Metagenome / Metatranscriptome Family F080972

Basic Information
Family ID	F080972
Family Type	Metagenome / Metatranscriptome
Number of Sequences	114
Average Sequence Length	40 residues
Representative Sequence	MLPIFFATYGAVFVAEIVGDKLLYTTGVLATRYRTVP
Number of Associated Samples	105
Number of Associated Scaffolds	114

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	61.40 %
% of genes near scaffold ends (potentially truncated)	98.25 %
% of genes from short scaffolds (< 2000 bps)	92.98 %
Associated GOLD sequencing projects	101
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.56

Most Common Taxonomy
Group	Bacteria (90.351 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (7.895 % of family members)
Environment Ontology (ENVO)	Unclassified (33.333 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (31.579 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 47.69% β-sheet: 0.00% Coil/Unstructured: 52.31%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 114 Family Scaffolds
PF00578	AhpC-TSA	12.28
PF13620	CarboxypepD_reg	6.14
PF00988	CPSase_sm_chain	4.39
PF00005	ABC_tran	2.63
PF03544	TonB_C	1.75
PF01008	IF-2B	1.75
PF07969	Amidohydro_3	1.75
PF13419	HAD_2	1.75
PF13577	SnoaL_4	0.88
PF00483	NTP_transferase	0.88
PF07662	Nucleos_tra2_C	0.88
PF00227	Proteasome	0.88
PF13683	rve_3	0.88
PF13709	DUF4159	0.88
PF01032	FecCD	0.88
PF00248	Aldo_ket_red	0.88
PF13398	Peptidase_M50B	0.88
PF12724	Flavodoxin_5	0.88
PF02872	5_nucleotid_C	0.88
PF00115	COX1	0.88
PF01609	DDE_Tnp_1	0.88
PF00588	SpoU_methylase	0.88
PF13545	HTH_Crp_2	0.88
PF01641	SelR	0.88
PF13432	TPR_16	0.88
PF00072	Response_reg	0.88

COG ID	Name	Functional Category	% Frequency in 114 Family Scaffolds
COG0505	Carbamoylphosphate synthase small subunit	Amino acid transport and metabolism [E]	8.77
COG0182	5-methylthioribose/5-deoxyribulose 1-phosphate isomerase (methionine salvage pathway), a paralog of eIF-2B alpha subunit	Amino acid transport and metabolism [E]	1.75
COG0810	Periplasmic protein TonB, links inner and outer membranes	Cell wall/membrane/envelope biogenesis [M]	1.75
COG1184	Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family	Translation, ribosomal structure and biogenesis [J]	1.75
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.88
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.88
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.88
COG5405	ATP-dependent protease HslVU (ClpYQ), peptidase subunit	Posttranslational modification, protein turnover, chaperones [O]	0.88
COG3484	Predicted proteasome-type protease	Posttranslational modification, protein turnover, chaperones [O]	0.88
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.88
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.88
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.88
COG1972	Nucleoside permease NupC	Nucleotide transport and metabolism [F]	0.88
COG0737	2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase family	Defense mechanisms [V]	0.88
COG0638	20S proteasome, alpha and beta subunits	Posttranslational modification, protein turnover, chaperones [O]	0.88
COG0566	tRNA G18 (ribose-2'-O)-methylase SpoU	Translation, ribosomal structure and biogenesis [J]	0.88
COG0565	tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase	Translation, ribosomal structure and biogenesis [J]	0.88
COG0229	Peptide methionine sulfoxide reductase MsrB	Posttranslational modification, protein turnover, chaperones [O]	0.88
COG0219	tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain	Translation, ribosomal structure and biogenesis [J]	0.88

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	90.35 %
Unclassified	root	N/A	9.65 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	90.35 %
Unclassified	root	N/A	9.65 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	90.35 %
Unclassified	root	N/A	9.65 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	58.77 %
Unclassified	root	N/A	9.65 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	4.39 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.63 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.88 %

Name	Rank	Taxonomy	Distribution
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	29.82 %
Unclassified	root	N/A	9.65 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	4.39 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2.63 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	1.75 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.75 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.75 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.88 %
Deinococcus-Thermus	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus	0.88 %

Name	Rank	Taxonomy	Distribution
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	21.93 %
Unclassified	root	N/A	9.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	4.39 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	1.75 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.75 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.75 %
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	1.75 %
Deinococci	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci	0.88 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.88 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	0.88 %

Name	Rank	Taxonomy	Distribution
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	21.05 %
Unclassified	root	N/A	9.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	4.39 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1.75 %
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	1.75 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.75 %
Bryobacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae	0.88 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	0.88 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.88 %
Deinococci	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci	0.88 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.88 %

Name	Rank	Taxonomy	Distribution
Candidatus Sulfopaludibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter	19.30 %
Unclassified	root	N/A	9.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	4.39 %
Candidatus Solibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	1.75 %
Gemmatimonadaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	1.75 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1.75 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.75 %
Bryobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter	0.88 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.88 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.88 %
Deinococci	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci	0.88 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.88 %

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Sulfopaludibacter	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter	19.30 %
Unclassified	root	N/A	9.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	4.39 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1.75 %
Gemmatimonas	genus	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas	1.75 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1.75 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.75 %
Bryobacter aggregatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	0.88 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.88 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.88 %
Deinococci	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci	0.88 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.88 %

Name	Rank	Taxonomy	Distribution
Candidatus Sulfopaludibacter sp. SbA3	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	14.04 %
Unclassified	root	N/A	9.65 %
Candidatus Sulfopaludibacter sp. SbA4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4	5.26 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	4.39 %
Gemmatimonas groenlandica	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas groenlandica	1.75 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1.75 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1.75 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.75 %
Bryobacter aggregatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	0.88 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.88 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.88 %
Deinococci	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci	0.88 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000789\|JGI1027J11758_11589682	All Organisms → cellular organisms → Bacteria	545	Open in IMG/M
3300000955\|JGI1027J12803_104274697	All Organisms → cellular organisms → Bacteria → Acidobacteria	561	Open in IMG/M
3300004778\|Ga0062383_10423353	All Organisms → cellular organisms → Bacteria → Acidobacteria	658	Open in IMG/M
3300005332\|Ga0066388_105703932	All Organisms → cellular organisms → Bacteria → Acidobacteria	630	Open in IMG/M
3300005338\|Ga0068868_102249243	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	520	Open in IMG/M
3300005364\|Ga0070673_102075777	All Organisms → cellular organisms → Bacteria	540	Open in IMG/M
3300005561\|Ga0066699_11031235	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	569	Open in IMG/M
3300005591\|Ga0070761_10193243	All Organisms → cellular organisms → Bacteria	1204	Open in IMG/M
3300005616\|Ga0068852_101334582	Not Available	739	Open in IMG/M
3300005764\|Ga0066903_106101346	All Organisms → cellular organisms → Bacteria	631	Open in IMG/M
3300005836\|Ga0074470_11211387	All Organisms → cellular organisms → Bacteria	10230	Open in IMG/M
3300005842\|Ga0068858_100789843	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	926	Open in IMG/M
3300005843\|Ga0068860_102061042	All Organisms → cellular organisms → Bacteria	592	Open in IMG/M
3300005844\|Ga0068862_100962234	Not Available	842	Open in IMG/M
3300006881\|Ga0068865_101662024	All Organisms → cellular organisms → Bacteria → Acidobacteria	575	Open in IMG/M
3300006904\|Ga0075424_101797841	All Organisms → cellular organisms → Bacteria	648	Open in IMG/M
3300009012\|Ga0066710_101546692	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1020	Open in IMG/M
3300009090\|Ga0099827_10055672	All Organisms → cellular organisms → Bacteria → Acidobacteria	2994	Open in IMG/M
3300009094\|Ga0111539_12757256	All Organisms → cellular organisms → Bacteria → Acidobacteria	569	Open in IMG/M
3300009101\|Ga0105247_11540804	All Organisms → cellular organisms → Bacteria → Acidobacteria	543	Open in IMG/M
3300009143\|Ga0099792_10911963	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300009143\|Ga0099792_11024127	All Organisms → cellular organisms → Bacteria	553	Open in IMG/M
3300009156\|Ga0111538_14049248	All Organisms → cellular organisms → Bacteria → Acidobacteria	506	Open in IMG/M
3300009520\|Ga0116214_1136718	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	909	Open in IMG/M
3300009665\|Ga0116135_1455997	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	525	Open in IMG/M
3300009700\|Ga0116217_10364831	All Organisms → cellular organisms → Bacteria → Acidobacteria	920	Open in IMG/M
3300010046\|Ga0126384_11218525	All Organisms → cellular organisms → Bacteria → Acidobacteria	695	Open in IMG/M
3300010048\|Ga0126373_11118139	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	854	Open in IMG/M
3300010366\|Ga0126379_11267466	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	843	Open in IMG/M
3300010366\|Ga0126379_11397956	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	806	Open in IMG/M
3300010375\|Ga0105239_11479176	All Organisms → cellular organisms → Bacteria	785	Open in IMG/M
3300010376\|Ga0126381_101556780	All Organisms → cellular organisms → Bacteria → Acidobacteria	955	Open in IMG/M
3300010863\|Ga0124850_1128634	Not Available	628	Open in IMG/M
3300011438\|Ga0137451_1285399	All Organisms → cellular organisms → Bacteria → Acidobacteria	519	Open in IMG/M
3300012199\|Ga0137383_11252823	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	531	Open in IMG/M
3300012205\|Ga0137362_10030235	All Organisms → cellular organisms → Bacteria	4282	Open in IMG/M
3300012210\|Ga0137378_11216544	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	669	Open in IMG/M
3300012212\|Ga0150985_119110573	All Organisms → cellular organisms → Bacteria → Acidobacteria	637	Open in IMG/M
3300012925\|Ga0137419_10857621	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	746	Open in IMG/M
3300012930\|Ga0137407_10773934	All Organisms → cellular organisms → Bacteria	906	Open in IMG/M
3300013296\|Ga0157374_11494994	Not Available	699	Open in IMG/M
3300013306\|Ga0163162_10057239	All Organisms → cellular organisms → Bacteria → Acidobacteria	3926	Open in IMG/M
3300013306\|Ga0163162_10750439	All Organisms → cellular organisms → Bacteria → Acidobacteria	1095	Open in IMG/M
3300013306\|Ga0163162_12738276	Not Available	568	Open in IMG/M
3300014161\|Ga0181529_10606472	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	571	Open in IMG/M
3300014167\|Ga0181528_10838958	All Organisms → cellular organisms → Bacteria → Acidobacteria	518	Open in IMG/M
3300014326\|Ga0157380_10085522	All Organisms → cellular organisms → Bacteria → Acidobacteria	2588	Open in IMG/M
3300014491\|Ga0182014_10635089	Not Available	511	Open in IMG/M
3300014492\|Ga0182013_10129613	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1631	Open in IMG/M
3300014493\|Ga0182016_10853192	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	504	Open in IMG/M
3300014495\|Ga0182015_10990036	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4	522	Open in IMG/M
3300014501\|Ga0182024_12543754	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	551	Open in IMG/M
3300014968\|Ga0157379_10304565	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	1453	Open in IMG/M
3300015372\|Ga0132256_101323514	All Organisms → cellular organisms → Bacteria	833	Open in IMG/M
3300015372\|Ga0132256_102384320	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300015373\|Ga0132257_100848106	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1143	Open in IMG/M
3300018014\|Ga0187860_1330879	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	583	Open in IMG/M
3300018026\|Ga0187857_10467952	Not Available	566	Open in IMG/M
3300018033\|Ga0187867_10748960	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300018034\|Ga0187863_10407361	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	758	Open in IMG/M
3300018060\|Ga0187765_11335243	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300018064\|Ga0187773_10957398	All Organisms → cellular organisms → Bacteria → Acidobacteria	558	Open in IMG/M
3300018433\|Ga0066667_10572151	All Organisms → cellular organisms → Bacteria	940	Open in IMG/M
3300018482\|Ga0066669_10971237	All Organisms → cellular organisms → Bacteria	765	Open in IMG/M
3300019260\|Ga0181506_1131147	Not Available	921	Open in IMG/M
3300019877\|Ga0193722_1130540	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300021181\|Ga0210388_11197405	All Organisms → cellular organisms → Bacteria → Acidobacteria	645	Open in IMG/M
3300021560\|Ga0126371_13295489	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	546	Open in IMG/M
3300021861\|Ga0213853_11264261	All Organisms → cellular organisms → Bacteria	610	Open in IMG/M
3300022499\|Ga0242641_1051346	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	500	Open in IMG/M
3300022512\|Ga0242676_1002931	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	1229	Open in IMG/M
3300022718\|Ga0242675_1093157	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	570	Open in IMG/M
3300025930\|Ga0207701_10459771	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1092	Open in IMG/M
3300025931\|Ga0207644_11284748	All Organisms → cellular organisms → Bacteria	615	Open in IMG/M
3300025972\|Ga0207668_11267960	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas groenlandica	663	Open in IMG/M
3300027729\|Ga0209248_10257071	All Organisms → cellular organisms → Bacteria → Acidobacteria	508	Open in IMG/M
3300027915\|Ga0209069_10155365	All Organisms → cellular organisms → Bacteria	1141	Open in IMG/M
3300028380\|Ga0268265_11322757	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas groenlandica	721	Open in IMG/M
3300028381\|Ga0268264_12405772	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	533	Open in IMG/M
3300028536\|Ga0137415_11032095	All Organisms → cellular organisms → Bacteria	634	Open in IMG/M
3300028813\|Ga0302157_10594052	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	571	Open in IMG/M
3300029636\|Ga0222749_10621383	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	591	Open in IMG/M
3300029894\|Ga0247028_1109831	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4	512	Open in IMG/M
3300029907\|Ga0311329_11051177	All Organisms → cellular organisms → Bacteria → Acidobacteria	502	Open in IMG/M
3300029922\|Ga0311363_10546125	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1159	Open in IMG/M
3300029953\|Ga0311343_10393681	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1283	Open in IMG/M
3300029994\|Ga0302283_1158887	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4	874	Open in IMG/M
3300030007\|Ga0311338_11915751	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	529	Open in IMG/M
3300030518\|Ga0302275_10026041	All Organisms → cellular organisms → Bacteria	4801	Open in IMG/M
3300030618\|Ga0311354_10586946	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1085	Open in IMG/M
3300030673\|Ga0302287_10224695	All Organisms → cellular organisms → Bacteria	549	Open in IMG/M
3300031234\|Ga0302325_12845037	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4	565	Open in IMG/M
3300031236\|Ga0302324_103198158	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4	539	Open in IMG/M
3300031524\|Ga0302320_11782716	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4	588	Open in IMG/M
3300031525\|Ga0302326_10123673	All Organisms → cellular organisms → Bacteria → Acidobacteria	4541	Open in IMG/M
3300031525\|Ga0302326_11157424	Not Available	1069	Open in IMG/M
3300031525\|Ga0302326_11458982	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	920	Open in IMG/M
3300031525\|Ga0302326_12024844	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	743	Open in IMG/M
3300031708\|Ga0310686_104388455	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	1336	Open in IMG/M
3300031715\|Ga0307476_11099639	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300031716\|Ga0310813_11790917	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	576	Open in IMG/M
3300031726\|Ga0302321_102946777	Not Available	556	Open in IMG/M
3300031788\|Ga0302319_10059820	All Organisms → cellular organisms → Bacteria → Acidobacteria	5971	Open in IMG/M
3300031820\|Ga0307473_11138410	All Organisms → cellular organisms → Bacteria → Acidobacteria	577	Open in IMG/M
3300031823\|Ga0307478_11045242	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci	682	Open in IMG/M
3300031823\|Ga0307478_11250889	All Organisms → cellular organisms → Bacteria → Acidobacteria	618	Open in IMG/M
3300032013\|Ga0310906_11268507	All Organisms → cellular organisms → Bacteria → Acidobacteria	537	Open in IMG/M
3300032783\|Ga0335079_11041962	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	832	Open in IMG/M
3300032805\|Ga0335078_11795383	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	667	Open in IMG/M
3300032828\|Ga0335080_10520092	All Organisms → cellular organisms → Bacteria	1261	Open in IMG/M
3300033004\|Ga0335084_11091862	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	801	Open in IMG/M
3300033134\|Ga0335073_11815087	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	569	Open in IMG/M
3300033888\|Ga0334792_095341	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	831	Open in IMG/M
3300034282\|Ga0370492_0459287	Not Available	517	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	77.19%
Host-Associated	Host-Associated	22.81%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	64.04%
Plants	Host-Associated → Plants	22.81%
Aquatic	Environmental → Aquatic	13.16%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	47.37%
Peat	Environmental → Terrestrial → Peat	16.67%
Rhizoplane	Host-Associated → Plants → Rhizoplane	11.40%
Rhizosphere	Host-Associated → Plants → Rhizosphere	11.40%
Freshwater	Environmental → Aquatic → Freshwater	10.53%
Sediment	Environmental → Aquatic → Sediment	2.63%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	32.46%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	16.67%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	11.40%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	9.65%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	8.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.02%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.39%
Loam	Environmental → Terrestrial → Soil → Loam	3.51%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.63%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.75%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.88%
Ice	Environmental → Aquatic → Freshwater → Ice	0.88%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	17.54%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	16.67%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	9.65%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.89%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	7.02%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	7.02%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.02%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.14%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	4.39%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.39%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.51%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.63%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.75%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.75%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.88%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.88%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.88%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	7.89%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	7.02%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	5.26%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	5.26%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	4.39%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.39%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	4.39%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.39%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.51%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	3.51%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.63%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.63%
Bog	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog	2.63%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.63%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.63%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.63%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.63%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	1.75%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.75%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.75%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.75%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.75%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.75%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	0.88%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.88%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	0.88%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.88%
Cryconite	Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite	0.88%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.88%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.88%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.88%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.88%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.88%
Palsa	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa	0.88%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	0.88%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.88%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	0.88%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.88%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.88%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.88%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.88%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.88%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000789	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300004778	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005591	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009520	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG	Environmental	Open in IMG/M
3300009665	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10	Environmental	Open in IMG/M
3300009700	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010863	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction)	Environmental	Open in IMG/M
3300011438	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014161	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG	Environmental	Open in IMG/M
3300014167	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014491	Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG	Environmental	Open in IMG/M
3300014492	Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG	Environmental	Open in IMG/M
3300014493	Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG	Environmental	Open in IMG/M
3300014495	Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG	Environmental	Open in IMG/M
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300018014	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40	Environmental	Open in IMG/M
3300018026	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100	Environmental	Open in IMG/M
3300018033	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10	Environmental	Open in IMG/M
3300018034	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019260	Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019877	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1	Environmental	Open in IMG/M
3300021181	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300021861	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022499	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022512	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022718	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027729	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)	Environmental	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028813	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3	Environmental	Open in IMG/M
3300029636	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300029894	Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_L-A1b	Environmental	Open in IMG/M
3300029907	I_Bog_N1 coassembly	Environmental	Open in IMG/M
3300029922	III_Fen_E1 coassembly	Environmental	Open in IMG/M
3300029953	II_Bog_E3 coassembly	Environmental	Open in IMG/M
3300029994	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4	Environmental	Open in IMG/M
3300030007	I_Palsa_E1 coassembly	Environmental	Open in IMG/M
3300030518	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2	Environmental	Open in IMG/M
3300030618	II_Palsa_E3 coassembly	Environmental	Open in IMG/M
3300030673	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_4	Environmental	Open in IMG/M
3300031234	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2	Environmental	Open in IMG/M
3300031236	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1	Environmental	Open in IMG/M
3300031524	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3	Environmental	Open in IMG/M
3300031525	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031715	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental	Open in IMG/M
3300031788	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031823	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032783	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3	Environmental	Open in IMG/M
3300032805	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033134	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2	Environmental	Open in IMG/M
3300033888	Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1	Environmental	Open in IMG/M
3300034282	Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.56
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.56
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F080972

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI1027J11758_115896822	3300000789	Soil	VLVVFFATFGAVFLAEIVGDKLLYTTGVLAARYRTAPIMIGMAAA
JGI1027J12803_1042746971	3300000955	Soil	VLIFFTTFGTVFVAEIVGDKLLYTTGVLAARYRTLPIT
Ga0062383_104233531	3300004778	Wetland Sediment	VIQLVLATYGAVFVAEIVGDKLLYTTGVLAARYRSAAVVLG
Ga0066388_1057039322	3300005332	Tropical Forest Soil	MLAIFFATYAAVFIAEIVGDKLLYTTGVLATRYRWGAVVIG
Ga0068868_1022492431	3300005338	Miscanthus Rhizosphere	MSYLLMVLGTAYLAVFIAEIVGDKLLYTSGVLATRYRWSAV
Ga0070673_1020757771	3300005364	Switchgrass Rhizosphere	MLAVFFATYAAVFIAEIAGDKLLYTTGILATRYRSAPIVIGMAAAFMVKMGA
Ga0066699_110312351	3300005561	Soil	VLAIFLATYGAVFVAEIVGDKLLYTTGVLATRYRWASIVC
Ga0070761_101932432	3300005591	Soil	MIAIFLATYEAVFVAEIVGDKLLYTTGVLATRYRTMPIM
Ga0068852_1013345822	3300005616	Corn Rhizosphere	MISVFIATYAAVFIAEIVGDKLLYTTGILATRYRSLPVM
Ga0066903_1061013462	3300005764	Tropical Forest Soil	MLPVFFATYGAVFAAEIVGDKLLYTTGVLATRYRTLP
Ga0074470_112113878	3300005836	Sediment (Intertidal)	MLALFFATYGAVFVAEIVGDKLLYTTGVLATRYRCCRCSKR*
Ga0068858_1007898431	3300005842	Switchgrass Rhizosphere	MFEIFLATYGGVFIAEIVGDKLLYTSGVLATRYSW
Ga0068860_1020610421	3300005843	Switchgrass Rhizosphere	MLSIFLATYGAVFIAEIVGDKLLYTTGVLATRYRSASIMLGMAL
Ga0068862_1009622341	3300005844	Switchgrass Rhizosphere	MITALVATYVAVFIAEIVGDKLLYTTGVLAVRYRP
Ga0068865_1016620241	3300006881	Miscanthus Rhizosphere	MLPIFFATYGAVFIAEIVGDKLLYTTGVLATRYRTIPILMGM
Ga0075424_1017978411	3300006904	Populus Rhizosphere	MLVIFFATFGAVFIAEIVGDKLLYTTGVLAARYRTAP
Ga0066710_1015466922	3300009012	Grasslands Soil	VFVVFFATFGAVFLAEIVGDKLLYTTGVLAARYRTTPIMIG
Ga0099827_100556722	3300009090	Vadose Zone Soil	VILIFFTAFGTVFVAEIVGDKLLYTTGVLAARYRTLPI
Ga0111539_127572561	3300009094	Populus Rhizosphere	MLEVVLATYVAVFVAEIVGDKLLYTSGVLATRFRWGAV
Ga0105247_115408043	3300009101	Switchgrass Rhizosphere	MLTIFAATYAAVFVAEIVGDKLLYTTGVLAANYRSLSIVVGMAFAFMC
Ga0099792_109119631	3300009143	Vadose Zone Soil	MIQAFWTTYASVLAAEVLGDKLLYTTGFLATRYRTTPMM
Ga0099792_110241272	3300009143	Vadose Zone Soil	MSMLAIFAATYAAVFIAEIVGDKLLYTTGVLATRYRSLPIILGM
Ga0111538_140492481	3300009156	Populus Rhizosphere	MFEIFLTTYGGVFVAEIVGDKLLYTSGVLATRYSWSSVL
Ga0116214_11367181	3300009520	Peatlands Soil	MLPIFFATYGTVFVAEIVGDKLLYTTGVLATRYRTLP
Ga0116135_14559971	3300009665	Peatland	MLPILFATYVAVFVAEIVGDKLLYTTGVLATRYRTPPIL
Ga0116217_103648311	3300009700	Peatlands Soil	MLPIFFATYGTVFVAEIVGDKLLYTTGVLATRYRTLPIMCG
Ga0126384_112185252	3300010046	Tropical Forest Soil	MLPILFATYGSVFMAEIVGDKLLYTTGVLATRFRTVPILCGMAMAFMGK
Ga0126373_111181393	3300010048	Tropical Forest Soil	MLPVLFATYGAVFVAEIVGDKLLYTTGVLANRYRAVPIMFGM
Ga0126379_112674661	3300010366	Tropical Forest Soil	VTLIFFTAFGAVFIAEIVGDKLLYTTSVLAARYRTLPIMF
Ga0126379_113979561	3300010366	Tropical Forest Soil	MLAIFLATYGAVFVAEIVGDKLLYTTGVLATRYRTV
Ga0105239_114791762	3300010375	Corn Rhizosphere	VLVIFFATFGAVFLAEIVGDKLLYTTGVLAARYRTAP
Ga0126381_1015567801	3300010376	Tropical Forest Soil	MIPILLTSYGAVFVAEIVGDKLLYTTGVLSARYRTAPVLFG
Ga0124850_11286341	3300010863	Tropical Forest Soil	MLPIFFATYGAVFVAEIVGDKLLYTTGVLATRYRTA
Ga0137451_12853991	3300011438	Soil	LLELVLTTYGAVFVAEIVGDKLLYTTGVLAARYRSAAVV
Ga0137383_112528231	3300012199	Vadose Zone Soil	MLPILFATYGAVFVAEIAGDKLLYTTGVLANRYRAAPIMFGMALAF
Ga0137362_100302351	3300012205	Vadose Zone Soil	MILILLTAFGAVFVAEIVGDKLLYTTGILAARYRTMPIM
Ga0137378_112165441	3300012210	Vadose Zone Soil	MLPIFLATFGTVIVAEIVGDKLLYTTGVLATRYRTLPILCGM
Ga0150985_1191105731	3300012212	Avena Fatua Rhizosphere	VLAVFLATYGAVFIAEIVGDKLLYTTGVLATRYRPAAIIAGLAAA
Ga0137419_108576213	3300012925	Vadose Zone Soil	VILILLTTFGAIFVAEIVGDKLLYTTGVLAARYRTMPI
Ga0137407_107739341	3300012930	Vadose Zone Soil	MLAIFLATYGAVFVAEIVGDKLLYTTGVLAARYKT
Ga0157374_114949941	3300013296	Miscanthus Rhizosphere	MLTIFAATYAAVFIAEIVGDKLLYTTGILATRYRSLPVI
Ga0163162_100572393	3300013306	Switchgrass Rhizosphere	MVLIFFTTFGTVFVAEIVGDKLLYTTSVLAARYRALPIT
Ga0163162_107504392	3300013306	Switchgrass Rhizosphere	MVLIFFTTFGTVFVAEIVGDKLLYTTGVLATRFRTLPIM
Ga0163162_127382761	3300013306	Switchgrass Rhizosphere	MISVFIATYAAVFIAEIVGDKLLYTTGILATRYRSLPVMLG
Ga0181529_106064721	3300014161	Bog	MLAILFATYGTVFVAEIVGDKLLYTTGVLATRFRWAPILCGMAMAFLL
Ga0181528_108389582	3300014167	Bog	MLPIFLQTYGTVFGAEIVGDKLLYTTGVLSARYKTA
Ga0157380_100855221	3300014326	Switchgrass Rhizosphere	LLQLVLTTYGAVFVAEIVGDKLLYTTGVLAARYRSAAVVLGMA
Ga0182014_106350892	3300014491	Bog	MLPILFATYGAVFLAEIAGDKLLYTTGVLAARRA*
Ga0182013_101296131	3300014492	Bog	MLPILLATYGTVFVAEIVGDKLLYTTGVLATRYRWGPIL
Ga0182016_108531921	3300014493	Bog	MIAILFATYGAVFVAEIVGDKLLYTTGVLATRYRTVS
Ga0182015_109900362	3300014495	Palsa	MIAIFIATYGAVFVAEIVGDKLLYTTGVLATRYRTTAVMIGMLIAF
Ga0182024_125437541	3300014501	Permafrost	MIAILIATYGAVFVAEIVGDKLLYTTGVLATRYRTVPIMIG
Ga0157379_103045651	3300014968	Switchgrass Rhizosphere	LLVIFFATFGAVFLAEIVGDKLLYTTGVLSARYRTAPILIGMA
Ga0132256_1013235141	3300015372	Arabidopsis Rhizosphere	LLVIFFATFGAVFLAEIVGDKLLYTTGVLSARYRTVPILI
Ga0132256_1023843202	3300015372	Arabidopsis Rhizosphere	MLPILFATYGAVFVAEIVGDKLLYTTGVLATRYRTAPIMFGMAISFMAKM
Ga0132257_1008481061	3300015373	Arabidopsis Rhizosphere	MAEFFGIFFTTYGAVFIAEIVGDKLLYTTGVLATRYRSVSIMIGMA
Ga0187860_13308791	3300018014	Peatland	MLPIILATYGTVFVAEIVGDKLLYTTGVLATRYRWV
Ga0187857_104679521	3300018026	Peatland	MLPILFATYGAVFIAEIAGDKLLYTTGVLAARYRAAPILCGMA
Ga0187867_107489601	3300018033	Peatland	MFAIFLATYGAVFVAEIVGDKLLYTTGVLAARYKTLPIMIGMG
Ga0187863_104073612	3300018034	Peatland	MLPIFIATYAAVFMAEIVGDKLLYTTGLLATRYKTFPILCGM
Ga0187765_113352432	3300018060	Tropical Peatland	MLPILLATYGAVFIAEIVGDKLLYTTGVLATRYRT
Ga0187773_109573982	3300018064	Tropical Peatland	MVAILLTTYVAVFLAEIVGDKLTYTTGILATRYRPAPIM
Ga0066667_105721511	3300018433	Grasslands Soil	MPVIFFATFGAVFIAEIVGDKLLYTTGVLAARYRTAPMM
Ga0066669_109712371	3300018482	Grasslands Soil	LLVIFFATFGAVFLAEIVGDKLLYTTGVLAARYRTA
Ga0181506_11311471	3300019260	Peatland	MTAVLFATFGAVFVAEIVGDKLLYTTGVLTTRYRTAPVI
Ga0193722_11305402	3300019877	Soil	MIAIFLATYGAVFLAEIAGDKLLYTTGVLTTRFRTVPVMIGVSLA
Ga0210388_111974052	3300021181	Soil	MLTIFFATYGVVFAAEIVGDKLLYTTGVLAARYSP
Ga0126371_132954892	3300021560	Tropical Forest Soil	MLPVLFATYGAVFVAEIVGDKLLYTTGVLANRYRAVPIMFGMALAFI
Ga0213853_112642612	3300021861	Watersheds	MLALFFATYGAVFLAEIVGDKLLYTTGVLATRYRTVPIMVGMGIAFM
Ga0242641_10513461	3300022499	Soil	MFAILLATYGAVFVAEIVGDKLLYTTGVLATRYKTVPILMG
Ga0242676_10029311	3300022512	Soil	MLPIFLATYGAVFVAEIVGDKLLYTTGVLAARYRTVP
Ga0242675_10931572	3300022718	Soil	MLPIFLATYGAVFVAEIVGDKLLYTTGVLAARYRTV
Ga0207701_104597711	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	LLIFFTTFGTVFVAEIVGDKLLYTTGVLAARYRTLPITL
Ga0207644_112847482	3300025931	Switchgrass Rhizosphere	MLVVFFATFGAVFLAEIVGDKLLYTTGVLASRYRTAPIMI
Ga0207668_112679601	3300025972	Switchgrass Rhizosphere	MLAALLATYAAVFLAEIVGDKLLYTTGILATRYRPLPIMI
Ga0209248_102570712	3300027729	Bog Forest Soil	MIAILFATYGAVFVAEIVGDKLLYTTGVLAARFRIGTVVVGVLL
Ga0209069_101553653	3300027915	Watersheds	MLAIILATFAAVFIAEIVGDKLLYTTGVLAARYSTLPI
Ga0268265_113227572	3300028380	Switchgrass Rhizosphere	MLAALLATYAAVFLAEIVGDKLLYTTGILATRYRPLPIMIRITAAFM
Ga0268264_124057721	3300028381	Switchgrass Rhizosphere	MLSIFLATYGAVFIAEIVGDKLLYTTGVLATRYRSASIMLGMALAFC
Ga0137415_110320952	3300028536	Vadose Zone Soil	MRSLLLAAYVTVFAAEIVGDKLLYTTGVLAAQYPRAPLLFGMALAFMVKMG
Ga0302157_105940522	3300028813	Bog	MLPILLATYGTVFVAEIVGDKLLYTTGVLATRYRWGPILCGM
Ga0222749_106213831	3300029636	Soil	MLAVFLATYGAVFVAEIVGDKLLYTTGVLATRYRLVS
Ga0247028_11098312	3300029894	Cryconite	MIPILLATYGAVFVAEIVGDKLLYTTGVLATRYRT
Ga0311329_110511772	3300029907	Bog	MLSIFFATYAAVFLAEIVGDKLLYTTGVLATRYRTTSV
Ga0311363_105461251	3300029922	Fen	MIPILLATYTAVFVAEIVGDKLLYTTGVLATRYRTA
Ga0311343_103936811	3300029953	Bog	MLPILLATYGTVFVAEIVGDKLLYTTGVLATRYRWGPI
Ga0302283_11588871	3300029994	Fen	MIPILFATYGAVFVAEIVGDKLLYTTGVLATRYRTV
Ga0311338_119157511	3300030007	Palsa	MLPIFFATYSAVFIAEIVGDKLLYTTGVLAARYRTIPIM
Ga0302275_100260414	3300030518	Bog	MWAILLATYGAVFVAEIVGDKLLYTTGVLATRNRTVP
Ga0311354_105869463	3300030618	Palsa	MLPIFFATYAAVFMAEIVGDKLLYTTGLLATRYKTFPILLGMA
Ga0302287_102246951	3300030673	Fen	MLAIFLAAYAAVFIAEIVGDKLLYTSGILATRFRWGAV
Ga0302325_128450372	3300031234	Palsa	MLAVLLATYGAVFVAEIVCDKHLYKNGVLASREPTVPIILGMLIALM
Ga0302324_1031981582	3300031236	Palsa	MIAILFATYGAVFVAEIVGDKLLYTTGVLATRYRTLPIML
Ga0302320_117827161	3300031524	Bog	MIAIFIATYGAVFVAEIVGDKLLYTTGVLATRYRTMPIMIGMLI
Ga0302326_101236735	3300031525	Palsa	MLAIFIGTYVAVFVAEIVGDKLLYTTGVLATRYKT
Ga0302326_111574242	3300031525	Palsa	MFPILFETYGVVFVAEIVGDKLLYTTGVLATRYRTAPILFG
Ga0302326_114589821	3300031525	Palsa	MFPIFLATYGAVFVAEIVGDKLLYTTGVLAARYRTVPI
Ga0302326_120248442	3300031525	Palsa	MLPIFLATYGAVFVAEIVGDKLLYTTGVLATKYKTIPIMFGMA
Ga0310686_1043884551	3300031708	Soil	MFPILFATYVAVFVAEIVGDKLLYTTGVLATRYRTTPILFGM
Ga0307476_110996392	3300031715	Hardwood Forest Soil	MIPLFLLTYGAVFVAEIVGDKLLYTTGVLATRYRTAPIVI
Ga0310813_117909172	3300031716	Soil	MWTIFFATYGAVFLAEIVGDKLLYTTGVLATRYRWG
Ga0302321_1029467772	3300031726	Fen	MLPILLAAYGAVFVAEITGDKLLYTTSVLATRYRAAPILCGM
Ga0302319_100598201	3300031788	Bog	VLSIFFATYAAVFIAEIVGDKLLYTTGVLATRYRTASVMV
Ga0307473_111384102	3300031820	Hardwood Forest Soil	MLIIFFTTFGTVFVAEIVGDKLLYTTSVLAARYRTIPI
Ga0307478_110452421	3300031823	Hardwood Forest Soil	MLTIFFATYGAVFVAEIVGDKLLYTTGVLATRYRTVPIMIGMA
Ga0307478_112508892	3300031823	Hardwood Forest Soil	MLPIFLATYGAVFVAEIVGDKLLYTTGVLAARYRTVPIMLGMA
Ga0310906_112685071	3300032013	Soil	MAAIFFGTYGAVFVAEVVGDKLLYTTGVLATRYRSLSIVVGM
Ga0335079_110419622	3300032783	Soil	MLPIFLATYSAVFIAEIVGDKLLYTTGVLAARYRTLPI
Ga0335078_117953831	3300032805	Soil	MLPIFLATYGTVFVAEIVGDKLLYTTGVLATRYRTLPVMCGM
Ga0335080_105200923	3300032828	Soil	MIPILLATYGAVFIAEIVGDKLLYTTGVLATRYRTTPILI
Ga0335084_110918621	3300033004	Soil	MLPIFFATYGAVFVAEIVGDKLLYTTGVLATRYRTVP
Ga0335073_118150872	3300033134	Soil	MLPIFFATYGTVFMAEIVGDKLLYTTGVLATRYKTV
Ga0334792_095341_2_106	3300033888	Soil	MFAILLATYVAVFAAEIVGDKLLYTTGVLATRYRT
Ga0370492_0459287_1_117	3300034282	Untreated Peat Soil	MLPILFATYGAVFIAEIAGDKLLYTTGVLAARYRTAPIL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign