NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080985

Metagenome / Metatranscriptome Family F080985

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080985
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 73 residues
Representative Sequence MSMRRIAALQAGLLLAAVLANAASQKDTVRITVLDSVTRSSTPDNNNGVPQNCEQLTFDAYCRST
Number of Associated Samples 102
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.27 %
% of genes near scaffold ends (potentially truncated) 95.61 %
% of genes from short scaffolds (< 2000 bps) 79.82 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.351 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(21.053 % of family members)
Environment Ontology (ENVO) Unclassified
(37.719 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.491 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 22.58%    β-sheet: 0.00%    Coil/Unstructured: 77.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF16177ACAS_N 4.39
PF13507GATase_5 1.75
PF07366SnoaL 0.88
PF00793DAHP_synth_1 0.88
PF13407Peripla_BP_4 0.88



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.35 %
UnclassifiedrootN/A9.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001151|JGI12713J13577_1011005All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7792Open in IMG/M
3300004080|Ga0062385_11070268Not Available545Open in IMG/M
3300004082|Ga0062384_100632252All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7729Open in IMG/M
3300004092|Ga0062389_103027393All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7629Open in IMG/M
3300004121|Ga0058882_1741118All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7568Open in IMG/M
3300004473|Ga0068919_1425795All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71071Open in IMG/M
3300005591|Ga0070761_10141043All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71408Open in IMG/M
3300006861|Ga0063777_1034813All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7500Open in IMG/M
3300009519|Ga0116108_1049757All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71332Open in IMG/M
3300009552|Ga0116138_1019514All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72116Open in IMG/M
3300009614|Ga0116104_1084659All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7644Open in IMG/M
3300009623|Ga0116133_1000005All Organisms → cellular organisms → Bacteria64988Open in IMG/M
3300009624|Ga0116105_1093278All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7745Open in IMG/M
3300009635|Ga0116117_1106664All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7704Open in IMG/M
3300009637|Ga0116118_1244288All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7552Open in IMG/M
3300009638|Ga0116113_1108872All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7673Open in IMG/M
3300009645|Ga0116106_1257675All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7555Open in IMG/M
3300009760|Ga0116131_1150239All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7670Open in IMG/M
3300009762|Ga0116130_1302491All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7511Open in IMG/M
3300010343|Ga0074044_10412523All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7884Open in IMG/M
3300011082|Ga0138526_1031730All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7893Open in IMG/M
3300011087|Ga0138570_1092941All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7989Open in IMG/M
3300014156|Ga0181518_10108795All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71537Open in IMG/M
3300014164|Ga0181532_10343295All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7838Open in IMG/M
3300014200|Ga0181526_10513204All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7759Open in IMG/M
3300014495|Ga0182015_10037528All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA73661Open in IMG/M
3300017946|Ga0187879_10012047All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA75485Open in IMG/M
3300017946|Ga0187879_10309118All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7878Open in IMG/M
3300017946|Ga0187879_10749242Not Available544Open in IMG/M
3300017955|Ga0187817_10027268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA73441Open in IMG/M
3300017975|Ga0187782_11583466All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7517Open in IMG/M
3300017996|Ga0187891_1171491All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7757Open in IMG/M
3300017998|Ga0187870_1165938All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7797Open in IMG/M
3300018013|Ga0187873_1024976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72954Open in IMG/M
3300018014|Ga0187860_1212098All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7788Open in IMG/M
3300018023|Ga0187889_10348696All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7647Open in IMG/M
3300018025|Ga0187885_10236198All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7838Open in IMG/M
3300018034|Ga0187863_10839600All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7521Open in IMG/M
3300018043|Ga0187887_10385920All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7827Open in IMG/M
3300018057|Ga0187858_10011180All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium7458Open in IMG/M
3300018090|Ga0187770_10755261All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7777Open in IMG/M
3300019258|Ga0181504_1006520All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71300Open in IMG/M
3300019260|Ga0181506_1006672All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71014Open in IMG/M
3300019786|Ga0182025_1209359All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7526Open in IMG/M
3300019786|Ga0182025_1227408All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72308Open in IMG/M
3300019786|Ga0182025_1345231All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71808Open in IMG/M
3300021403|Ga0210397_10979455All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7656Open in IMG/M
3300021406|Ga0210386_11177565All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7649Open in IMG/M
3300022522|Ga0242659_1021812All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7990Open in IMG/M
3300022528|Ga0242669_1114350All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7536Open in IMG/M
3300022709|Ga0222756_1082086All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7528Open in IMG/M
3300022721|Ga0242666_1020432All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71238Open in IMG/M
3300023250|Ga0224544_1050204All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7599Open in IMG/M
3300024271|Ga0224564_1108459All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7566Open in IMG/M
3300025414|Ga0208935_1042152All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7607Open in IMG/M
3300025434|Ga0208690_1000262All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis14718Open in IMG/M
3300025454|Ga0208039_1011617All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72117Open in IMG/M
3300025473|Ga0208190_1057434All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7805Open in IMG/M
3300025473|Ga0208190_1115328All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7520Open in IMG/M
3300025480|Ga0208688_1029123All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71334Open in IMG/M
3300027648|Ga0209420_1134030All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7686Open in IMG/M
3300027676|Ga0209333_1189986Not Available544Open in IMG/M
3300027803|Ga0209910_10004068All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7885Open in IMG/M
3300027812|Ga0209656_10410748All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7605Open in IMG/M
3300027824|Ga0209040_10251727All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7885Open in IMG/M
3300027855|Ga0209693_10021530All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA73109Open in IMG/M
3300027879|Ga0209169_10456727All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7671Open in IMG/M
3300027884|Ga0209275_10015128All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA73372Open in IMG/M
3300028560|Ga0302144_10063392All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71183Open in IMG/M
3300028766|Ga0302269_1066615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71091Open in IMG/M
3300028775|Ga0302231_10186451All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7866Open in IMG/M
3300028776|Ga0302303_10007002All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA75694Open in IMG/M
3300028779|Ga0302266_10368932All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7516Open in IMG/M
3300028798|Ga0302222_10074304All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71364Open in IMG/M
3300028798|Ga0302222_10364256All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7564Open in IMG/M
3300028798|Ga0302222_10446919Not Available506Open in IMG/M
3300028806|Ga0302221_10286576All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7718Open in IMG/M
3300029701|Ga0222748_1066194All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7649Open in IMG/M
3300029907|Ga0311329_10161712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71760Open in IMG/M
3300029943|Ga0311340_11517410All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7524Open in IMG/M
3300029944|Ga0311352_10137248All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72126Open in IMG/M
3300029944|Ga0311352_11491761Not Available506Open in IMG/M
3300029951|Ga0311371_10205449All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72913Open in IMG/M
3300030013|Ga0302178_10165586All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71085Open in IMG/M
3300030042|Ga0302300_1039358All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71591Open in IMG/M
3300030043|Ga0302306_10020389All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72758Open in IMG/M
3300030049|Ga0302191_10265872All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7634Open in IMG/M
3300030053|Ga0302177_10445291All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7674Open in IMG/M
3300030054|Ga0302182_10403242All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7572Open in IMG/M
3300030058|Ga0302179_10009453All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA75094Open in IMG/M
3300030399|Ga0311353_11011473All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7695Open in IMG/M
3300030503|Ga0311370_10058554All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA75622Open in IMG/M
3300030503|Ga0311370_10601933All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71317Open in IMG/M
3300030509|Ga0302183_10365340Not Available554Open in IMG/M
3300030524|Ga0311357_10585845All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71028Open in IMG/M
3300030528|Ga0210277_10181381Not Available548Open in IMG/M
3300030578|Ga0210275_10184020All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7658Open in IMG/M
3300030580|Ga0311355_11649650All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7549Open in IMG/M
3300030596|Ga0210278_1007087All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71292Open in IMG/M
3300030740|Ga0265460_11979753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7605Open in IMG/M
3300030743|Ga0265461_11574067All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7717Open in IMG/M
3300030743|Ga0265461_12312130All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7627Open in IMG/M
3300030746|Ga0302312_10259755All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7658Open in IMG/M
3300030760|Ga0265762_1146015All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7560Open in IMG/M
3300030940|Ga0265740_1022841All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7655Open in IMG/M
3300031028|Ga0302180_10128287All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71426Open in IMG/M
3300031090|Ga0265760_10008602All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72915Open in IMG/M
3300031708|Ga0310686_102218535All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7754Open in IMG/M
3300031823|Ga0307478_10368993All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71185Open in IMG/M
3300031870|Ga0316029_103317All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7797Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa21.05%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland14.91%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland13.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.26%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.39%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.39%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog4.39%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost3.51%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.51%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.51%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.63%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.75%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.88%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.88%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.88%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.88%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001151Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004121Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004473Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300006861Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009614Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300011070Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 52 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011082Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011087Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019258Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019260Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022528Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022709Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022721Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023250Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025434Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025454Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025480Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027803Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3SEnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028766Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028779Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030042Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030049Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030528Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030578Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030596Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1EnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030940Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031870Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI1 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12713J13577_101100523300001151Forest SoilMSICRIAALLAGLLLVAMLANAASLKNTIRITVLDSETRALSLNDNGVPTNCEQITFDAYCRSTSTAPLMNTVWVQVGNEAPFRI
Ga0062385_1107026823300004080Bog Forest SoilMSMRRTAALLAGLLLAGLLASATEQKGTIRLTVLDSVTRASTSDNNNGVPQNCEQLTFD
Ga0062384_10063225213300004082Bog Forest SoilMSIGRLAAVQMGLLLAAMFANAASQKDAVRITVLDSVTRASTADNNNGVPLNC
Ga0062389_10302739313300004092Bog Forest SoilMSMGRIAVLQTGLLLVAVVASAASEKDTVRITVLDSVTRASAPENNGVPQNCEQLTFDAYCRSTS
Ga0058882_174111813300004121Forest SoilMSIRRLAAVQTCLLLATMFANAASEKNIRITVLDSVTRVSTADNNNGVPQNCEQLTFD
Ga0068919_142579513300004473Peatlands SoilMSMRRFAIVEAGLLLVAMFANASSRNNTIRITVLNSETRALNLDNNGVPNNCDQLTFDAYCRSTTTAPLVNTLL
Ga0070761_1014104313300005591SoilMSIRRLAAVQTCLLLATMFANAASEKNIRITVLDSVTRVSTADNNNGVPQNCEQLTFDAYCRSTTNVPLISTLLVQEGNEPPFHISCTIE
Ga0063777_103481313300006861Peatlands SoilMSMRRMVALQAGLLLVAMLASAASQKNTMRIKVLDSETRSSSLSDNGVPNNCDQLTFDAYCRSSRTAPLVNTLLVQEDDKPPFRISCTTES
Ga0116108_104975713300009519PeatlandMRRFAVLEAGLLLVAMFANAASLKNTMRITVLDSVTRASSPDDNNGVPKNCEQLTFDAYCRSTTNVPMVSTLLVQEGDNPP
Ga0116138_101951423300009552PeatlandMRRFAVLEAGLLLVAMFANAASLKNTMRITVLDSVTRASSPDDNNGVPKNCEQLTFDAYCRSTTNVPMVSTLLVQEGDNPPFRI
Ga0116104_108465913300009614PeatlandMSMRTVAVQAGLLLVATLASATSLKDTVRITVLDSVTRSSTPDDNNGVPKNCEQLTFDAYCRSTTNVPLVSTLLVQVGNDPPFRISCTIDSRYSR
Ga0116133_100000513300009623PeatlandMRTVAVQAGLLLVATLASATSLKDTVRITVLDSVTRSSTPDDNNGVPKNCEQLTFDAYCRSTTNVPLV
Ga0116105_109327823300009624PeatlandMAVVLAGLLLMAVFANAASRKSTIEITVLESQTRALASDDNGVPLNCEQLTFDAYCRSTRGPQMMSTLLVQEGD
Ga0116117_110666423300009635PeatlandMSMRTVALQAVLLLLVATLASATSLKNTVRITVLDSVTRSSTPDDNNGVPKNCEQLTFDAYCRS
Ga0116118_124428823300009637PeatlandMHVFGGVGLMSMRRIAALQAGLLLVAMLANAASLKNTMRITVLDSVTRASSLDDNNGVPT
Ga0116113_110887223300009638PeatlandMRRIAALQAALLLVAMLANAAVKNNMRITVLDSVTRALPIDNNGVPLNCDQLTFD
Ga0116106_125767513300009645PeatlandMSMRRIAALQAGLLLAAVLANAASQKDTVRITVLDSVTRSSTPDNNNGVPQNCEQLTFDAYCRST
Ga0116131_115023923300009760PeatlandMSMRTVAVQAGLLLVATLASATSLKDTVRITVLDSVTRSSTPDDNNGVPKNCEQLTFDAYCRSTTNVPLVSTLLVQVGNDPPFRIVC
Ga0116130_130249113300009762PeatlandMRRFAVLEAGLLLVAMFANAASLKNTMRITVLDSVTRASSPDDNNGVPKNCEQLTFDAYCRSTTNVPMVSTLLVQEGDNPPFRISCKIESKFSR
Ga0074044_1041252323300010343Bog Forest SoilMSMRRIAALQAGLLLVAMLANAASLKNTMRITVLNSETRAAKVDDNGVPKNCDGITFDAYCRSTTNVPL
Ga0138567_103963813300011070Peatlands SoilMVALQAGLLLVAMLASAASQKNTMRIKVLDSETRSSSLSDNGVPNNCDQLTFDAYCRSSRTAPLVNTLLVQEDDKPPFRISC
Ga0138526_103173013300011082Peatlands SoilMRRFAIVEAGLLLVAMFANASSRNNTIRITVLNSETRALNLDNNGVPNNCDQLTFDAYCRSTTTAPLVNTLL
Ga0138570_109294113300011087Peatlands SoilMAALLAGLLLVAMFANAASRNNTIRITVLDSQTRALNLDNNGVPNNCDQLTFDAYCRSTTNAPLVNTLLVQEGNEPPIRVTCTMGSRNSR
Ga0181518_1010879523300014156BogMAALQAGLLLVATLSNAASQKNTMRITVLDSETRALPADDNGVPNNCNEATFDAYCRSGRASQMMSTLLVQEGNEPPFRISCKIESRF
Ga0181532_1034329513300014164BogMVALQAGLLLVAMFANAAPQKNTMRITVLGSETRSSSRDDSGVPNNCEQVTFDAYCRSSRTEPLVNILLVQEGDQPPFRISCTVDSKYSRC
Ga0181526_1051320423300014200BogMSRRTLAALQSGFLLVAILVSATSTKTQMQITVLDSITRASTRDDNNGVPKDCDQLTFDAYCRSTTN
Ga0182015_1003752813300014495PalsaMSVRRIAALPAGFLLAVVLANASSLKDTVRITVLDSVTRASTPDNNNGVPQNCEQLTFDAYCRST
Ga0187879_1001204713300017946PeatlandMSMRTVAVQAGLLLVATLASATSLKDTVRITVLDSVTRSSTPDDNNGVPKNCEQLTFDAYCRSTTNVPLV
Ga0187879_1030911813300017946PeatlandMSMRTVALQAVLLLLVATLASATSLKNTVRITVLDSVTRSSTPDDNNGVPKNCEQLTFDAYCRSTTNVPLV
Ga0187879_1074924223300017946PeatlandMSMRRIAALQAGLLLAAVLANAASQKDTVRITVLDSVTRSSTPDNNNGVPQNCE
Ga0187817_1002726813300017955Freshwater SedimentMSMRRIAALQAGLVLVVMFANAASLKNTIRITVLESVTRASTPDNNNNGVPKNCDQVNF
Ga0187782_1158346613300017975Tropical PeatlandMGIRGIAVLQAGLLLVCMLANASVKNTMQIKVLDSVTRAAQVDGNGVPKNCDGITFDAYCRSTTTVPLV
Ga0187891_117149113300017996PeatlandMSMRRFAVLEAGLLLVAMFANAASLKNTMRITVLDSVTRASSPDDNNGVPKNCEQLTFDAYCRSTTNVPMVSTLLVQEGDNPPF
Ga0187870_116593813300017998PeatlandMSMRRIAALQAGLLLVAMLANAASLKNTMRITVLDSVTRASSLDDNNGVPTNCEQLTFDAYCRSTTN
Ga0187873_102497623300018013PeatlandMSMRTVAVQAGLLLVATLASATSLKDTVRITVLDSVTRSSTPDDNNGVPKNCEQLTFDAYCRSTTNVPLVS
Ga0187860_121209813300018014PeatlandMSMRRKAALAGLLLVAMFANAASKNTMRITVLDSETRAVSLDDNGVPLNCETATNFDAYCRSTRAQPMMSFLLVQEGNEPPFRISC
Ga0187889_1034869623300018023PeatlandMNIRKIAALQVGFLLAAMLANASPKSTLRITVLDSATRALAAENNGVPQNCEQLTFDAYC
Ga0187885_1023619823300018025PeatlandMSMRTVALQAVLLLLVATLASATSLKNTVRITVLDSVTRSSTPDDNNGVPKNCEQLTFDAYCRSTTNVPLVSTLLVQVGNDPPFRIVC
Ga0187863_1083960013300018034PeatlandMSMRRIAALQAGLLLAAVLANAASQKDTVRITVLDSVTRSSTPDNNNGVPQNCEQLTFDAYCRSTRSVPLVSTLLV
Ga0187862_1067367523300018040PeatlandMSMRRMAVVLAGLLLMAVFANAASRKSTIEITVLESQTRALASDDNGVPLNCEQLTFDAYCRSTRGPQMMSTLLVQEGD
Ga0187887_1038592023300018043PeatlandMNIRKIAALQVGFLLAAMLANASPKSTLRITVLDSATRALAAENNGVPQNCEQLTFDAYCRSTTNVPLQSTLLVQEDGGPT
Ga0187858_1001118013300018057PeatlandMSMRTVALQAVLLLLVATLASATSLKNTVRITVLDSVTRSSTPDDNNGVPKNCEQLTFDAYCRSTTNVPL
Ga0187770_1075526123300018090Tropical PeatlandMSMRRIAALQAGFLLVAILANAASLKNTIRITVLESVTRASTDNNSVPKNCDQLTFDAYCRSTTNAPLVTTLLVQEGN
Ga0181504_100652013300019258PeatlandMSMRRIAALQAALLLVAMLANAAVKNNMRITVLDSVTRALPIDNNGVPLNCDQLTFDAYCRSTTNAPLMSTLLVQEGNEPPFRISC
Ga0181506_100667223300019260PeatlandMRRIFALLAGLLLAVVSANAASENTVRITVLDSSTRASTADNNNGVPQNCEQLTFDAYCRST
Ga0182025_120935913300019786PermafrostMSMRKIAALLASLLLVAVLANAASQKDTIRIKVLDSVTRALAPDNNGVPQNCEQLTFDAYCRSIDAY
Ga0182025_122740813300019786PermafrostMSMRKIAALLASLLLVAVLANAASQKDTIRIKVLDSVTRALAPDNNGVPQNCEQ
Ga0182025_130733933300019786PermafrostMSMRKIAALLASLLLVAVLANAASQKDTIRIKVLDSVTRALAPDNNGVP
Ga0182025_134523143300019786PermafrostMSMRKIAALLASLLLVAVLANAASQKDTIRIKVLDSVTRALAPDNNGVPQNCEQLTFDAYCRSTTNVPLLSTLLVQEDNQPRSVSVAPSNQNIPGAFRWLRRKL
Ga0210397_1097945513300021403SoilLISMRRISSLQICLLLAATFANAGSQKDAVRITVLDSVTRASAPDNNGVPLNCEQLTYDAYCRSTSNAPMVSTLLVQEDSQPPFR
Ga0210386_1117756513300021406SoilMSIRRLAAVQAGVLLAAMFANAASQKDTVRITVLDSVTRASTADNNNGVPQN
Ga0242659_102181213300022522SoilMSIRRLAAVQTGVLLAAMFANAASQKDTVRITVLDSVTRASTADNNNGVPQNCEQLTFD
Ga0242669_111435023300022528SoilLISMRRISSLQICLLLAATFANAGSQKDAVRITVLDSVTRASAPDNNGVPLNCEQLTYDAYC
Ga0222756_108208613300022709SoilMSIRRVAAVQTCLLLATLFANAASEKNIRITVLDSVTRASTADNNNGVPQNCEQLTYDAYCRSTTNVPMISTLLVQEGNEPPFRISCTIESR
Ga0242666_102043213300022721SoilMSIRRLAAVQAGVLLAAMFANAASQKDTVRITVLDSVTRASTADNNNGVPQNCEQLTFDAYCRSTTNVPMISTLLVQEGNDPPFRISCTIES
Ga0224544_105020413300023250SoilMSMRRSVLQAGLLLVAMLANAASLKNNLRITVLDSVTRASSANNNNGVPLNCDQLTFDAYCRSTTNVPLVSSLLVQAGNEPPFWIS
Ga0224564_110845923300024271SoilMSVRRIAAVLAGFLFAAVLANASPQKNTVRITVLDSVTRASTPDNNNNGVPQNCEQLTFDAYCRSSTNVPLV
Ga0208935_104215213300025414PeatlandMNIRKIAALQVGFLLAAMLANASPKSTLRITVLDSATRALAADNNGVPQNCEQLTFDAYCRSTTNVPLQSTLLV
Ga0208690_100026213300025434PeatlandMSMRRIAALQAALLLVAMLANAAVKNNMRITVLDSVTRALPIDNNGVPLNCDQLTFDAYCRSTTNAPLMSTLLVQ
Ga0208039_101161723300025454PeatlandMSMRRFAVLEAGLLLVAMFANAASLKNTMRITVLDSVTRASSPDDNNGVPKNCEQLTFDAYCRSTTNVPMVSTLLVQEGDNPPFRISCKI
Ga0208190_105743423300025473PeatlandMSMRTVAVQAGLLLVATLASATSLKDTVRITVLDSVTRSSTPDDNNGVPKNCEQLTFDAYCRSTTNVP
Ga0208190_111532813300025473PeatlandMSMRTMAVLLAGLVLAAVLANAASRKSTVQITVVDSETRAVSADDNGVPKNCDQLTFDAYCRSTTAAKMVHT
Ga0208688_102912323300025480PeatlandMSMRRFAVLEAGLLLVAMFANAASLKNTMRITVLDSVTRASSPDDNNGVPKNCEQLTFDAYCRSTTNVPMVSTLLVQEGDNPP
Ga0209420_113403013300027648Forest SoilMSVRRIAALQAGFLLAVVLANASSLKDTVRITVLDSVTRASTADNNNGVPLNCEQLTFDAYCRSTTNVPMIS
Ga0209333_118998623300027676Forest SoilMSMRRIAALQAGLLLAATFASAASRDNTIRITVLDSETQAGKIENNGVPTNCDDQITFDAYCRS
Ga0209910_1000406813300027803Thawing PermafrostMRMRGVAALRVGLLLVAVAVHAASSKDTVRITVLESVTQALAPDNNG
Ga0209656_1041074823300027812Bog Forest SoilMSIHRLATVQAGLLLVAAFANAASQKDAVRITVLDSVTRASTLDNNNGVPLNCEQLTYDAYCRSTSNAPIVSTLLVQEDNQPP
Ga0209040_1025172713300027824Bog Forest SoilMSIHRLATVQAGLLLVAAFANAASQKDAVRITVLDSVTRASTLDNNNGVPLNCEQLTYDAYCRSTSNAPMVSTLLVQEDNQPPFRISCTIESRYSRC
Ga0209693_1002153033300027855SoilMSIRRLAAVQTGVLLAAMFANAASQKDTVRITVLDSVTRASTADNNNGVPQNCEQLTFDAYC
Ga0209169_1045672723300027879SoilMSMPRIAPLLAGLLLAAVLANAGSQKDTVRITVLDSVTQALTSDNNGVPQNCEQLTFDAYCRSTTNVPLLSTLLV
Ga0209275_1001512813300027884SoilMRRISSLQICLLLAATFADAGSQKDAVRITVLDSVTRASAPDNNGVPLNC
Ga0302144_1006339213300028560BogMRMRGVAALRVGLLLVAVAVHAASSKDTVRITVLESVTQALAPDNNGVPQ
Ga0302269_106661523300028766BogMNIRKIAALQVGFLLAAMLANASPKSTLRITVLDSATRALAAENNGVPQNCEQLTFDA
Ga0302231_1018645113300028775PalsaMTMRRIAALQAGLLLAVMVANAASSKDTVRITVLDSVTRSSAPDNNGVPQNCEQLTFDAYCRSTTNVPLVSTLLV
Ga0302303_1000700253300028776PalsaMTMRRIAALQAGLLLAVMVANAASSKDTVRITVLDSVTRSSAPDNNGVPQNCEQLTFDAYCRSTTNVPLVSTLLVQEDNEPPFRIS
Ga0302266_1036893213300028779BogMRMRGVAALRVGLLLVAVAVHAASSKDTVRITVLESVTQALAPDNNGVPQNCDQLTFDAYCRSTTNVPLLSTLLVQENNEPPFR
Ga0302222_1007430423300028798PalsaVSMCRVAAVQAFLLLVAMCGNAAVTNNIRITVLDSETRASTPDNNGVPQNCDQLTFDAYCRSTTTVPLVSTLLVQEGNEPPFRIRCTI
Ga0302222_1036425613300028798PalsaMSVRRIAALPAGFLLAVVLANASSLKDTVRITVLDSVTRASTPDNNNGVPQNCEQLTFDAYCRSTTN
Ga0302222_1044691913300028798PalsaMSMPRIAPLLASLLLAAVLANAASQKDTVRITVLDSVTQALTPDNNGVPQNCEQLTFDA
Ga0302221_1028657623300028806PalsaMCMRRSALQAGLLLVAMLANAASLRNSLRITVLDSVTRAASVNNNNGVPINCDQLTFDAYCRSTTNAPLVSNLLVQEGDEPPFWIS
Ga0222748_106619423300029701SoilMSIRRVAAVQTCLLLATLFANAASEKNIRITVLDSVTRASTADNNNGVPQNC
Ga0311329_1016171223300029907BogMNIRKIAALQVGFLLAAMLANASPKSTLRITVLDSATRALAAENNGVPQNCEQLTFDAYCRSTTNVPLQSTLLVQ
Ga0311340_1151741013300029943PalsaMSMPRIAPLLAGFLLAAVLANAAPQKDTLRITVLDSVTRALTPDNNGVPQNCEQLTFDAYCRS
Ga0311352_1013724823300029944PalsaMSMRRIAALQASLLLAAMLANAAAEKNTLRVTVLDSVTRATADNNNGVPQNCE
Ga0311352_1149176113300029944PalsaMSMPRIAPLLAGFLLAAVLANAAPQKDTLRITVLDSVTRALTPDNNGVPQNCEQLTFDA
Ga0311371_1020544923300029951PalsaMSVRRIAALPAGFLLAVVLANASSLKDTVRITVLDSVTRASTPDNNNGVPQNCEQLTFDAYCRSTTNVPLVSTLLVQEDNQPPFRITCTIESRY
Ga0302178_1016558613300030013PalsaMNICKIAALQVGFLLTAMLANASPKSTLRITVLDSATRALAADNNGVPQNCEQLTFDAYCRSTTNVPLVSTLLVQEDNEP
Ga0302300_103935823300030042PalsaMTMRRIAALQAGLLLAVMVANAASSKDTVRITVLDSVTRSSAPDNNGVPQNCEQLTFDAY
Ga0302306_1002038913300030043PalsaMNICKIAALQVGFLLTAMLANASPKSTLRITVLDSATRALAADNNGVPQ
Ga0302191_1026587213300030049BogMRMRGVAALRVGLLLVAVAVHAASSKDTVRITVLESVTQALAPDNNGVPQNCDQLTFDAYCRST
Ga0302177_1044529123300030053PalsaMCMRRSALQAGLLLVAMLANAASLRNSLRITVLDSVTRAASVNNNNGVPINCDQLTFDAYCRSTTNAPLVSNLLVQEGDEPPFWISCTIESR
Ga0302182_1040324213300030054PalsaMSMRRIAALQASLLLAAMLANAAAEKNTLRVTVLDSVTRATADNNNGVPQNCEQLTFDAYCRSTTNVPLVSTLLVREDDGPPFRISCTIES
Ga0302179_1000945313300030058PalsaMSVRRIAALPAGFLLAVVLANASSLKDTVRITVLDSVTRASTPDNNNGVPQNCEQLTFDAYCRSTTNVPLVSTLLVQEDNQPPFRITCTIESR
Ga0311353_1101147313300030399PalsaMSVRRIAALPAGFLLAVVLANASSLKDTVRITVLDSVTRASTPDNNNGVPQNCEQLTFDAYCRSTTNVPLVSTLLVQEDNQPPFRITCTIESRYSRCI
Ga0311370_1005855413300030503PalsaMSVRRIAALPAGFLLAVVLANASSLKDTVRITVLDSVTRASTPDNNNGVPQNCEQLTFDAYCRSTTNVPLVSTLLVQEDNQPPFRITCTIESRYSR
Ga0311370_1060193313300030503PalsaMSMPRIAPLLAGFLLAAVLANAAPQKDTLRITVLDSVTRALTPDNNGVPQNCEQLTFDAYCRSTTNVPLLSTLL
Ga0302183_1036534013300030509PalsaMSVRRIAALPAGFLLAVVLANASSLKDTVRITVLDSVTRASTPDNNNGVPQNCE
Ga0311357_1058584523300030524PalsaMSMRRIAALQASLLLAAMLANAAAEKNTLRVTVLDSVTRATADNNNGVPQNCEQLTFDAYCRSTTNVP
Ga0210277_1018138113300030528SoilMSIGRLAAVQMGLLLAAMFANAASQKDAVRITVLDSVTRASAPDNNGVPQNCEQLTFVAYCR
Ga0210275_1018402013300030578SoilLTSVRRIAALQVGLLLAAVLANAASSKDTVRITVLDSVTRASAPDNNNGVPQNCEQLTFDAYCRSTTNVPLVSTLLVQEDNQPP
Ga0311355_1164965013300030580PalsaMHPQYAVYGGVGLMSMPRIAPLLAGLLLAAVWANAASQKDAVRITVLDSVTQALTPDNNGVPQNCEQLTFDAYCRSTTNVPL
Ga0210278_100708713300030596SoilMSMCRMAAVQAFFLLVAIYANASVTNNIRITVLDSETRASTPDNNGVPQNCEQLTYDAYCRSTTNVPLVSTLLVREGNTPPFRIRCTITSK
Ga0265460_1004098213300030740SoilMGIRRIAALQTGLLLAAVLANAGSQKDTVRITVLDAVTRASAPDNNGVPQNCEQLTFDAYCRSTSNVQVSTLLVQEDNEPPSESVAPLKNIPDAFPCL
Ga0265460_1197975323300030740SoilMSIRRIAALQTGLLLAAVLANAGSQKDTVRITVLDSVTRASAPDNNGVPQNCEQLTFDAYCR
Ga0265461_1157406723300030743SoilMSVRRIAALQVGLLLAAVLANAASSKDTVRITVLDSVTRASAPDNNNGVPQNCEQLTFDAYCRSTTNVPLVSTLLVQEDNQPP
Ga0265461_1231213013300030743SoilMSMRRIAALQAGLLLVAVLANAAWAKDTLRITVLDSVTRASTPDNNNGVPQNCE
Ga0302312_1025975523300030746PalsaMNICKIAALQVGFLLTAMLANASPKSTLRITVLDSATRALAADNNGVPQNCEQLTFDA
Ga0265762_114601513300030760SoilMSIRRMAALQAGLLLLAMLANAASLKKSIQVTVLDSETRAVNLNDNGVPTNCEQLTFDAYCRSTSTAPLVNTLLVQIGNEAPFRV
Ga0265740_102284113300030940SoilMRRISSLQICLLLAATFANAGSQKDAVRITVLDSVTRASAPDNNGVPLNCEQLTYDAYC
Ga0302180_1012828723300031028PalsaMSMPRIAPLLAGFLLAAVLANAAPQKDTLRITVLDSVTRALTPDNNGVPQNCEQLTFDAYCRSTTNVPLLSTLLVQEDNQPPFRISCTVQ
Ga0265760_1000860213300031090SoilMSMRRIAALQASLLLAAVLANAASQKDTVRITVLDSVTRALPPDNNGVPQNCEQLTFDAYCRSTTNVPLVSTLLVQE
Ga0310686_10221853523300031708SoilVGLISMRRIAALLAGLLLAAIVANASPKDTVRITVLDSVTRASSPDNNGVPQNCEQLTFDAYCRSTTNV
Ga0307478_1036899313300031823Hardwood Forest SoilMSMCRIPALRICLLLVATFANAGSQKDAVRITVLDSVTRASAPDNNGVPLNCEQLTYDAYCRSTSNAPMV
Ga0316029_10331723300031870SoilMSVRRSAAWQAGLLFAAILANADSPKNTLRITVLDSVTRASTPDNSNNGVPLNCE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.