| Basic Information | |
|---|---|
| Family ID | F081039 |
| Family Type | Metagenome |
| Number of Sequences | 114 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MNTEQALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKEEKKAE |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 13.91 % |
| % of genes near scaffold ends (potentially truncated) | 29.82 % |
| % of genes from short scaffolds (< 2000 bps) | 72.81 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (74.561 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (36.842 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.421 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (71.053 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.67% β-sheet: 0.00% Coil/Unstructured: 57.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 42.11 |
| PF00149 | Metallophos | 1.75 |
| PF01464 | SLT | 1.75 |
| PF13481 | AAA_25 | 0.88 |
| PF13414 | TPR_11 | 0.88 |
| PF03237 | Terminase_6N | 0.88 |
| PF12708 | Pectate_lyase_3 | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.60 % |
| Unclassified | root | N/A | 11.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001533|MLSed_10070034 | All Organisms → Viruses → Predicted Viral | 1781 | Open in IMG/M |
| 3300002091|JGI24028J26656_1007589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1470 | Open in IMG/M |
| 3300002408|B570J29032_109749324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1202 | Open in IMG/M |
| 3300002835|B570J40625_100009741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17499 | Open in IMG/M |
| 3300002835|B570J40625_100387187 | All Organisms → Viruses → Predicted Viral | 1366 | Open in IMG/M |
| 3300004096|Ga0066177_10453476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300004481|Ga0069718_10011670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1796 | Open in IMG/M |
| 3300005583|Ga0049085_10041392 | All Organisms → Viruses → Predicted Viral | 1681 | Open in IMG/M |
| 3300006030|Ga0075470_10190069 | Not Available | 590 | Open in IMG/M |
| 3300006805|Ga0075464_10423385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
| 3300006863|Ga0075459_1088509 | Not Available | 531 | Open in IMG/M |
| 3300007363|Ga0075458_10068013 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
| 3300007363|Ga0075458_10263418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300009068|Ga0114973_10026554 | Not Available | 3538 | Open in IMG/M |
| 3300009151|Ga0114962_10013988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5818 | Open in IMG/M |
| 3300009151|Ga0114962_10035008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3413 | Open in IMG/M |
| 3300009151|Ga0114962_10106299 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300009151|Ga0114962_10115441 | All Organisms → Viruses → Predicted Viral | 1653 | Open in IMG/M |
| 3300009151|Ga0114962_10168501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1303 | Open in IMG/M |
| 3300009152|Ga0114980_10000280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36163 | Open in IMG/M |
| 3300009152|Ga0114980_10006604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7632 | Open in IMG/M |
| 3300009152|Ga0114980_10134495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1469 | Open in IMG/M |
| 3300009152|Ga0114980_10713745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300009154|Ga0114963_10369807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
| 3300009158|Ga0114977_10001199 | Not Available | 16928 | Open in IMG/M |
| 3300009158|Ga0114977_10004179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9218 | Open in IMG/M |
| 3300009160|Ga0114981_10185038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1144 | Open in IMG/M |
| 3300009168|Ga0105104_10492562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300009180|Ga0114979_10548270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300009181|Ga0114969_10091820 | Not Available | 1964 | Open in IMG/M |
| 3300009181|Ga0114969_10521232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300009183|Ga0114974_10420061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
| 3300009183|Ga0114974_10615133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300009184|Ga0114976_10412093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300010157|Ga0114964_10099871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1441 | Open in IMG/M |
| 3300010158|Ga0114960_10602302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300010885|Ga0133913_10713205 | All Organisms → Viruses → Predicted Viral | 2623 | Open in IMG/M |
| 3300010885|Ga0133913_10790021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2475 | Open in IMG/M |
| 3300010885|Ga0133913_13435371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1036 | Open in IMG/M |
| 3300010885|Ga0133913_13637936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1000 | Open in IMG/M |
| 3300013004|Ga0164293_10019439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5670 | Open in IMG/M |
| 3300013004|Ga0164293_10587142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300013005|Ga0164292_10358308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
| 3300013285|Ga0136642_1012565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2593 | Open in IMG/M |
| 3300013285|Ga0136642_1023643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1784 | Open in IMG/M |
| 3300013286|Ga0136641_1029169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1669 | Open in IMG/M |
| 3300013286|Ga0136641_1051632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1195 | Open in IMG/M |
| 3300013286|Ga0136641_1051785 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Aquirufa → Aquirufa nivalisilvae | 1192 | Open in IMG/M |
| 3300013286|Ga0136641_1107046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
| 3300017722|Ga0181347_1042878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1383 | Open in IMG/M |
| 3300017736|Ga0181365_1090530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
| 3300017754|Ga0181344_1024304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1868 | Open in IMG/M |
| 3300017761|Ga0181356_1111653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
| 3300017774|Ga0181358_1143794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
| 3300017784|Ga0181348_1082776 | Not Available | 1270 | Open in IMG/M |
| 3300019784|Ga0181359_1095103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1100 | Open in IMG/M |
| 3300020141|Ga0211732_1191012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300020205|Ga0211731_10045887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300020205|Ga0211731_10061035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
| 3300020205|Ga0211731_10343336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
| 3300020205|Ga0211731_11008414 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300020205|Ga0211731_11473043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5238 | Open in IMG/M |
| 3300020530|Ga0208235_1002602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2811 | Open in IMG/M |
| 3300020556|Ga0208486_1049484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300021108|Ga0214162_1000037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29236 | Open in IMG/M |
| 3300021600|Ga0194059_1090009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
| 3300021952|Ga0213921_1030307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
| 3300021956|Ga0213922_1004248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4512 | Open in IMG/M |
| 3300021961|Ga0222714_10412435 | Not Available | 711 | Open in IMG/M |
| 3300021963|Ga0222712_10250472 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
| 3300021963|Ga0222712_10518971 | Not Available | 701 | Open in IMG/M |
| 3300022190|Ga0181354_1139525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300023184|Ga0214919_10001405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 39525 | Open in IMG/M |
| 3300023184|Ga0214919_10317003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1063 | Open in IMG/M |
| 3300025635|Ga0208147_1162248 | Not Available | 515 | Open in IMG/M |
| 3300025732|Ga0208784_1090694 | Not Available | 918 | Open in IMG/M |
| 3300025896|Ga0208916_10321777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300027627|Ga0208942_1033810 | All Organisms → Viruses → Predicted Viral | 1615 | Open in IMG/M |
| 3300027708|Ga0209188_1012083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4810 | Open in IMG/M |
| 3300027733|Ga0209297_1000711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20497 | Open in IMG/M |
| 3300027733|Ga0209297_1009046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4922 | Open in IMG/M |
| 3300027741|Ga0209085_1138164 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
| 3300027746|Ga0209597_1074718 | Not Available | 1597 | Open in IMG/M |
| 3300027749|Ga0209084_1073542 | All Organisms → Viruses → Predicted Viral | 1566 | Open in IMG/M |
| 3300027749|Ga0209084_1085014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1425 | Open in IMG/M |
| 3300027749|Ga0209084_1281619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300027749|Ga0209084_1298199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300027754|Ga0209596_1036765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2693 | Open in IMG/M |
| 3300027759|Ga0209296_1319800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300027763|Ga0209088_10000273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 37455 | Open in IMG/M |
| 3300027899|Ga0209668_10388989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
| 3300027902|Ga0209048_11070257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300027969|Ga0209191_1043327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2089 | Open in IMG/M |
| 3300027973|Ga0209298_10039401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2242 | Open in IMG/M |
| 3300027973|Ga0209298_10327225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300027974|Ga0209299_1177357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300028025|Ga0247723_1000442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28658 | Open in IMG/M |
| 3300028025|Ga0247723_1051776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1172 | Open in IMG/M |
| 3300031707|Ga0315291_10668245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
| 3300031873|Ga0315297_11308052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300031885|Ga0315285_10128992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2143 | Open in IMG/M |
| 3300031999|Ga0315274_11032308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
| 3300032053|Ga0315284_11603623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300032116|Ga0315903_11188697 | Not Available | 515 | Open in IMG/M |
| 3300032342|Ga0315286_10492963 | All Organisms → Viruses → Predicted Viral | 1277 | Open in IMG/M |
| 3300032516|Ga0315273_12367998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300032562|Ga0316226_1145706 | Not Available | 1044 | Open in IMG/M |
| 3300033993|Ga0334994_0073514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2065 | Open in IMG/M |
| 3300033993|Ga0334994_0358789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
| 3300033995|Ga0335003_0007956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5461 | Open in IMG/M |
| 3300033995|Ga0335003_0018469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3742 | Open in IMG/M |
| 3300033996|Ga0334979_0023525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4155 | Open in IMG/M |
| 3300034104|Ga0335031_0304615 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
| 3300034356|Ga0335048_0051761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus frigoriresistens | 2649 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 36.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.53% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.53% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.89% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.02% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.14% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.51% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.75% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.75% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.75% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.75% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.88% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.88% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.88% |
| Benthic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001533 | Benthic freshwater microbial communities from British Columbia, Canada | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021108 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MLSed_100700344 | 3300001533 | Benthic | MKKEEALQLLYNAARLAPLNAEQHEAVRKAAETLNEELNPKEEKKK* |
| JGI24028J26656_10075893 | 3300002091 | Lentic | MNTEQALNNLYAAARLAPLPAEQHDIIRKSAEVLVEALKPKEEKKAE* |
| B570J29032_1097493241 | 3300002408 | Freshwater | MNTEQALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKEEKK |
| B570J40625_10000974117 | 3300002835 | Freshwater | MNTETALNNLYAAARLAPLPAEQHDILRKSAEVLVEALKPKEEKKAE* |
| B570J40625_1003871872 | 3300002835 | Freshwater | MNTEQALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKEEKKAE* |
| Ga0066177_104534762 | 3300004096 | Freshwater Lake | MNTEQALNNLYAAARLAPLPAEQHDIIRKSAEVLVEALKPKEPKVE* |
| Ga0069718_100116702 | 3300004481 | Sediment | MTTEQALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKEEKKAE* |
| Ga0049085_100413922 | 3300005583 | Freshwater Lentic | MNTETALNNLYQAARLAPLPAEQHDIIRKSAEVLVEALKPKEPKVE* |
| Ga0075470_101900691 | 3300006030 | Aqueous | MTTEQALNNLYAASRRAPLTAEEHELLRKSAELLLEAL |
| Ga0075464_104233852 | 3300006805 | Aqueous | MNTEQALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKEAPKAD* |
| Ga0075459_10885091 | 3300006863 | Aqueous | MTTEQALNNLYAASRRAPLSADEHELLRKSAELILEA |
| Ga0075458_100680131 | 3300007363 | Aqueous | MTTEQALNNLYAASRRAPLTAEEHEILRKSAEVLLEAIK |
| Ga0075458_102634182 | 3300007363 | Aqueous | MTTEQALNNLYAAARLAPLPAEQHEILRKSVEVLVEALKPKEEKKAE* |
| Ga0114973_100265542 | 3300009068 | Freshwater Lake | MNTEQALNNLYAAARLAPLPAEQHEIVRKCAEILAEALKPKEEPKQ* |
| Ga0114962_100139887 | 3300009151 | Freshwater Lake | MNTEQALNNLYTAARSAMLTAEQHEIIRKSAEVLVEALKPKEEKKAD* |
| Ga0114962_100350082 | 3300009151 | Freshwater Lake | MNTETALNNLYAAARSAMLTAEQHEIIRKSAEVLVEALKPKEDKKAE* |
| Ga0114962_101062991 | 3300009151 | Freshwater Lake | MNTEQALNNLYNAARSAMLTAEQHDIIRKSVEVLVEALKPKEEKKAE* |
| Ga0114962_101154412 | 3300009151 | Freshwater Lake | MNTEQALNNLYQAARSAMLTAEQHEIIRKSVEVLVEALKPKEEKKAD* |
| Ga0114962_101685012 | 3300009151 | Freshwater Lake | MNTETALNNLYAAARSAMLTAEQHEIIRKSVEVLVEALKPKEAPKAD* |
| Ga0114980_1000028016 | 3300009152 | Freshwater Lake | MNTEQALNNIYNAARLAPLTAEQHDIIRKSAEVLVEALKPKEEKKAE* |
| Ga0114980_100066049 | 3300009152 | Freshwater Lake | MNTEIALNNLYAAARLAPLPAEQHDIIRKSAEVLVEALKPKEAPKAD* |
| Ga0114980_101344952 | 3300009152 | Freshwater Lake | MNTEQALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKEEKKAD* |
| Ga0114980_107137452 | 3300009152 | Freshwater Lake | MNTEQALNNLYAAARLAPLPAEQHDILRKSVEVLVEALKPKEEKKSE* |
| Ga0114963_103698071 | 3300009154 | Freshwater Lake | MNTETALNNLYAAARSAMLTAEQHDIIRKSAEVLVDALKPKEEKKAE* |
| Ga0114977_1000119914 | 3300009158 | Freshwater Lake | MNTETALNNLYQAARLAPLPAEQHEIIRKSAEVLVEALKPKEEKKAE* |
| Ga0114977_100041792 | 3300009158 | Freshwater Lake | MNTEQALNNLYAAARLAPLPAEQHDIIRKSAEVLVEALKPKEEKKAD* |
| Ga0114981_101850381 | 3300009160 | Freshwater Lake | MNTEQALNNLYAAARLAPLPAEQHEILRKSAEVLVEALKPKEEKKAE* |
| Ga0105104_104925622 | 3300009168 | Freshwater Sediment | MENQKENEQALQNLYAAARLAPLKADEHELLRKCAEQLLQALKPKEAPAT* |
| Ga0114979_105482702 | 3300009180 | Freshwater Lake | MNMSTETALNNIYNAARMAPLTAEQHDIIRKSAEVLVEALKPKEAPKAD* |
| Ga0114969_100918204 | 3300009181 | Freshwater Lake | MTTEQALNNLYNAARLAPLNAEQHELIRKCAEQLAEALKP |
| Ga0114969_105212322 | 3300009181 | Freshwater Lake | MNTEQALNNLYAAARLAPLPAEQHELIRKSGEAIAEALKPKTEANAELIKDNE* |
| Ga0114974_104200612 | 3300009183 | Freshwater Lake | MNTEQALNNLYQAARLAPLPAEQHDIIRKSAEVLVEALKPKTDAPVSE* |
| Ga0114974_106151332 | 3300009183 | Freshwater Lake | MNPETALQNLYNATRLAPLTAEQHEFLITCAKAVAEALKPKDTENEQP* |
| Ga0114976_104120932 | 3300009184 | Freshwater Lake | MNTEQALNNLYAAARLAPLPAEQHKIIRKSAEVLVEALKPKEEKKAD* |
| Ga0114964_100998713 | 3300010157 | Freshwater Lake | MNTETALNNLYAAARLAPLPAEQHDIIRKSAEVLVDALKPKEAPKAD* |
| Ga0114960_106023021 | 3300010158 | Freshwater Lake | MNTEQALNNLYAAARLAPLPAEQHEIIRKSVEVLVEALKPKEAPKAD* |
| Ga0133913_107132051 | 3300010885 | Freshwater Lake | TEQALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKEEKKAD* |
| Ga0133913_107900213 | 3300010885 | Freshwater Lake | MNPETALQNLYNATRLAPLTAEQHEFLVTCAKAVAEALKPKDTDNEQP* |
| Ga0133913_134353711 | 3300010885 | Freshwater Lake | EQALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKEDKKAE* |
| Ga0133913_136379361 | 3300010885 | Freshwater Lake | NNLYAAARSAMLTAEQHEIIRKSAEVLVEALKPKEDKKAE* |
| Ga0164293_100194393 | 3300013004 | Freshwater | MNTEQALNNLYAAARLAPLPAEQHDIIRKSAEVLVEALKPKEAPKAD* |
| Ga0164293_105871421 | 3300013004 | Freshwater | MNTEQALNNLDAAARLAPLPAEQHDIIRKSAEVLVEALKPKEEKKAE* |
| Ga0164292_103583082 | 3300013005 | Freshwater | MNTEQALNNLYQAARLAPLPAEQHDIIRKSAEVLVEALKPKEEKKAE* |
| Ga0136642_10125652 | 3300013285 | Freshwater | MNTETALNNLYAAARLAPLPAEQHEIIRKSAELLVEALKPKEEKKAE* |
| Ga0136642_10236432 | 3300013285 | Freshwater | MNTEQALNNLYQAARLAPLPAEQHEIIRKSAEVLVEALKPKEEKKVE* |
| Ga0136641_10291694 | 3300013286 | Freshwater | MNTEQALNNLYQAARLAPLSAEQHEIIRKSAEVLVEALKPKEEKKAD* |
| Ga0136641_10516324 | 3300013286 | Freshwater | NTEQALNNLYAAARLAPLPAEQHDIIRKSAEVLVEALKPKEEKKVE* |
| Ga0136641_10517852 | 3300013286 | Freshwater | MNTEQALNNLYQAARLAPLSAEQHEIIRKSAEVLVEALKPKEEKKVE* |
| Ga0136641_11070462 | 3300013286 | Freshwater | MNTEQALNNLYQAARLAPLSAEQHEIIRKSAEVLVEALK |
| Ga0181347_10428782 | 3300017722 | Freshwater Lake | MNTEVALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKEAPKAD |
| Ga0181365_10905301 | 3300017736 | Freshwater Lake | MTTEQALNNLYAAARLAPLPAEQHDIIRKSAEVLVEALKPKEAPKAD |
| Ga0181344_10243042 | 3300017754 | Freshwater Lake | MNTEQALNNLYNAARLAPLPAEQHEIIRKSAEVLVEALKPKEEKKSE |
| Ga0181356_11116532 | 3300017761 | Freshwater Lake | MNTEQALNNLYAAARLAPLPAEQHDIIRKSAEVLVEALKPKETKAE |
| Ga0181358_11437942 | 3300017774 | Freshwater Lake | MNTEVALNNLYAAARLAPLPAEQHEILRKSAEVLVEALKPKEPKVE |
| Ga0181348_10827761 | 3300017784 | Freshwater Lake | MTTEQALNNLYAAARLAQLNAEQHELIRKCAEQLAEALKPKPEPAAQD |
| Ga0181359_10951031 | 3300019784 | Freshwater Lake | NTEVALNNLYAAARLAPLPAEQHDIIRKSAEVLVEALKPKEEKKSE |
| Ga0211732_11910122 | 3300020141 | Freshwater | NMNTEQALNNIYTAARLAPLTAEQHDIIRKSAEVLVEALKPKDAPKPE |
| Ga0211731_100458871 | 3300020205 | Freshwater | LYAAARLAPLPAEQHDIIRKSAEVLVEALKPKDAPKPE |
| Ga0211731_100610352 | 3300020205 | Freshwater | MNTEQALNNLYAAARLAPLPAEQHDIIRKSAEVLVEAL |
| Ga0211731_103433363 | 3300020205 | Freshwater | ALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKDAPKPE |
| Ga0211731_110084142 | 3300020205 | Freshwater | MNTEQALNNLYAAARLAPLPAEQHDILRKSAEVLVEALKPKDAPKPE |
| Ga0211731_114730431 | 3300020205 | Freshwater | NNLYAAARLAPLPAEQHDIIRKSAEVLVEALKPKEEKKAE |
| Ga0208235_10026026 | 3300020530 | Freshwater | MNTETALNNLYAAARLAPLPAEQHDILRKSAEVLVEALKPKEEKKAE |
| Ga0208486_10494842 | 3300020556 | Freshwater | MNTEQALNNLYAAARLAPLPAEQHDILRKSAEVLVEALKPKEEKKAE |
| Ga0214162_100003720 | 3300021108 | Freshwater | MNTEQALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKDAPKPE |
| Ga0194059_10900091 | 3300021600 | Anoxic Zone Freshwater | LYAAARLAPLPAEQHEIIRKSVEVLVEALKPKEEKKAD |
| Ga0213921_10303072 | 3300021952 | Freshwater | MNTEQALNNIYQAARAAMLTAEQHEIIRKSVEVLVEALKPKEEKKAEXDEWHLRC |
| Ga0213922_10042485 | 3300021956 | Freshwater | MNTEQALNNIYQAARAAMLTAEQHEIIRKSVEVLVEALKPKEEKKAE |
| Ga0222714_104124351 | 3300021961 | Estuarine Water | MTTEQALNNLYAASRRAPLTAEEHEILRKSAELLLEAIK |
| Ga0222712_102504722 | 3300021963 | Estuarine Water | MSTETALNNIYNAARLAPLTADQHDIIRKSAEVLVEALKPKDAPKPE |
| Ga0222712_105189711 | 3300021963 | Estuarine Water | MTTEQALNNLYAASRRAPLTAEEHEILRKSAELLLEAIKPK |
| Ga0181354_11395252 | 3300022190 | Freshwater Lake | MTTEQALNNLYAAARLAPLPAEQHDIIRKSAEVLVEALKPKETKAE |
| Ga0214919_100014055 | 3300023184 | Freshwater | MNTEQALNNLYNAARSAMLTAEQHEIIRKSAEVLVEALKPKEEKKAD |
| Ga0214919_103170032 | 3300023184 | Freshwater | MNTETALNNIYTAARLAPLTAEQHEIIRKSAEVLVEALKPKEEKKAD |
| Ga0208147_11622482 | 3300025635 | Aqueous | MNITTEQALNNLYAAARMAPLTAEQHELIRKSGEALAEALKPKTEANAEL |
| Ga0208784_10906941 | 3300025732 | Aqueous | MTTEQALNNLYAASRRAPLTAEEHEILRKSAEVLLEAIKP |
| Ga0208916_103217772 | 3300025896 | Aqueous | MNTEQALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKEAPKAD |
| Ga0208942_10338102 | 3300027627 | Freshwater Lentic | MNTETALNNLYQAARLAPLPAEQHDIIRKSAEVLVEALKPKEPKVE |
| Ga0209188_10120832 | 3300027708 | Freshwater Lake | MNTETALNNLYAAARSAMLTAEQHEIIRKSAEVLVEALKPKEDKKAE |
| Ga0209297_100071113 | 3300027733 | Freshwater Lake | MNTETALNNLYQAARLAPLPAEQHEIIRKSAEVLVEALKPKEEKKAE |
| Ga0209297_10090462 | 3300027733 | Freshwater Lake | MNTEQALNNLYAAARLAPLPAEQHDIIRKSAEVLVEALKPKEEKKAD |
| Ga0209085_11381643 | 3300027741 | Freshwater Lake | MNTEQALNNLYTAARSAMLTAEQHEIIRKSAEVLVEALKPKEEKKAD |
| Ga0209597_10747182 | 3300027746 | Freshwater Lake | MNTEQALNNLYAAARLAPLPAEQHEIVRKCAEILAEALKPKEEPKQ |
| Ga0209084_10735422 | 3300027749 | Freshwater Lake | MNTEQALNNLYQAARSAMLTAEQHEIIRKSVEVLVEALKPKEEKKAD |
| Ga0209084_10850141 | 3300027749 | Freshwater Lake | LNNLYNAARSAMLTAEQHDIIRKSVEVLVEALKPKEEKKAE |
| Ga0209084_12816192 | 3300027749 | Freshwater Lake | MNTEQALNNLYNAARSAMLTAEQHDIIRKSVEVLVEALKPKEEKKAE |
| Ga0209084_12981992 | 3300027749 | Freshwater Lake | ALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKEAPKSD |
| Ga0209596_10367653 | 3300027754 | Freshwater Lake | MNPETALQNLYNATRLAPLTAEQHEFLVTCAKAVAEALKPKDTDNEQP |
| Ga0209296_13198002 | 3300027759 | Freshwater Lake | MNPETALQNLYNATRLAPLTAEQHEFLITCAKAVAEALKPKDTENEQP |
| Ga0209088_1000027331 | 3300027763 | Freshwater Lake | MNTEQALNNIYNAARLAPLTAEQHDIIRKSAEVLVEALKPKEEKKAE |
| Ga0209668_103889892 | 3300027899 | Freshwater Lake Sediment | MNTEQALNNLYAAARLAPLPAEQHEILRKSAEVLVEALKPKEEKKAD |
| Ga0209048_110702572 | 3300027902 | Freshwater Lake Sediment | MNTEQALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKEEKKAD |
| Ga0209191_10433271 | 3300027969 | Freshwater Lake | YGRTRIQLKHMNTEQALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKEEKKAD |
| Ga0209298_100394012 | 3300027973 | Freshwater Lake | MNTEIALNNLYAAARLAPLPAEQHDIIRKSAEVLVEALKPKEAPKAD |
| Ga0209298_103272251 | 3300027973 | Freshwater Lake | AVASPTCRRSRIQLKHMNTEQALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKEEKKAD |
| Ga0209299_11773571 | 3300027974 | Freshwater Lake | MNTEQALNNLYAAARLAPLPAEQHEILRKSAEVLVEALKPKEEKKAE |
| Ga0247723_10004422 | 3300028025 | Deep Subsurface Sediment | MTTEQALNNLYAAARLAPLPAEQHEILRKSAEVLVEALKPKEAPKAD |
| Ga0247723_10517762 | 3300028025 | Deep Subsurface Sediment | MNTETALNNLYAAARLAPLPAEQHEILRKSAEVLVEALKPKEEKKAE |
| Ga0315291_106682452 | 3300031707 | Sediment | MNTEQALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKEAPKPE |
| Ga0315297_113080521 | 3300031873 | Sediment | QLKHMNTETALNNLYAAARLAPLPAEQHEIIRKSVEVLVEALKPKEEKKAD |
| Ga0315285_101289921 | 3300031885 | Sediment | MNTEQALNNLYNAARAALLPAEQHEIIRKSAEVLVEALKPKEEKKAE |
| Ga0315274_110323081 | 3300031999 | Sediment | MNTETALNNLYAAARLAPLPAEQHDIIRKSVEVLVEALKPKDAPKPE |
| Ga0315284_116036232 | 3300032053 | Sediment | NNLYAAARLAPLPAEQHDIIRKSAEVLVEALKPKDAPKPE |
| Ga0315903_111886972 | 3300032116 | Freshwater | MTNEQYLEMLYAASRRAPLTADDHENVRKAAEALL |
| Ga0315286_104929632 | 3300032342 | Sediment | MNTETALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKDAPKPE |
| Ga0315273_123679982 | 3300032516 | Sediment | MNTETALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKDAPKPEXYER |
| Ga0316226_11457062 | 3300032562 | Freshwater | MTTEQAFNNLYSAARLAPLTADQHEAIKQSAEVLVNALKPKDTSDTSSN |
| Ga0334994_0073514_3_110 | 3300033993 | Freshwater | MNTEQALNNLYAAARLAPLPAEQHEIIRKSAEVLVE |
| Ga0334994_0358789_346_489 | 3300033993 | Freshwater | MNTEQALNNLYAAARLAPLPAEQHEIIRKSAEVLVEALKPKEEKKSE |
| Ga0335003_0007956_5176_5319 | 3300033995 | Freshwater | MNTEQALNNLYNAARLAPLPAEQHEILRKSAEVLVEALKPKEEKKAD |
| Ga0335003_0018469_2323_2469 | 3300033995 | Freshwater | MTTEQALNNLYNAARLAPLTAEQHELIRKCAEQLAEALKPKAEPVALD |
| Ga0334979_0023525_940_1083 | 3300033996 | Freshwater | MNTEQALNNLYQAARLAPLPAEQHDIIRKSAEVLVEALKPKDAPKPE |
| Ga0335031_0304615_173_316 | 3300034104 | Freshwater | MTTEQALNNLYAAARLAPLPAEQHEILRKSAEVLVEALKPKEEKKSE |
| Ga0335048_0051761_1_114 | 3300034356 | Freshwater | MNTEQALNNLYNAARLAPLSAEQHEILRKSAEVLVEAL |
| ⦗Top⦘ |