| Basic Information | |
|---|---|
| Family ID | F080991 |
| Family Type | Metagenome |
| Number of Sequences | 114 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MNPENQNNSKSYVDPTYLVLGISLAYFVDQTGIVQKLTNKLFKKEEE |
| Number of Associated Samples | 69 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 20.18 % |
| % of genes from short scaffolds (< 2000 bps) | 71.93 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.456 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil (14.035 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.825 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.509 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF06985 | HET | 0.88 |
| PF01381 | HTH_3 | 0.88 |
| PF01555 | N6_N4_Mtase | 0.88 |
| PF00216 | Bac_DNA_binding | 0.88 |
| PF00589 | Phage_integrase | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.88 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.88 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.46 % |
| Unclassified | root | N/A | 17.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001686|C688J18823_10415132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 869 | Open in IMG/M |
| 3300002099|JGI24808J26613_1001846 | Not Available | 7005 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100343747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1373 | Open in IMG/M |
| 3300002568|C688J35102_118306537 | Not Available | 547 | Open in IMG/M |
| 3300002568|C688J35102_119928671 | Not Available | 817 | Open in IMG/M |
| 3300002568|C688J35102_120618562 | Not Available | 1250 | Open in IMG/M |
| 3300002568|C688J35102_120669443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales | 1324 | Open in IMG/M |
| 3300002568|C688J35102_120888783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 2043 | Open in IMG/M |
| 3300002568|C688J35102_120902615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 2159 | Open in IMG/M |
| 3300002568|C688J35102_120910706 | Not Available | 2237 | Open in IMG/M |
| 3300002568|C688J35102_120919851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 2341 | Open in IMG/M |
| 3300002915|JGI25387J43893_1029645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 741 | Open in IMG/M |
| 3300003319|soilL2_10178212 | Not Available | 2574 | Open in IMG/M |
| 3300003322|rootL2_10203699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 3013 | Open in IMG/M |
| 3300004081|Ga0063454_100095631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales | 1395 | Open in IMG/M |
| 3300004081|Ga0063454_100353469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 954 | Open in IMG/M |
| 3300004081|Ga0063454_101482863 | Not Available | 579 | Open in IMG/M |
| 3300004092|Ga0062389_100028371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 4118 | Open in IMG/M |
| 3300005172|Ga0066683_10414170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 831 | Open in IMG/M |
| 3300005175|Ga0066673_10011536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → unclassified Mycoplasmatales → endosymbiont GvMRE of Glomus versiforme | 3807 | Open in IMG/M |
| 3300005178|Ga0066688_10672216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 661 | Open in IMG/M |
| 3300005179|Ga0066684_10676539 | Not Available | 692 | Open in IMG/M |
| 3300005187|Ga0066675_10248801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1269 | Open in IMG/M |
| 3300005330|Ga0070690_100009506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales | 5636 | Open in IMG/M |
| 3300005330|Ga0070690_100165814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1517 | Open in IMG/M |
| 3300005330|Ga0070690_100285199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1179 | Open in IMG/M |
| 3300005330|Ga0070690_101793955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 500 | Open in IMG/M |
| 3300005343|Ga0070687_100767140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 680 | Open in IMG/M |
| 3300005439|Ga0070711_102003613 | Not Available | 509 | Open in IMG/M |
| 3300005458|Ga0070681_10964234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 772 | Open in IMG/M |
| 3300005468|Ga0070707_100528941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1141 | Open in IMG/M |
| 3300005529|Ga0070741_10636118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 948 | Open in IMG/M |
| 3300005544|Ga0070686_101212475 | Not Available | 627 | Open in IMG/M |
| 3300005587|Ga0066654_10014946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 2997 | Open in IMG/M |
| 3300005587|Ga0066654_10115447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1320 | Open in IMG/M |
| 3300005719|Ga0068861_100611417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales | 1002 | Open in IMG/M |
| 3300006028|Ga0070717_11840102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 547 | Open in IMG/M |
| 3300006032|Ga0066696_11023971 | Not Available | 525 | Open in IMG/M |
| 3300006854|Ga0075425_101977793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 652 | Open in IMG/M |
| 3300006854|Ga0075425_102877263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 528 | Open in IMG/M |
| 3300006918|Ga0079216_10935522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 659 | Open in IMG/M |
| 3300009012|Ga0066710_101301619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1127 | Open in IMG/M |
| 3300009012|Ga0066710_103182162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 631 | Open in IMG/M |
| 3300009137|Ga0066709_100573261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1603 | Open in IMG/M |
| 3300009137|Ga0066709_100627764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1535 | Open in IMG/M |
| 3300009137|Ga0066709_101754453 | Not Available | 875 | Open in IMG/M |
| 3300009137|Ga0066709_104334621 | Not Available | 517 | Open in IMG/M |
| 3300009553|Ga0105249_12361676 | Not Available | 604 | Open in IMG/M |
| 3300009553|Ga0105249_13148111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 530 | Open in IMG/M |
| 3300010037|Ga0126304_10299413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → unclassified Mycoplasmatales → endosymbiont GvMRE of Glomus versiforme | 1065 | Open in IMG/M |
| 3300010373|Ga0134128_10019400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 8067 | Open in IMG/M |
| 3300010373|Ga0134128_10165923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 2494 | Open in IMG/M |
| 3300010373|Ga0134128_10526702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1317 | Open in IMG/M |
| 3300010375|Ga0105239_10811107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1072 | Open in IMG/M |
| 3300010396|Ga0134126_10172495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 2606 | Open in IMG/M |
| 3300010396|Ga0134126_10344916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales | 1738 | Open in IMG/M |
| 3300010397|Ga0134124_10033738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → unclassified Mycoplasmatales → endosymbiont GvMRE of Glomus versiforme | 4251 | Open in IMG/M |
| 3300010397|Ga0134124_10053064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 3416 | Open in IMG/M |
| 3300010397|Ga0134124_10109935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 2410 | Open in IMG/M |
| 3300010397|Ga0134124_10217563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1743 | Open in IMG/M |
| 3300010397|Ga0134124_10329403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1432 | Open in IMG/M |
| 3300010397|Ga0134124_10429313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1263 | Open in IMG/M |
| 3300010397|Ga0134124_11808416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 645 | Open in IMG/M |
| 3300010397|Ga0134124_13134210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 506 | Open in IMG/M |
| 3300010401|Ga0134121_10221076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1646 | Open in IMG/M |
| 3300010401|Ga0134121_10246615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1561 | Open in IMG/M |
| 3300010401|Ga0134121_10788923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 911 | Open in IMG/M |
| 3300012198|Ga0137364_10168702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1592 | Open in IMG/M |
| 3300012198|Ga0137364_10640103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 802 | Open in IMG/M |
| 3300012201|Ga0137365_10380636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1041 | Open in IMG/M |
| 3300012201|Ga0137365_10601438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 806 | Open in IMG/M |
| 3300012201|Ga0137365_10762470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 707 | Open in IMG/M |
| 3300012201|Ga0137365_10946349 | Not Available | 627 | Open in IMG/M |
| 3300012285|Ga0137370_10171620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1263 | Open in IMG/M |
| 3300012350|Ga0137372_10791759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 681 | Open in IMG/M |
| 3300012354|Ga0137366_11026544 | Not Available | 572 | Open in IMG/M |
| 3300012356|Ga0137371_10031856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales | 4067 | Open in IMG/M |
| 3300012356|Ga0137371_10124565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 2013 | Open in IMG/M |
| 3300012356|Ga0137371_10516529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 921 | Open in IMG/M |
| 3300012360|Ga0137375_10135346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 2434 | Open in IMG/M |
| 3300012532|Ga0137373_10144227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales | 2017 | Open in IMG/M |
| 3300014325|Ga0163163_10225980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1921 | Open in IMG/M |
| 3300014325|Ga0163163_11048600 | Not Available | 878 | Open in IMG/M |
| 3300018051|Ga0184620_10124697 | Not Available | 815 | Open in IMG/M |
| 3300018431|Ga0066655_10997392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 578 | Open in IMG/M |
| 3300018433|Ga0066667_10188487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1502 | Open in IMG/M |
| 3300018433|Ga0066667_10458437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1042 | Open in IMG/M |
| 3300018433|Ga0066667_11469340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 601 | Open in IMG/M |
| 3300018465|Ga0190269_10007022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 5086 | Open in IMG/M |
| 3300018465|Ga0190269_10024944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales | 2700 | Open in IMG/M |
| 3300018468|Ga0066662_10951680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 847 | Open in IMG/M |
| 3300018468|Ga0066662_11306030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 744 | Open in IMG/M |
| 3300019868|Ga0193720_1059976 | Not Available | 527 | Open in IMG/M |
| 3300019879|Ga0193723_1003986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 5154 | Open in IMG/M |
| 3300020009|Ga0193740_1000578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales | 9491 | Open in IMG/M |
| 3300020009|Ga0193740_1005105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales | 2303 | Open in IMG/M |
| 3300020009|Ga0193740_1012569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1357 | Open in IMG/M |
| 3300020016|Ga0193696_1151515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 571 | Open in IMG/M |
| 3300020580|Ga0210403_10768172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 768 | Open in IMG/M |
| 3300025910|Ga0207684_10622867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 920 | Open in IMG/M |
| 3300025912|Ga0207707_11459439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 543 | Open in IMG/M |
| 3300025918|Ga0207662_10200066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 1293 | Open in IMG/M |
| 3300025922|Ga0207646_10879965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 795 | Open in IMG/M |
| 3300025936|Ga0207670_10055190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 2684 | Open in IMG/M |
| 3300025939|Ga0207665_10098178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 2040 | Open in IMG/M |
| 3300026118|Ga0207675_100714386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales | 1012 | Open in IMG/M |
| 3300026295|Ga0209234_1021787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → unclassified Mycoplasmatales → endosymbiont GvMRE of Glomus versiforme | 2425 | Open in IMG/M |
| 3300026316|Ga0209155_1030890 | Not Available | 2173 | Open in IMG/M |
| 3300027869|Ga0209579_10407949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 736 | Open in IMG/M |
| 3300031456|Ga0307513_10070762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales | 3644 | Open in IMG/M |
| 3300031456|Ga0307513_10159265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 2152 | Open in IMG/M |
| 3300032829|Ga0335070_11213478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 692 | Open in IMG/M |
| 3300032897|Ga0335071_11423482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 638 | Open in IMG/M |
| 3300034819|Ga0373958_0143986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 592 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 14.04% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.28% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 12.28% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 12.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.02% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 7.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.26% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.75% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 1.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.75% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.88% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.88% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.88% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.88% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002099 | Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDA | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020009 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J18823_104151322 | 3300001686 | Soil | MSNETQNT*KSYVD*FPTYLVLGISLAYFVDKTGIVQKITQKLFTKKDEE* |
| JGI24808J26613_100184610 | 3300002099 | Soil | MKENPNT*KSYVD**PTYLVLGISLAYFIDNTGIISKLTTKLFTKKEE* |
| JGIcombinedJ26739_1003437475 | 3300002245 | Forest Soil | MNPENPNTN*KSYVD**PAYIVVGITLAYFVDKTGIVQKLTNRLFTKKAESE* |
| C688J35102_1183065371 | 3300002568 | Soil | MNPETQNT*KSYVD**PTYIIIGISLAYFVDETGIVQKLTNKLFTKKE |
| C688J35102_1199286713 | 3300002568 | Soil | MNQNN*KSYVDW*PTYLILGVSLAYFINQTEVIQKLTDKLFIKKEAE* |
| C688J35102_1206185621 | 3300002568 | Soil | MNQNN*KSYVDW*PTYLILGVSLAYFINQTGIIQKLTDKLLKKESE* |
| C688J35102_1206694435 | 3300002568 | Soil | MNNENTNN*KA*VD*WPTYLVIGISLAYFINKTGVVQKLTSKIFTKKEAE* |
| C688J35102_1208887835 | 3300002568 | Soil | MSNENNT*KSYVD**PTYLVLGISLAYFIDQSGIIQKLTNRLFKKEESE* |
| C688J35102_1209026156 | 3300002568 | Soil | MPNQTQNT*KSYVD**PTYIIIGISLAYFIDETGIVQKLTNKLFTKKEE* |
| C688J35102_1209107063 | 3300002568 | Soil | MKPNTN*KSYVDY*PTYLILGISLAYFVDKTGVISQLTNKLFTKKEAE* |
| C688J35102_1209198513 | 3300002568 | Soil | MQNLQKEYLNN*KAYVD**PTYLVLGISLAYLVDKTGIVQKLSAKLFSKKVEE* |
| JGI25387J43893_10296453 | 3300002915 | Grasslands Soil | MNPETTNN*KSYVD**PTYFVLGISLAYFVDKSGIVPKLSTKLFKKEGNN* |
| soilL2_101782129 | 3300003319 | Sugarcane Root And Bulk Soil | MLPKQNN*KSYVD**PTYLIIGVSLAYFIDKSGIVTKLTNKFFQKAE* |
| rootL2_102036997 | 3300003322 | Sugarcane Root And Bulk Soil | MENTNTN*KSYVD**PSYIVIGITLAYFVHQTGIVPKLTNQLFKKSEE* |
| Ga0063454_1000956313 | 3300004081 | Soil | MNSETTPNN*KSYVD*FPTYLVLGITLAYFVDQTEIVQKLTQKLFTKKEE* |
| Ga0063454_1003534694 | 3300004081 | Soil | MQNLQKEYLNN*KAYVD**PTYLVLGISLAYLVDKTGIVQKLSAKLFSKKV |
| Ga0063454_1014828632 | 3300004081 | Soil | MNNNNNT*KSYVD*FPTYLILGVSLAYLVDKTEIIQKLTDKLFTKKEAE* |
| Ga0062389_1000283717 | 3300004092 | Bog Forest Soil | MNPENQNTN*KSYVD**PTYIVLGIALAHFVNQTGIVQKLTNKLFTKKVSE* |
| Ga0066683_104141702 | 3300005172 | Soil | MPNQTN*KSYVD*WPTYLVLGISLAYFVDQTGIVQKLTNKLLKKEE* |
| Ga0066673_100115367 | 3300005175 | Soil | MNQNN*KSYVDW*PTYLILGVSLAYFINQTEVIQKLTDKLFTKKEAE* |
| Ga0066688_106722161 | 3300005178 | Soil | MNPETTNT*KSYVD**PTYLVLGLSLAYFVDQTGIVQKLTNKFFKKDEE* |
| Ga0066684_106765393 | 3300005179 | Soil | MNNQNTN*KSYVD**PTYLILGVSLAYFIDQSGIVQKLTTKLLTKKESE* |
| Ga0066675_102488011 | 3300005187 | Soil | MNPETTNN*KSYVD**PTYFVLGISLAYFVDKSGIVPKLS |
| Ga0070690_10000950610 | 3300005330 | Switchgrass Rhizosphere | MQNQTNN*KSYVD**PTYLILGISLAYLVDQTGIVQKLSSKLLKKAEE* |
| Ga0070690_1001658143 | 3300005330 | Switchgrass Rhizosphere | MNNQNTN*KSYVD**PTYLVLGISLAYFVDQTGIVQKLTNKFFKKEE* |
| Ga0070690_1002851992 | 3300005330 | Switchgrass Rhizosphere | MNTNENQNT*KSYVD**PTYLVLGISLAYFVDQTSIVAKIKSQTIY* |
| Ga0070690_1017939552 | 3300005330 | Switchgrass Rhizosphere | MNENNT*KDYVD*WPTYLVLGISLAYFVDQTGIVQKLTNKLFTKKESE* |
| Ga0070687_1007671402 | 3300005343 | Switchgrass Rhizosphere | MNSETPNT*KSYVD*WPTYLILGISLAYFVDQTGIVQKLSTKLFTKKEE* |
| Ga0070711_1020036131 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | *KSYVD**PTYLVLGISLAYFVDQTEIVQKLTNKFFKKEE* |
| Ga0070681_109642341 | 3300005458 | Corn Rhizosphere | MNPENQNNS*KSYVD**PTYLVLGISLAYFVDQTGIVQKLTNKLFKKEEE* |
| Ga0070707_1005289415 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSETPNT*KSYVD*WPTYLILGISLAYFVDQTGIVQKLS |
| Ga0070741_106361181 | 3300005529 | Surface Soil | MNPENNTN*KSYVD**PTYLIIGISLAYFIDKTGLVQKLTNNLFKKEE* |
| Ga0070686_1012124753 | 3300005544 | Switchgrass Rhizosphere | MQNQTNN*KSYVD**PTYLILGISPAYLVDQTGIVQKLSSKLLKKAEE* |
| Ga0066654_100149465 | 3300005587 | Soil | MENNTNNN*KSYVD**PSYIVVGITLAYFIDQTGIVQKLTNKLFKKAAE* |
| Ga0066654_101154474 | 3300005587 | Soil | MPKDQILNN*KSYVD**PTYLVLGISLAYFVDKTGIVQKLTNKLFAKKEAE* |
| Ga0068861_1006114172 | 3300005719 | Switchgrass Rhizosphere | MNNENTN*KSYVD**PTYLVLGIAVAHFINETGIVQKLTNKLFTKKEE* |
| Ga0070717_118401021 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNNQNTN*KSYVD**PTYLVLEISLAYFVDQTGIVQKLTNKFFKKEE* |
| Ga0066696_110239712 | 3300006032 | Soil | MNQNQNN*KSYVDW*PTYLILGVSLAYFINQTGIIQKLTDKLLKKEAE* |
| Ga0075425_1019777934 | 3300006854 | Populus Rhizosphere | MNNNQTN*KSYVD**PTYLVLGISLAYFVDQTGIVQKLT |
| Ga0075425_1028772632 | 3300006854 | Populus Rhizosphere | NNNT*KSYVD*WPTYLVLGISLAYFIDKTGIIPKLTNKLFKKEAE* |
| Ga0079216_109355222 | 3300006918 | Agricultural Soil | MNPENTN*KSYVD**PTYVVLGITLAYFVDETGIVQKLTQKLFTKKEE* |
| Ga0066710_1013016193 | 3300009012 | Grasslands Soil | MNPETTNNXKSYVDXXPTYFVLGISLAYFVDKSGIVPKLSTKLFKKEGNN |
| Ga0066710_1031821622 | 3300009012 | Grasslands Soil | MNNETNTXKSYVDCWPTYLILGISLAYFVDQTGIVQKLSTKLFTKKEE |
| Ga0066709_1005732612 | 3300009137 | Grasslands Soil | MNPETTNN*KSYVD**PTYFVLGISLAYFVDKSGVVPKLSTKLFKKEGNN* |
| Ga0066709_1006277643 | 3300009137 | Grasslands Soil | MNNETNT*KSYVDCWPTYLILGISLAYFVDQTGIVQKLSTKLFTKKEE* |
| Ga0066709_1017544532 | 3300009137 | Grasslands Soil | MFPKSNNN*KSYVDW*PTYLILGVSLAYFINQTGIIQKLTDKLLKKEAE* |
| Ga0066709_1043346212 | 3300009137 | Grasslands Soil | MNNQNTN*KSYVD**PTYLVLGLSLAYFVDQTGIVQKLTNKFFKKDEEE* |
| Ga0105249_123616764 | 3300009553 | Switchgrass Rhizosphere | MQNQTNN*KSYVD*WQTYLILGISLAYFVDQTGIVQK |
| Ga0105249_131481113 | 3300009553 | Switchgrass Rhizosphere | MSNNPNNT*KSYVD**PTYLVLGISLAYFVDQTGIVQKLTNRLFNK |
| Ga0126304_102994133 | 3300010037 | Serpentine Soil | MNPENTNNN*KSYVD**PSYIVVGITLAYFIDQTGIVQKLTNKLFKKAAE* |
| Ga0134128_1001940012 | 3300010373 | Terrestrial Soil | MNPENQNTN*KSYVD**PSYIVIGITLAYFVHQTGIVQKLTNKLFKKGEE* |
| Ga0134128_101659237 | 3300010373 | Terrestrial Soil | MNPENQNNS*KSYVD**PTYLVLGISVAYFVDQTGIVQKLTNKLFKKEED* |
| Ga0134128_105267026 | 3300010373 | Terrestrial Soil | MNLENQNNS*KSYVD**PTYLVLGISVAYFVDQTGIVQKLTNKLFKKEEE* |
| Ga0105239_108111074 | 3300010375 | Corn Rhizosphere | MNPENTN*KSYVD**PTYLVLGISLTYFVDQTGIVQKLTNKLFKKEE* |
| Ga0134126_101724951 | 3300010396 | Terrestrial Soil | MSTNQNQNT*KSYVD**PTYLVLGISLAYFVDQTGIVQQLSN |
| Ga0134126_103449163 | 3300010396 | Terrestrial Soil | MNNENNN*KSYVD**PTYIVLGISLAYFVDQSGIVQKLSSKLFTKKTESQSEEEY* |
| Ga0134124_1003373814 | 3300010397 | Terrestrial Soil | *KSYVD*WPTYLILGISLAYFVDQTGIVQKLSSKLFTKKEEE* |
| Ga0134124_100530646 | 3300010397 | Terrestrial Soil | MNNNNSN*KSYVD*WPTYLILGISLAYLVDQTGIVQKLSNKLLKKAEE* |
| Ga0134124_101099358 | 3300010397 | Terrestrial Soil | MNNETQST*KSYVD*WPTYLILGISLAYFVDQTGIVQKLSSKLFTKKE |
| Ga0134124_102175637 | 3300010397 | Terrestrial Soil | MNNNQNTN*KSYVD**PTYLVLGISLAYFVDQTGIVQKLTNKFFKKEE* |
| Ga0134124_103294032 | 3300010397 | Terrestrial Soil | MNPENQNNS*KSYVD**PTYLVLGISVAYFVDQTGIVQQLTNKLFKKEE* |
| Ga0134124_104293134 | 3300010397 | Terrestrial Soil | MNPETNT*KSYVD*WPTYLVLGISLAYFIDKTGIIPKLTNKLFKNSAEE* |
| Ga0134124_118084162 | 3300010397 | Terrestrial Soil | *KSYVD*WPTYLILGISLAYFVDQTGIVQKLSSKLFTKKEE* |
| Ga0134124_131342104 | 3300010397 | Terrestrial Soil | MNPENTN*KSYVD**PTYLVLGISLAYFVDQTGIVQ |
| Ga0134121_102210767 | 3300010401 | Terrestrial Soil | MQNENYT*KSYVD**PTYLVLGISLAYFVDQTGIVQKLTNKFFKKEE* |
| Ga0134121_102466156 | 3300010401 | Terrestrial Soil | MNNETQST*KSYVD*WPTYLILGISLAYFVDQTGIVQKLSSKLFTKKEEE* |
| Ga0134121_107889231 | 3300010401 | Terrestrial Soil | MNNNQNTN*KSYVD**PTYLVLGISLAYFVDQTGIVQKLTNKFF |
| Ga0137364_101687025 | 3300012198 | Vadose Zone Soil | MNENTNT*KSYVD**PTYLVLGISLAYFIDQSGIISKLTNKLFTKKDEE* |
| Ga0137364_106401032 | 3300012198 | Vadose Zone Soil | MNPETTNT*KSYVD**PTYLVLGLSLAYFVDQTGIVQKLTNKFFKKEEE* |
| Ga0137365_103806364 | 3300012201 | Vadose Zone Soil | MNPETNT*KSYVD**PTYLILGISLAYFVDETGIVQKLSQKIFTKKEED* |
| Ga0137365_106014384 | 3300012201 | Vadose Zone Soil | *KSYVD**PPYLILGISLAYFVDETGIVQKLSQKIFTKKEED* |
| Ga0137365_107624702 | 3300012201 | Vadose Zone Soil | MNNETQNT*KSYVD*WPTYLVLGISLAYFIDQSGIIQKLTNRLFKKEESE* |
| Ga0137365_109463491 | 3300012201 | Vadose Zone Soil | N*KSYVDY*PTYLILGISLAYFVDKTGVISQLTDKLFTKKEAE* |
| Ga0137370_101716204 | 3300012285 | Vadose Zone Soil | MNPETTNT*KSYVD**PTYLVLGISLAYFVDQTGIVQKLSSKFFKKDEEE* |
| Ga0137372_107917592 | 3300012350 | Vadose Zone Soil | MQPENQNNN*KS*VD*WPTYIIIGISLARFVHTTGIVQKLTDKLFTKKEENE* |
| Ga0137366_110265442 | 3300012354 | Vadose Zone Soil | MNPNQNNN*KSYVDLWPTYIVIGISLAYLVHQTGIVQKLTNKLFKKDEISTEEED* |
| Ga0137371_1003185612 | 3300012356 | Vadose Zone Soil | MNQENQITT*KT*VD**PTYIVIGISLAYLVDQTGIVQKATTKLFSKKEEE* |
| Ga0137371_101245653 | 3300012356 | Vadose Zone Soil | MNENTNT*KSYVD**PTYLVLGISLAYFIDQSGIISKLTNKLFTKKYEE* |
| Ga0137371_105165292 | 3300012356 | Vadose Zone Soil | MNPETNT*KSYVD**PPYLILGISLAYFVDETGIVQKLSQKIFTKKEED* |
| Ga0137375_101353467 | 3300012360 | Vadose Zone Soil | MNPENQNT*KSYVD**PVYLTLGISLAYFVDKTGIVQKLTNKLLKKEEE* |
| Ga0137373_101442277 | 3300012532 | Vadose Zone Soil | MNNETNT*KSYVD*WPTYLILGISLAYFVDQTGIVQKLSSKLLKKEE* |
| Ga0163163_102259804 | 3300014325 | Switchgrass Rhizosphere | MNNQNTN*KSYVD**PTYLVLGISLAYFVDQTGIVQKLTNKFFKKED* |
| Ga0163163_110486004 | 3300014325 | Switchgrass Rhizosphere | MQNETQNT*KS*ID**PTYLVLGISLAYFVDQTGIVQQLSRKLFTN |
| Ga0184620_101246972 | 3300018051 | Groundwater Sediment | MFPKSNNNXKSYVDWXPTYLILGVSLAYFINQTGIIQKLTDKLLKKESE |
| Ga0066655_109973922 | 3300018431 | Grasslands Soil | MNPETTNTXKSYVDXXPTYLILGVSLAYFIDQSGIVQKLTTKLFTKKESE |
| Ga0066667_101884876 | 3300018433 | Grasslands Soil | MNNETQSTXKSYVDXWPTYLVLGISLAYFVDQTGIVQKLTNKLLKKTEEE |
| Ga0066667_104584372 | 3300018433 | Grasslands Soil | MNPETTNNXKSYVDXXPTYFVLGISLAYFVDKSGVVPKLSTKLFKKEGNN |
| Ga0066667_114693402 | 3300018433 | Grasslands Soil | MNPETTNTXKSYVDXXPTYLVLGISLAYFVDQTGIVQKLTNKFFKKDEEE |
| Ga0190269_100070229 | 3300018465 | Soil | MENNQNXKSYVDXXPTYLILGISLAYFVDKTGIVQKITDQIFKKN |
| Ga0190269_100249446 | 3300018465 | Soil | MNPENTNXKSYVDXXPTYVVLGITLAYFVDETGIVQKLTQKLFTKKEE |
| Ga0066662_109516802 | 3300018468 | Grasslands Soil | MNQENQITTXKTXVEXXPTYIVIGISLAYLVDETGIVQKATTKLFSKKEAD |
| Ga0066662_113060302 | 3300018468 | Grasslands Soil | MNNENQSTXKSYVDXXPTYLILGISLAYFVDQTGIVPKLTNKLFTKKESE |
| Ga0193720_10599761 | 3300019868 | Soil | MNPENQNNXKSYVDXXPTYIMIGIALGYFIDETGIVQKLTNKL |
| Ga0193723_100398611 | 3300019879 | Soil | MNQENQITTXKTXVDXXPTYIVIGISLAYLVDQTGIVQKATTKLFSKKEEE |
| Ga0193740_10005786 | 3300020009 | Soil | MSNENYTXKSYVDXFPTYLILGVSLAYLIHKTEIVQKLTNQLFTKKESE |
| Ga0193740_10051055 | 3300020009 | Soil | MNPENTNPNNXKSYVDXXPTYIIIGITLVYFIDETGIVQKLTNKLFTKKEE |
| Ga0193740_10125694 | 3300020009 | Soil | MNPENTNHXKSYVDXXPTYIMIGIALGYFIDETGIVQKLTNKLFTKKEE |
| Ga0193696_11515152 | 3300020016 | Soil | MNLETTNNXKSYVDXXPAYFVLGISLAYFVDESGIVQKLSTKLFKKEGNN |
| Ga0210403_107681723 | 3300020580 | Soil | SYVDXWPTYLVLGIALAYFIDQTGLIPKLTDKLFTKKEASE |
| Ga0207684_106228673 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNQNTNXKSYVDXXPTYLVLGISLAYFVDQTGIVQKLTNKFFKKEE |
| Ga0207707_114594391 | 3300025912 | Corn Rhizosphere | MNPENQNNSXKSYVDXXPTYLVLGISLAYFVDQTGIVQKLTNKLFKKEEE |
| Ga0207662_102000663 | 3300025918 | Switchgrass Rhizosphere | MNSETPNTXKSYVDXWPTYLILGISLAYFVDQTGIVQKLSTKLFTKKEE |
| Ga0207646_108799651 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSETPNTXKSYVDXWPTYLILGISLAYFVDQTGIVQKL |
| Ga0207670_100551906 | 3300025936 | Switchgrass Rhizosphere | MQNQTNNXKSYVDXXPTYLILGISLAYLVDQTGIVQKLSSKLLKKAEE |
| Ga0207665_100981787 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNQNNTXKSYVDXXPTYLVLGISLAYFVDQTGIVQKLTNKFFKKEE |
| Ga0207675_1007143862 | 3300026118 | Switchgrass Rhizosphere | MNNENTNXKSYVDXXPTYLVLGIAVAHFINETGIVQKLTNKLFTKKEE |
| Ga0209234_10217873 | 3300026295 | Grasslands Soil | MNNQNNXKSYVDWXPTYLILGVSLAYFINQTGIIQKLTDKLLKKESE |
| Ga0209155_10308903 | 3300026316 | Soil | MNQNNXKSYVDWXPTYLILGVSLAYFINQTEVIQKLTDKLFTKKEAE |
| Ga0209579_104079492 | 3300027869 | Surface Soil | MNPENTNSNNXKSYVDXXPTYIVIGISLAYFVNQTGIVQKLTNQLFKKGESE |
| Ga0307513_100707628 | 3300031456 | Ectomycorrhiza | MNPENQNNNXKSYVDXXPTYFVLGISLAYFVDKSGIVPKLSTKLFKKEGNN |
| Ga0307513_101592653 | 3300031456 | Ectomycorrhiza | MNPENQNNNXKSYVDXXPAYFVLGISLAYFVDKSGIVQKLSTKLFKKEGNN |
| Ga0335070_112134782 | 3300032829 | Soil | MNLENQTTNXKTXVDXWPTYLIIGISLGYLVDETGIVQKLTNKLLKKED |
| Ga0335071_114234821 | 3300032897 | Soil | MNSENQTTNXKSYVDXWPTYIMIGISLGYLVDETGIVQKLTNKLLKKED |
| Ga0373958_0143986_461_592 | 3300034819 | Rhizosphere Soil | MSNNPNNTWKSYVDWWPTYLVLGISLAYLVDQTGIVPQLTNKFF |
| ⦗Top⦘ |