Metagenome / Metatranscriptome Family F080994

Basic Information
Family ID	F080994
Family Type	Metagenome / Metatranscriptome
Number of Sequences	114
Average Sequence Length	43 residues
Representative Sequence	DVPTAILAIGAFLALSRFHGKMTVLYVVLGCGAIGALLQATVV
Number of Associated Samples	86
Number of Associated Scaffolds	114

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	3.54 %
% of genes near scaffold ends (potentially truncated)	92.11 %
% of genes from short scaffolds (< 2000 bps)	90.35 %
Associated GOLD sequencing projects	84
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.65

Most Common Taxonomy
Group	Bacteria (62.281 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (20.175 % of family members)
Environment Ontology (ENVO)	Unclassified (28.947 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (53.509 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 49.30% β-sheet: 0.00% Coil/Unstructured: 50.70%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 114 Family Scaffolds
PF08241	Methyltransf_11	4.39
PF00903	Glyoxalase	3.51
PF02417	Chromate_transp	3.51
PF01925	TauE	1.75
PF01790	LGT	1.75
PF03364	Polyketide_cyc	1.75
PF00589	Phage_integrase	1.75
PF08448	PAS_4	1.75
PF07883	Cupin_2	1.75
PF01370	Epimerase	1.75
PF07690	MFS_1	0.88
PF00202	Aminotran_3	0.88
PF00881	Nitroreductase	0.88
PF13417	GST_N_3	0.88
PF01625	PMSR	0.88
PF13936	HTH_38	0.88
PF01726	LexA_DNA_bind	0.88
PF04945	YHS	0.88
PF00563	EAL	0.88
PF00561	Abhydrolase_1	0.88
PF01565	FAD_binding_4	0.88
PF13669	Glyoxalase_4	0.88
PF00171	Aldedh	0.88
PF14018	DUF4234	0.88
PF01545	Cation_efflux	0.88
PF04185	Phosphoesterase	0.88
PF07366	SnoaL	0.88
PF00950	ABC-3	0.88
PF02559	CarD_CdnL_TRCF	0.88
PF01263	Aldose_epim	0.88
PF08282	Hydrolase_3	0.88
PF01546	Peptidase_M20	0.88
PF05995	CDO_I	0.88
PF00196	GerE	0.88
PF13847	Methyltransf_31	0.88
PF03795	YCII	0.88
PF05222	AlaDh_PNT_N	0.88
PF12802	MarR_2	0.88
PF00078	RVT_1	0.88
PF12680	SnoaL_2	0.88
PF00353	HemolysinCabind	0.88
PF09509	Hypoth_Ymh	0.88
PF00005	ABC_tran	0.88
PF04542	Sigma70_r2	0.88
PF01627	Hpt	0.88
PF02771	Acyl-CoA_dh_N	0.88
PF00027	cNMP_binding	0.88
PF00486	Trans_reg_C	0.88
PF01966	HD	0.88
PF16363	GDP_Man_Dehyd	0.88
PF02371	Transposase_20	0.88
PF11017	DUF2855	0.88

COG ID	Name	Functional Category	% Frequency in 114 Family Scaffolds
COG2059	Chromate transport protein ChrA	Inorganic ion transport and metabolism [P]	3.51
COG0730	Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family	Inorganic ion transport and metabolism [P]	1.75
COG0682	Prolipoprotein diacylglyceryltransferase	Cell wall/membrane/envelope biogenesis [M]	1.75
COG4943	Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains	Signal transduction mechanisms [T]	0.88
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	0.88
COG4606	ABC-type enterochelin transport system, permease component	Inorganic ion transport and metabolism [P]	0.88
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	0.88
COG3965	Predicted Co/Zn/Cd cation transporter, cation efflux family	Inorganic ion transport and metabolism [P]	0.88
COG5001	Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain	Signal transduction mechanisms [T]	0.88
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	0.88
COG3769	Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily	Carbohydrate transport and metabolism [G]	0.88
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.88
COG3511	Phospholipase C	Cell wall/membrane/envelope biogenesis [M]	0.88
COG3434	c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains	Signal transduction mechanisms [T]	0.88
COG2350	YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.88
COG2217	Cation-transporting P-type ATPase	Inorganic ion transport and metabolism [P]	0.88
COG2200	EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)	Signal transduction mechanisms [T]	0.88
COG5553	Predicted metal-dependent enzyme of the double-stranded beta helix superfamily	General function prediction only [R]	0.88
COG2017	Galactose mutarotase or related enzyme	Carbohydrate transport and metabolism [G]	0.88
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	0.88
COG1877	Trehalose-6-phosphate phosphatase	Carbohydrate transport and metabolism [G]	0.88
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.88
COG1230	Co/Zn/Cd efflux system component	Inorganic ion transport and metabolism [P]	0.88
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	0.88
COG1108	ABC-type Mn2+/Zn2+ transport system, permease component	Inorganic ion transport and metabolism [P]	0.88
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	0.88
COG0676	D-hexose-6-phosphate mutarotase	Carbohydrate transport and metabolism [G]	0.88
COG0609	ABC-type Fe3+-siderophore transport system, permease component	Inorganic ion transport and metabolism [P]	0.88
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.88
COG0561	Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases	Coenzyme transport and metabolism [H]	0.88
COG0560	Phosphoserine phosphatase	Amino acid transport and metabolism [E]	0.88
COG0225	Peptide methionine sulfoxide reductase MsrA	Posttranslational modification, protein turnover, chaperones [O]	0.88
COG0053	Divalent metal cation (Fe/Co/Zn/Cd) efflux pump	Inorganic ion transport and metabolism [P]	0.88

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	63.16 %
Unclassified	root	N/A	36.84 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	63.16 %
Unclassified	root	N/A	36.84 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	62.28 %
Unclassified	root	N/A	36.84 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.88 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	43.86 %
Unclassified	root	N/A	36.84 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.75 %
Candidatus Thermoplasmatota	phylum	All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota	0.88 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	37.72 %
Unclassified	root	N/A	36.84 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.88 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.88 %
Thermoplasmata	class	All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.84 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	14.04 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	11.40 %
unclassified Actinobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria	1.75 %
Thermoplasmatales	order	All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales	0.88 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.88 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.84 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	8.77 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	7.02 %
Thermoleophilales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales	3.51 %
Actinobacteria bacterium 13_1_20CM_3_68_9	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9	1.75 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.88 %
unclassified Thermoplasmatales	no rank	All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales	0.88 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.88 %
Streptomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales	0.88 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.88 %
Micromonosporales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.84 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	7.02 %
Thermoleophilaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae	3.51 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	2.63 %
Actinobacteria bacterium 13_1_20CM_3_68_9	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9	1.75 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.88 %
Thermoplasmatales archaeon SW_10_69_26	species	All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon SW_10_69_26	0.88 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → environmental samples	0.88 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.88 %
Nocardioidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	0.88 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.88 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.84 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	7.02 %
unclassified Thermoleophilaceae	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae	3.51 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples	1.75 %
Actinobacteria bacterium 13_1_20CM_3_68_9	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9	1.75 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.88 %
uncultured Solirubrobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → environmental samples → uncultured Solirubrobacterales bacterium	0.88 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	0.88 %
Asanoa	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa	0.88 %
Thermoplasmatales archaeon SW_10_69_26	species	All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon SW_10_69_26	0.88 %
Nocardioidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	0.88 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.88 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.84 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	7.02 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	3.51 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	1.75 %
Actinobacteria bacterium 13_1_20CM_3_68_9	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9	1.75 %
unclassified Streptomyces	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces	0.88 %
Asanoa ishikariensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa ishikariensis	0.88 %
uncultured Solirubrobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → environmental samples → uncultured Solirubrobacterales bacterium	0.88 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	0.88 %
Thermoplasmatales archaeon SW_10_69_26	species	All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon SW_10_69_26	0.88 %
Nocardioidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	0.88 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.88 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.84 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	7.02 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	3.51 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	1.75 %
Actinobacteria bacterium 13_1_20CM_3_68_9	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9	1.75 %
Streptomyces sp. Ru73	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Ru73	0.88 %
Asanoa ishikariensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa ishikariensis	0.88 %
uncultured Solirubrobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → environmental samples → uncultured Solirubrobacterales bacterium	0.88 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	0.88 %
Thermoplasmatales archaeon SW_10_69_26	species	All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon SW_10_69_26	0.88 %
Nocardioidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	0.88 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.88 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300004081\|Ga0063454_101322503	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9	605	Open in IMG/M
3300004153\|Ga0063455_101279394	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	557	Open in IMG/M
3300005437\|Ga0070710_11057560	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	594	Open in IMG/M
3300005440\|Ga0070705_100503103	All Organisms → cellular organisms → Bacteria	920	Open in IMG/M
3300005535\|Ga0070684_100419329	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1235	Open in IMG/M
3300005548\|Ga0070665_101050287	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	826	Open in IMG/M
3300005614\|Ga0068856_100642274	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1082	Open in IMG/M
3300005718\|Ga0068866_10194434	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	1208	Open in IMG/M
3300005718\|Ga0068866_11328976	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300006033\|Ga0075012_10096236	All Organisms → cellular organisms → Bacteria	2263	Open in IMG/M
3300006038\|Ga0075365_10568794	Not Available	802	Open in IMG/M
3300006046\|Ga0066652_100408837	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → environmental samples → uncultured Solirubrobacterales bacterium	1239	Open in IMG/M
3300006046\|Ga0066652_101330695	Not Available	676	Open in IMG/M
3300006852\|Ga0075433_11838545	All Organisms → cellular organisms → Bacteria	520	Open in IMG/M
3300009012\|Ga0066710_101533455	Not Available	1026	Open in IMG/M
3300009100\|Ga0075418_10940299	All Organisms → cellular organisms → Bacteria → Terrabacteria group	935	Open in IMG/M
3300009137\|Ga0066709_103542699	All Organisms → cellular organisms → Bacteria	566	Open in IMG/M
3300009137\|Ga0066709_104406203	Not Available	514	Open in IMG/M
3300009148\|Ga0105243_10629342	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1037	Open in IMG/M
3300009789\|Ga0126307_10016255	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	5530	Open in IMG/M
3300009789\|Ga0126307_10060813	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2962	Open in IMG/M
3300009789\|Ga0126307_10145095	All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon SW_10_69_26	1898	Open in IMG/M
3300009815\|Ga0105070_1005770	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1929	Open in IMG/M
3300009840\|Ga0126313_10467951	All Organisms → cellular organisms → Bacteria	1006	Open in IMG/M
3300009840\|Ga0126313_10872561	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	734	Open in IMG/M
3300009840\|Ga0126313_10999071	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Ru73	685	Open in IMG/M
3300009840\|Ga0126313_11149662	Not Available	639	Open in IMG/M
3300010036\|Ga0126305_10479224	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	828	Open in IMG/M
3300010037\|Ga0126304_11064989	All Organisms → cellular organisms → Bacteria → Terrabacteria group	552	Open in IMG/M
3300010038\|Ga0126315_10209346	All Organisms → cellular organisms → Bacteria	1178	Open in IMG/M
3300010038\|Ga0126315_10617407	Not Available	701	Open in IMG/M
3300010039\|Ga0126309_10059171	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1861	Open in IMG/M
3300010040\|Ga0126308_10820375	Not Available	645	Open in IMG/M
3300010040\|Ga0126308_10919076	Not Available	610	Open in IMG/M
3300010041\|Ga0126312_10199280	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1399	Open in IMG/M
3300010041\|Ga0126312_10454947	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	913	Open in IMG/M
3300010042\|Ga0126314_10122242	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1791	Open in IMG/M
3300010042\|Ga0126314_10216465	All Organisms → cellular organisms → Bacteria	1353	Open in IMG/M
3300010042\|Ga0126314_10418151	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	967	Open in IMG/M
3300010042\|Ga0126314_10752217	Not Available	716	Open in IMG/M
3300010044\|Ga0126310_10433773	Not Available	944	Open in IMG/M
3300010045\|Ga0126311_11069341	Not Available	662	Open in IMG/M
3300010045\|Ga0126311_11353024	Not Available	593	Open in IMG/M
3300012042\|Ga0136627_1016367	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2782	Open in IMG/M
3300012092\|Ga0136621_1125092	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1037	Open in IMG/M
3300012093\|Ga0136632_10101057	Not Available	1334	Open in IMG/M
3300012183\|Ga0136624_1093348	Not Available	1033	Open in IMG/M
3300012187\|Ga0136622_10421183	Not Available	561	Open in IMG/M
3300012188\|Ga0136618_10241636	Not Available	781	Open in IMG/M
3300012212\|Ga0150985_108738906	All Organisms → cellular organisms → Bacteria	620	Open in IMG/M
3300012355\|Ga0137369_10806989	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	639	Open in IMG/M
3300012679\|Ga0136616_10058859	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1841	Open in IMG/M
3300012679\|Ga0136616_10385852	Not Available	636	Open in IMG/M
3300012680\|Ga0136612_10075334	All Organisms → cellular organisms → Bacteria	1700	Open in IMG/M
3300012684\|Ga0136614_10116561	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	2024	Open in IMG/M
3300012684\|Ga0136614_10411553	All Organisms → cellular organisms → Bacteria	987	Open in IMG/M
3300012915\|Ga0157302_10302512	Not Available	622	Open in IMG/M
3300012975\|Ga0134110_10405293	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	606	Open in IMG/M
3300012977\|Ga0134087_10779245	Not Available	515	Open in IMG/M
3300013297\|Ga0157378_11818995	All Organisms → cellular organisms → Bacteria	657	Open in IMG/M
3300013306\|Ga0163162_11178612	Not Available	869	Open in IMG/M
3300013308\|Ga0157375_10965183	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	993	Open in IMG/M
3300013768\|Ga0120155_1039850	All Organisms → cellular organisms → Bacteria	1440	Open in IMG/M
3300014264\|Ga0075308_1129362	Not Available	565	Open in IMG/M
3300015373\|Ga0132257_102222658	Not Available	710	Open in IMG/M
3300015373\|Ga0132257_103450416	Not Available	575	Open in IMG/M
3300017789\|Ga0136617_10053095	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	3575	Open in IMG/M
3300017789\|Ga0136617_11188185	Not Available	574	Open in IMG/M
3300017789\|Ga0136617_11371026	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9	528	Open in IMG/M
3300018077\|Ga0184633_10172214	Not Available	1121	Open in IMG/M
3300018432\|Ga0190275_11161134	Not Available	847	Open in IMG/M
3300018432\|Ga0190275_12509741	Not Available	593	Open in IMG/M
3300018466\|Ga0190268_10231776	All Organisms → cellular organisms → Bacteria	1042	Open in IMG/M
3300018466\|Ga0190268_10458301	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	847	Open in IMG/M
3300018466\|Ga0190268_11494491	Not Available	586	Open in IMG/M
3300018469\|Ga0190270_10453151	Not Available	1207	Open in IMG/M
3300018469\|Ga0190270_11154932	Not Available	810	Open in IMG/M
3300018469\|Ga0190270_11439457	All Organisms → cellular organisms → Bacteria → Terrabacteria group	736	Open in IMG/M
3300018482\|Ga0066669_11027508	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	744	Open in IMG/M
3300018910\|Ga0193598_1012365	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa ishikariensis	2453	Open in IMG/M
3300021339\|Ga0193706_1111411	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	745	Open in IMG/M
3300023077\|Ga0247802_1009625	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	1251	Open in IMG/M
3300024347\|Ga0179591_1197646	Not Available	4209	Open in IMG/M
3300025935\|Ga0207709_11853476	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300026075\|Ga0207708_10311890	All Organisms → cellular organisms → Bacteria	1282	Open in IMG/M
3300027647\|Ga0214468_1046735	Not Available	1130	Open in IMG/M
3300027851\|Ga0209066_10357841	Not Available	795	Open in IMG/M
3300027961\|Ga0209853_1119315	Not Available	657	Open in IMG/M
3300028592\|Ga0247822_11641118	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	546	Open in IMG/M
3300028744\|Ga0307318_10058520	Not Available	1281	Open in IMG/M
3300028754\|Ga0307297_10042018	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1385	Open in IMG/M
3300028754\|Ga0307297_10328053	Not Available	556	Open in IMG/M
3300028755\|Ga0307316_10000713	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	10167	Open in IMG/M
3300028796\|Ga0307287_10297755	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	610	Open in IMG/M
3300028811\|Ga0307292_10436607	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	558	Open in IMG/M
3300028819\|Ga0307296_10438936	All Organisms → cellular organisms → Bacteria	714	Open in IMG/M
3300028828\|Ga0307312_10875159	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	595	Open in IMG/M
3300030510\|Ga0268243_1079038	All Organisms → cellular organisms → Bacteria	744	Open in IMG/M
3300030990\|Ga0308178_1040263	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	836	Open in IMG/M
3300031099\|Ga0308181_1015980	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	1156	Open in IMG/M
3300031184\|Ga0307499_10286575	Not Available	538	Open in IMG/M
3300031424\|Ga0308179_1063420	Not Available	501	Open in IMG/M
3300031450\|Ga0272433_10223829	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1004	Open in IMG/M
3300031548\|Ga0307408_102261106	All Organisms → cellular organisms → Bacteria → Terrabacteria group	526	Open in IMG/M
3300031731\|Ga0307405_10897309	Not Available	749	Open in IMG/M
3300031824\|Ga0307413_10239340	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1339	Open in IMG/M
3300031903\|Ga0307407_11033809	All Organisms → cellular organisms → Bacteria	636	Open in IMG/M
3300031995\|Ga0307409_100480795	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1205	Open in IMG/M
3300031995\|Ga0307409_100890571	Not Available	903	Open in IMG/M
3300031995\|Ga0307409_102621329	All Organisms → cellular organisms → Bacteria → Terrabacteria group	532	Open in IMG/M
3300032896\|Ga0335075_10927915	Not Available	793	Open in IMG/M
3300034377\|Ga0334931_131493	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	596	Open in IMG/M
3300034384\|Ga0372946_0022945	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2738	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	79.82%
Host-Associated	Host-Associated	20.18%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	64.91%
Plants	Host-Associated → Plants	20.18%
Aquatic	Environmental → Aquatic	14.91%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	64.04%
Freshwater	Environmental → Aquatic → Freshwater	14.04%
Rhizosphere	Host-Associated → Plants → Rhizosphere	13.16%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.14%
Sediment	Environmental → Aquatic → Sediment	0.88%
Rock-Dwelling (Endoliths)	Environmental → Terrestrial → Rock-Dwelling (Endoliths)	0.88%
Roots	Host-Associated → Plants → Roots	0.88%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	54.39%
Ice	Environmental → Aquatic → Freshwater → Ice	12.28%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	11.40%
Loam	Environmental → Terrestrial → Soil → Loam	5.26%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.51%
Sand	Environmental → Terrestrial → Soil → Sand	2.63%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.63%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.75%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.75%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.75%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.88%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified	0.88%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.88%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	43.86%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	12.28%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	11.40%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.26%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.51%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.51%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.63%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	1.75%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.75%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.75%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	1.75%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.75%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.88%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.88%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.88%
Desert	Environmental → Terrestrial → Soil → Unclassified → Desert	0.88%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.88%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.88%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.88%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.88%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified	0.88%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.88%

Habitat	Taxonomy	Distribution
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	20.18%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	19.30%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	12.28%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	6.14%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.51%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.63%
Watersheds	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds	1.75%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.75%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.75%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.75%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.75%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	1.75%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.75%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.75%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.75%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.75%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.75%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.88%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.88%
Sub-Biocrust Soil	Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil	0.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.88%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.88%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.88%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.88%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.88%
Rock	Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock	0.88%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.88%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.88%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.88%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.88%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300004081	Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)	Environmental	Open in IMG/M
3300004153	Grasslands soil microbial communities from Hopland, California, USA (version 2)	Environmental	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300006033	Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15	Environmental	Open in IMG/M
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300009815	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10	Environmental	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010036	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental	Open in IMG/M
3300012042	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ489 (22.06)	Environmental	Open in IMG/M
3300012092	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06)	Environmental	Open in IMG/M
3300012093	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)	Environmental	Open in IMG/M
3300012183	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ469 (22.06)	Environmental	Open in IMG/M
3300012187	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06)	Environmental	Open in IMG/M
3300012188	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06)	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012679	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06)	Environmental	Open in IMG/M
3300012680	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)	Environmental	Open in IMG/M
3300012684	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)	Environmental	Open in IMG/M
3300012915	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2	Environmental	Open in IMG/M
3300012975	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015	Environmental	Open in IMG/M
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300013768	Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M	Environmental	Open in IMG/M
3300014264	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rd	Environmental	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300017789	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)	Environmental	Open in IMG/M
3300018077	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300018910	Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 18 hrs after wetting v1	Environmental	Open in IMG/M
3300021339	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1	Environmental	Open in IMG/M
3300023077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6	Environmental	Open in IMG/M
3300024347	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300027647	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq	Environmental	Open in IMG/M
3300027851	Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes)	Environmental	Open in IMG/M
3300027961	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)	Environmental	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300028744	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367	Environmental	Open in IMG/M
3300028754	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157	Environmental	Open in IMG/M
3300028755	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356	Environmental	Open in IMG/M
3300028796	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141	Environmental	Open in IMG/M
3300028811	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149	Environmental	Open in IMG/M
3300028819	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153	Environmental	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300030510	Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)	Environmental	Open in IMG/M
3300030990	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031099	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031184	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S	Environmental	Open in IMG/M
3300031424	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031450	Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Host-Associated	Open in IMG/M
3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Host-Associated	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032896	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4	Environmental	Open in IMG/M
3300034377	Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 27HNS	Environmental	Open in IMG/M
3300034384	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.65
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.65
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F080994

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0063454_1013225032	3300004081	Soil	KTSVVDVYTALLAIGAFLALNRWHSKLTVLYVVLGCGAIGALLQATIV*
Ga0063455_1012793941	3300004153	Soil	TGLLAVGAFLVLLRFHGKLTVLYVVLGCGAIGGLLQLTVV*
Ga0070710_110575602	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	VDVYTALIAIAAFAILVRFHSKLTVLYVVLGGGAIGAVLQATVV*
Ga0070705_1005031032	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	VDVWTAILAIGAFLVLNRWHGKLTVLYVVLGCGLIGAGLQLSGIA*
Ga0070684_1004193293	3300005535	Corn Rhizosphere	SIVDVYTAILAVAAFLALNRWHGKLTVLYVVLGCGVAGVLLQATIV*
Ga0070665_1010502873	3300005548	Switchgrass Rhizosphere	TSVVDVYTAVLAVAAFLALNRWHGKLTVLYVVLGCGVAGVLLQATAV*
Ga0068856_1006422743	3300005614	Corn Rhizosphere	AIAAFAILVRFHSKLTVLYVVLGGGAIGAVLQATVV*
Ga0068866_101944341	3300005718	Miscanthus Rhizosphere	DVWTAILAIGAFLVLNRWHGKLTVLYVVLGCGLIGAGLQLSGIA*
Ga0068866_113289762	3300005718	Miscanthus Rhizosphere	LAIGAFLVLNRYHAKLTVLYVVLGCGLIGLLLQLTVV*
Ga0075012_100962363	3300006033	Watersheds	DVPTAVLAVAAFYVLYRFHSKLTVVAVILGCGLLGALWQFV*
Ga0075365_105687941	3300006038	Populus Endosphere	SAILAIAAFAALYRWQAKLTVLFVVLGCGLLGAALQLTVL*
Ga0066652_1004088372	3300006046	Soil	LAVGAFLALNRWHGKLTVVYVVLASGLIGAALQLSGVV*
Ga0066652_1013306953	3300006046	Soil	AIGAFAALTRWHSKVTVLWVVLGCGAIGVLLQATVV*
Ga0075433_118385452	3300006852	Populus Rhizosphere	ALLALGAFAALMSFHGKLTVLYVVLGCGLVGVVLQLTVV*
Ga0066710_1015334551	3300009012	Grasslands Soil	KTSVVDVYTALLAIGAFLVLNRWHSKLTVLWVVLGCGAIGALLQATIV
Ga0075418_109402991	3300009100	Populus Rhizosphere	VGAFVVLNRWHGKLTVLYVVLACGAVGALVQLAGLV*
Ga0066709_1035426991	3300009137	Grasslands Soil	DVPTAILAIGAFLALSRFHGKMTVLYVVLGCGAIGALLQATVV*
Ga0066709_1044062031	3300009137	Grasslands Soil	IGAFLTLSRFHGKLTVLYVVLGCGAIGTLLQLTVI*
Ga0105243_106293421	3300009148	Miscanthus Rhizosphere	VYTALIAIAAFAILVRFHSKLTVLYVVLGGGAIGAVLQATVV*
Ga0126307_100162556	3300009789	Serpentine Soil	WTAALAALSFAALIRWHGKLTVLFVVLGAGFAGAMLELAGVA*
Ga0126307_100608131	3300009789	Serpentine Soil	DVSTALLAVAAFLALNRWHGKLTIVAVVISCGLIGLALQATGAV*
Ga0126307_101450951	3300009789	Serpentine Soil	AIAAFAVLMRYHDKLTVLYVVLGCGAVGAALQLTVL*
Ga0105070_10057702	3300009815	Groundwater Sand	VVDVPTALLALGAFAALMRFHGKLTVLYVVLGCGLIGVGLQLTVV*
Ga0126313_104679512	3300009840	Serpentine Soil	VGAFLVLTRFHGKLTVLYVVLGCGGLGALLQLTVL*
Ga0126313_108725611	3300009840	Serpentine Soil	ILDASIVDVPTAILAVAAFLALNRWHGKLTVVAVVLGCGVVGAILQMTGAV*
Ga0126313_109990713	3300009840	Serpentine Soil	DVPTALLAAGAFLVLNRYHGKLSVLYVVLGCGAIGAALQATVI*
Ga0126313_111496621	3300009840	Serpentine Soil	AYTAVLAVGAFAALQRWHGKLTVLYAVLGCGLIGALLQLTIL*
Ga0126305_104792241	3300010036	Serpentine Soil	ILAVAAFLALNRWHGKLTVVAVVLGCGVVGAILQMTGAV*
Ga0126304_110649892	3300010037	Serpentine Soil	VPTAVLAVTAFLVLNRWHGKLTVLYVVLGCGATGALLRVAGLM*
Ga0126315_102093462	3300010038	Serpentine Soil	VPTAILAVAAFLALNRWHGKLTVVAVVLGCGVVGAILQMTGAV*
Ga0126315_106174072	3300010038	Serpentine Soil	DASIVDVPTAILAVAAFAALNRWHGKLTVVAVVLGCGAAGVILQATSAV*
Ga0126309_100591711	3300010039	Serpentine Soil	VLAIGAFLVLNRFHSKLTVLYVVLGCGAIGALLQATIV*
Ga0126308_108203752	3300010040	Serpentine Soil	AIAAFAALTRWHAKTTVLWVVLACGAVGTLLQATVV*
Ga0126308_109190763	3300010040	Serpentine Soil	MAAFVALSRWHGKVTVVAVVLGCGIVGAVLQTTGAV*
Ga0126312_101992803	3300010041	Serpentine Soil	VDTGVVDLPTALLALGAFAALMRFHGKLTVLYVVLGCGLIGLVLRLTIV*
Ga0126312_104549472	3300010041	Serpentine Soil	VDVPTALLALGAFAALMRFHGKLTVLYVVLGCGLVGVALQATVI*
Ga0126314_101222422	3300010042	Serpentine Soil	VPTAVLAVAAFAVLYRFHTKLTVLYVVLGCGAIGALLQLSGTA*
Ga0126314_102164651	3300010042	Serpentine Soil	SVVDVPTALLAVGAFLVLTRFHGKLTVLYVVLGCGGLGALLQLTVL*
Ga0126314_104181511	3300010042	Serpentine Soil	SVVDAYTAVLAVGAFAALQRWHGKLTVLYVVLGCGLIGTLLQLTIV*
Ga0126314_107522171	3300010042	Serpentine Soil	TAVLAVTAFLVLNRWHGKLTVLYVMLGCGATGALLQGTGLV*
Ga0126310_104337732	3300010044	Serpentine Soil	DILDTSIVDVPTALLAVSAFLALNRWHGKLTIVAVVLSCGLAGVALQATGAV*
Ga0126311_110693411	3300010045	Serpentine Soil	ILDASIVDVPTAILAVAAFAALNRWHGKLTVVAVVLGCGVAGVLLQATGAV*
Ga0126311_113530241	3300010045	Serpentine Soil	ILDASIVDVPTAILAVAAFAALNRWHGKLTVVAVVLGCGAAGVILQATSAV*
Ga0136627_10163673	3300012042	Polar Desert Sand	GLIAVGAFAALMRFHSKLTVLWVVLGCGTIGAALQLTVL*
Ga0136621_11250921	3300012092	Polar Desert Sand	GAFLALYRFQAKLTVLFVVLGCGLIGAALQFSVL*
Ga0136632_101010574	3300012093	Polar Desert Sand	VVDVPTALLAVGAFLVLNRWHGKLTVLYVVLGCGAIGALLQVADLV*
Ga0136624_10933482	3300012183	Polar Desert Sand	GAFAALMRFHSKLTVLWVVLGCGTIGAALQLTVL*
Ga0136622_104211831	3300012187	Polar Desert Sand	IAVGAFAALMRFHSKLTVLWVVLGCGTIGAALQLTVL*
Ga0136618_102416361	3300012188	Polar Desert Sand	TALLAVGAFLVLNRWHGKLTVLYVVLGCGAIGALLQVADLV*
Ga0150985_1087389062	3300012212	Avena Fatua Rhizosphere	GWPAALAIGAFAVLQLWHGKLTVVYVVLGCGLIGALLQATVV*
Ga0137369_108069891	3300012355	Vadose Zone Soil	TALLAVAAFGALMRFHGKLTVLYVVMGCGLVGGLLQITVA*
Ga0136616_100588594	3300012679	Polar Desert Sand	GGFLVLNRYHGKLTVLYVVLGCGLIGAALQLTVV*
Ga0136616_103858523	3300012679	Polar Desert Sand	AVGAFLVLNRYHSKLTVLYVVLGCGLIGAMLQLMVL*
Ga0136612_100753342	3300012680	Polar Desert Sand	LAVGAFLVLNRWHGKLTVLYVVLGCGAIGALLQVCRACR*
Ga0136614_101165613	3300012684	Polar Desert Sand	APTAVLAMAAFLALNRWHGKLTVVAVVLGCGIAGAVLQTTGTV*
Ga0136614_104115531	3300012684	Polar Desert Sand	PTAVLAVGAFLILSRFHEKTTVLYVVLGCGAIGATLQLTVL*
Ga0157302_103025121	3300012915	Soil	SVVDLPTALIAIGAFLALNRWHGKLTVVYVVLGCGLIGAALQLSGLV*
Ga0134110_104052931	3300012975	Grasslands Soil	AVGAFLALNRWHSKLTVLYVVLGCGAVGALLQATVV*
Ga0134087_107792451	3300012977	Grasslands Soil	AGIVDIYTAALALGAFLALNRWHGKLTVLYVVAGCGEIGAALQLTIV*
Ga0157378_118189951	3300013297	Miscanthus Rhizosphere	MNMRKMMSLAAFAVLMRFHGKLTVLYVVLGCGAVGALLQLTVV*
Ga0163162_111786121	3300013306	Switchgrass Rhizosphere	IVKTSVVDVYTAVLAIGAFLALNRWHGKLTVLYVVLGCGVLGVLLQATVV*
Ga0157375_109651833	3300013308	Miscanthus Rhizosphere	IAAFAILVRFHSKLTVLYVVLGGGAIGAVLQATVV*
Ga0120155_10398503	3300013768	Permafrost	VVDVPTAVLAIGAFAVLCRFHSKLTVLYVVLGCGAIGALLQATVV*
Ga0075308_11293621	3300014264	Natural And Restored Wetlands	DTGIVDGWTAALAILAFAALNRWHGKLTVLYVVVGCGLAGALLQLLVV*
Ga0132257_1022226581	3300015373	Arabidopsis Rhizosphere	LAIGAFAALNRWHGKLTVVYVVLGCGLIGAALQVSGVV*
Ga0132257_1034504162	3300015373	Arabidopsis Rhizosphere	YTALIAIAAFAILVRFHSKLTVLYVVLGGGAIGAVLQATVVEV*
Ga0136617_100530954	3300017789	Polar Desert Sand	PTALLAIASFAALYRFQSKLTVLYVVVGAGLAGALLQATVV
Ga0136617_111881851	3300017789	Polar Desert Sand	LAVGAFAALQRWHGKLTVLWVVLACGAIGGVLQLTVV
Ga0136617_113710262	3300017789	Polar Desert Sand	TAVLAIGAFLALNRWHGKLTVLFVVAACGATGAALQLSGVV
Ga0184633_101722143	3300018077	Groundwater Sediment	LIEIAAFLALYRFHSKLTVLYVMIGCGAIGALLQLTVL
Ga0190275_111611341	3300018432	Soil	EILDTSIVDAPTAVLAMAAFVALNRWHGKLTVVAVVLGCGIVGAVLQTTGAV
Ga0190275_125097412	3300018432	Soil	AALAFLALYRFEGKLTVLWVVLGCGAVGALLQLTVL
Ga0190268_102317762	3300018466	Soil	VGAFAVLYRFQGKLTILFVVLGCGALGALLQLTVV
Ga0190268_104583012	3300018466	Soil	ALAVGAFAVLYRAGSKLAVLWVVLGCGVLGALLQLTIL
Ga0190268_114944911	3300018466	Soil	ILAVAAFAVLMRWHARLTVLYVVVGCGLIGGALQATGVV
Ga0190270_104531511	3300018469	Soil	PTAILAVGAFLVLMRAHGKLSILYVVLGCGAIGAVLQATGVV
Ga0190270_111549322	3300018469	Soil	DVPTAIIAVAAFLALNRWHGKLTVLFVVAGAGIAGAALQLSGLV
Ga0190270_114394572	3300018469	Soil	ASVPDWPSALLALGAFAALYRWSGKLTVLWVVLGCGAIGALLQLTVL
Ga0066669_110275082	3300018482	Grasslands Soil	LLAIGAFLVLLRFHAKLTVLYVVLGCGAIGALLQLTIV
Ga0193598_10123651	3300018910	Soil	TVDVLEASVVDLPTAILAVAAFAALTRWHGKLVVVGAVLGCGIIGALLQATAVV
Ga0193706_11114111	3300021339	Soil	VVDVYTGVLAVAAFLALNRWHGKLTVLYVVLGCGLVGALLQQTVV
Ga0247802_10096251	3300023077	Soil	LDASVVDAYTAALAVGAFLALNRWHGKLTVLYVVLSCGAIGAVLQLTFV
Ga0179591_11976461	3300024347	Vadose Zone Soil	GRASSDVYTALIAIAAFLALNHWHGKLTVLYVMLGCGLVGVLLQATVV
Ga0207709_118534762	3300025935	Miscanthus Rhizosphere	DVYTAILAVASFLVLNRFHGKLTVLYVVLGCGVIGAVLQATVV
Ga0207669_116436431	3300025937	Miscanthus Rhizosphere	VMLDILDTSIVDLPTALLAIGAFLALSRWHSKLTVVYVMAACGAIGALLQAI
Ga0207708_103118901	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	ALIAIAAFAILVRFHSKLTVLYVVLGGGAIGAVLQATVV
Ga0214468_10467353	3300027647	Soil	TSVVDAPTAILALLAFLALNRWHGKLTVLYVVLGCGIAGAGLQLSGIV
Ga0209066_103578412	3300027851	Watersheds	TAVLAVAAFYVLYRFHSKLTVVAVILGCGLLGALWQFV
Ga0209853_11193152	3300027961	Groundwater Sand	ALGAFAALMRFHGKLTVLYVVLGCGLIGVGLQLTVV
Ga0247822_116411181	3300028592	Soil	DVPTATLAIGAFLVLSRWHGKLTVLYVVLGCGAIGAAIQLSGVV
Ga0307318_100585201	3300028744	Soil	IADTSIVDVPSALIAIAAFLALSRWHGSLTVLWVMLGSGLVGVALQLTVL
Ga0307297_100420184	3300028754	Soil	ASVVDVYTAALALGAFLALNRWHSKLTVLYVVAACGALGAALQLTIV
Ga0307297_103280531	3300028754	Soil	DLLETTVVDVPTAILAVAAFLVLNRFHDKLTVLYVVLGCGAAGALLQATGHA
Ga0307316_1000071313	3300028755	Soil	YTAVLALGAFLALNKWHSKLTVLYVVATCGAIGAALQLTVV
Ga0307287_102977552	3300028796	Soil	ALLAVAAFVVLSRYHGKMTVLYVVFGCGAIGALLQLTVV
Ga0307292_104366072	3300028811	Soil	VKTSVVDVYTALLAIGAFLALNRWHAKLTVLWVVLGCGAIGALLQATVV
Ga0307296_104389361	3300028819	Soil	ASVVDVPTAILAIAGFLALNRWHGKLTVLYVVLGCGAIGAALQFSGLV
Ga0307312_108751592	3300028828	Soil	KTSVVDVYTAVLAIGAFLALNRWHSKLTVVYVVLSCGAIGALLQATIV
Ga0268243_10790381	3300030510	Soil	IVDAGVVDAYTAALALGAFLALNRWHGKLTVLYVVLSCGAIGAILQLTVA
Ga0308178_10402631	3300030990	Soil	PTAILAVAAFAALTRWHSKLTVLYVVLGCGLVGAALQLTVL
Ga0308181_10159803	3300031099	Soil	PTALLAIGAFLALNRWHGKLTVVYVVLGCGLIGAALQVSGLV
Ga0307499_102865751	3300031184	Soil	VETSVVDFWTALLAIGAFLVLNRFHGKLTVLYVVLGCGVIGALLQATVV
Ga0308179_10634202	3300031424	Soil	VDLPTALLAIGAFLALNRWHGKLTVVYVVLGCGLIGAALQVSGLV
Ga0272433_102238291	3300031450	Rock	PSALLAIGAFLALYRFQAKLTVLFVVLGCGLIGAALQYSAL
Ga0307408_1022611061	3300031548	Rhizosphere	DLLDASVPDAPSALLALGAFAVLYRWPGKLIVVWVVLGCGAIGALLQLTVL
Ga0307405_108973093	3300031731	Rhizosphere	DVPTALLAVAAFLALNRWHGKLTVVAVVLGCGVAGATLQVSGAV
Ga0307413_102393403	3300031824	Rhizosphere	IGAFAALQRWHGKLTVLWVVLACGALGAVLQATVV
Ga0307407_110338093	3300031903	Rhizosphere	PTAVLAIAAFVALNRWHGKLVVVGAVLGCGVIGVLLQTTNVV
Ga0307409_1004807954	3300031995	Rhizosphere	IVKETVVDLPTALLAIAAFAVLMRFHGKLTVPYVVLGCGIVGAALQLTVL
Ga0307409_1008905711	3300031995	Rhizosphere	DVPTAILAVAAFGALNRWHGKLTVVAVVLGCGAAGVILQATGAV
Ga0307409_1026213291	3300031995	Rhizosphere	AVLALGAFAVLYLRPGKLTVLWVILGCGAIGALLQLTVL
Ga0335075_109279151	3300032896	Soil	DVWTGLLAIAAFLALLRWHGKLTVLYVVLGCGLAGALLQATVV
Ga0334931_131493_1_129	3300034377	Sub-Biocrust Soil	VYTGALALAAFLALNRWHSKLTVLYVVLGCGAIGAALQLTIV
Ga0372946_0022945_384_512	3300034384	Soil	VPSAILAAGAFAALYRFPGKLTVLYVVLGCGAIGAVLQLTVL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign