031779 | Soil | MTTGQIIRWSTAGAVVGVAAVAAVASCEHAYALVR |
| Ga0318508_10877731 | 3300031780 | Soil | MTTGQIIRWSTAGAVVGVAAVAAVASCEHAYALVRAHGETG |
| Ga0318523_101012023 | 3300031798 | Soil | MTTGQIIRWSTAGAVIGVAAVASYEHAYALVRAHGET |
| Ga0318565_100863643 | 3300031799 | Soil | MTTGQIIRWSTAGAVIGVAAVASYEHAYALVRAHGETGW |
| Ga0318497_102302182 | 3300031805 | Soil | MTTGQIIRWSTAGAVAGVAAVAAVASCEHAYALVRAHGETG |
| Ga0318497_102514112 | 3300031805 | Soil | MTTTGQIIRWSTAGAVVGVAAVAAVASCEHAYALVRAHGETGWIG |
| Ga0307478_105779882 | 3300031823 | Hardwood Forest Soil | MSGADRVIRWSTAFAVLGVTAVAATASYEHAYDLVRA |
| Ga0318511_105687941 | 3300031845 | Soil | MTTTGQIIRWSTPEAVVGVAAVAAVASYEHAYALVRA |
| Ga0306919_100480951 | 3300031879 | Soil | MTTTGQIIRWSTAGAVAGVAAVAAVASYEHACALVRAHGETGWIG |
| Ga0306919_105159812 | 3300031879 | Soil | MTSAGQISRWCTAGTVVGVAAVAAVASYEHAYALVR |
| Ga0318522_104304631 | 3300031894 | Soil | MTTGQIIRWSTARAVAGVAAVAAVASCEHAYALVRAHGETGW |
| Ga0306923_1000320715 | 3300031910 | Soil | MTTGQIIRWSTAGAVVGVAAVAAVAPCENAYALVRAHGE |
| Ga0310912_103584672 | 3300031941 | Soil | MTSGQIIRWSTAGAVAGVAAVAAVASCEHAYALVRA |
| Ga0310912_106720932 | 3300031941 | Soil | MTTGQIIRWSTAGAVIGVAAVASYEHACALVRAHGETG |
| Ga0310916_105584981 | 3300031942 | Soil | MTTGQVIRWSTAGAVAGVAAVAAVASCEHAYALVRAHGETGWI |
| Ga0310910_100417002 | 3300031946 | Soil | MTTGQIIRWSTAGSVIGVAAVAEVASYEHAYAPVRAHGETG |
| Ga0318530_100383722 | 3300031959 | Soil | MTTGQIIRWSTAGAVIGVAAVASYEHAYAPVRAHGETG |
| Ga0318563_104917631 | 3300032009 | Soil | VTAAEQVIRWSTAGAVVGVAAVAAVVSYEHPYVLVRAHGEAG |
| Ga0318545_102998751 | 3300032042 | Soil | MTTGQIIRWSTAGAVVGVAAVAAVASCEHAYALVRAHG |
| Ga0318558_100036611 | 3300032044 | Soil | MTTGQIIRWSTAGAVVGVAAVAAVAPCEHAYALVRAHGETG |
| Ga0318558_102478092 | 3300032044 | Soil | MTTTGQIIRWSTAGAVVGVAAVAAVASCEHAYALVRAHGETGW |
| Ga0318575_100932632 | 3300032055 | Soil | MTTTGQIIRWSTAGAVVGVAAVAAVASCEHAYALVRAHGE |
| Ga0318513_100007271 | 3300032065 | Soil | MTTGQIIRWSTAGAVVGVAAVAAVAPCEHAYALVR |
| Ga0308173_102311831 | 3300032074 | Soil | MTSADRIIRWSTALAVIGVAAVAAVVSYEHASDLVREHGVS |
| Ga0318525_100100668 | 3300032089 | Soil | MTAGQIIRWSTAGAVAGVAAVAAVASCEHAYALVRAHGE |
| Ga0318525_100566571 | 3300032089 | Soil | MTTGQIIRWSTAGAVVGVAAVAAVASCEHAYALVRAHGETGWIGR |
| Ga0335078_106847393 | 3300032805 | Soil | MSAADRIIRWSTAGAVVRVAAVAAVASYEHAYDLVRAHGESFAASRAHMLP |
| Ga0335074_1000138219 | 3300032895 | Soil | MVVDRVIWWTTGAAVIGVAAVAAVASYEHLFDLVRAHGRLGRRFDWSRSPWTG |
| Ga0335074_105982003 | 3300032895 | Soil | MTVVDGVIRWTTVGAVLGVAAVAAVASYEHAYDLVRVHG |
| Ga0335074_114420752 | 3300032895 | Soil | VSGAGRVIRWSTALAVLGVAAVASVASYEHAYDFVRMHGED |
| Ga0335072_100050132 | 3300032898 | Soil | MAVDRVIWWTTGAAVIGVAAVAAVASYEHLFDLVRAHGRLGRRFDWSRSPWTG |
| Ga0335073_100263845 | 3300033134 | Soil | MNAADRMIRWSAALAVVSVAVVAAVVSYEHRSTLAREHGESDCT |
| Ga0335073_104216562 | 3300033134 | Soil | MNVVDRVIRWLTALAVVGVAAVAAVVSYEHASALVRAYGESRVGPGA |
| Ga0318519_100350861 | 3300033290 | Soil | MTTGQIIRWSTAGAVVGVAAVAAVAPCEHAYALVRAHGE |
| ⦗Top⦘ |