NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080963

Metagenome / Metatranscriptome Family F080963

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080963
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 147 residues
Representative Sequence MTRSIAIRAAASLLGAGCVVWATAPLVHTGLANLALFLAICGVTGGALRLLLAGVPVPEDSFLLSVPLRAWLGFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPTVLRPQVRVLAAGAG
Number of Associated Samples 95
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 61.06 %
% of genes near scaffold ends (potentially truncated) 97.37 %
% of genes from short scaffolds (< 2000 bps) 93.86 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.77

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.474 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(38.596 % of family members)
Environment Ontology (ENVO) Unclassified
(45.614 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(42.982 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 67.84%    β-sheet: 0.00%    Coil/Unstructured: 32.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.77
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
f.72.1.1: Double antiporter-like subunits from respiratory complex Id3rkod_3rko0.59357
a.216.1.1: I/LWEQ domaind1r0da_1r0d0.58694
c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domaind1gqia11gqi0.58501
f.72.1.1: Double antiporter-like subunits from respiratory complex Id3rkol_3rko0.57419
f.13.1.1: Bacteriorhodopsin-liked1h2sa_1h2s0.57383


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF01882DUF58 17.54
PF00795CN_hydrolase 1.75
PF07726AAA_3 1.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG1721Uncharacterized conserved protein, DUF58 family, contains vWF domainFunction unknown [S] 17.54


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.47 %
UnclassifiedrootN/A10.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005602|Ga0070762_11262522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. MOTT36Y512Open in IMG/M
3300005610|Ga0070763_10783046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii563Open in IMG/M
3300005610|Ga0070763_10804371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii556Open in IMG/M
3300006904|Ga0075424_100209003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → Actinospica robiniae2073Open in IMG/M
3300009522|Ga0116218_1070110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1595Open in IMG/M
3300009523|Ga0116221_1394366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii602Open in IMG/M
3300009764|Ga0116134_1069724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1307Open in IMG/M
3300009839|Ga0116223_10176416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1316Open in IMG/M
3300010046|Ga0126384_10571153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii986Open in IMG/M
3300010341|Ga0074045_10903032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii557Open in IMG/M
3300010376|Ga0126381_103642198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii604Open in IMG/M
3300010379|Ga0136449_103917011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii558Open in IMG/M
3300010876|Ga0126361_10312964Not Available560Open in IMG/M
3300012349|Ga0137387_11002149Not Available599Open in IMG/M
3300012924|Ga0137413_10969953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii665Open in IMG/M
3300012971|Ga0126369_12909795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii561Open in IMG/M
3300014200|Ga0181526_10753575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii614Open in IMG/M
3300016294|Ga0182041_11826702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii564Open in IMG/M
3300016371|Ga0182034_11835489Not Available534Open in IMG/M
3300016387|Ga0182040_11094412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii667Open in IMG/M
3300016422|Ga0182039_12020116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii530Open in IMG/M
3300016445|Ga0182038_10293513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1326Open in IMG/M
3300017821|Ga0187812_1067724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1187Open in IMG/M
3300017822|Ga0187802_10220438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii731Open in IMG/M
3300017924|Ga0187820_1059383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1046Open in IMG/M
3300017926|Ga0187807_1334014Not Available508Open in IMG/M
3300017928|Ga0187806_1107428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii896Open in IMG/M
3300017942|Ga0187808_10387402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii638Open in IMG/M
3300017959|Ga0187779_10241266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1142Open in IMG/M
3300017959|Ga0187779_11178035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii538Open in IMG/M
3300017972|Ga0187781_10926087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii635Open in IMG/M
3300017974|Ga0187777_10307601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1084Open in IMG/M
3300017975|Ga0187782_10338819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1138Open in IMG/M
3300018001|Ga0187815_10431153Not Available562Open in IMG/M
3300018037|Ga0187883_10374353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii729Open in IMG/M
3300018062|Ga0187784_11221704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii596Open in IMG/M
3300020581|Ga0210399_10734264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii810Open in IMG/M
3300021088|Ga0210404_10647056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii602Open in IMG/M
3300021180|Ga0210396_11655779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii521Open in IMG/M
3300021388|Ga0213875_10163257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1045Open in IMG/M
3300021407|Ga0210383_11146039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii655Open in IMG/M
3300025625|Ga0208219_1010167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii3067Open in IMG/M
3300025928|Ga0207700_10065689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2769Open in IMG/M
3300025931|Ga0207644_11411981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii585Open in IMG/M
3300027110|Ga0208488_1021771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1231Open in IMG/M
3300027110|Ga0208488_1056649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii669Open in IMG/M
3300027609|Ga0209221_1053741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1066Open in IMG/M
3300027884|Ga0209275_10250624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii971Open in IMG/M
3300027911|Ga0209698_10558514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii883Open in IMG/M
3300028780|Ga0302225_10458867Not Available596Open in IMG/M
3300028879|Ga0302229_10268144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii770Open in IMG/M
3300029882|Ga0311368_10729900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii682Open in IMG/M
3300029944|Ga0311352_10547819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii929Open in IMG/M
3300029951|Ga0311371_10340523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales2082Open in IMG/M
3300030399|Ga0311353_10656418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii910Open in IMG/M
3300030490|Ga0302184_10223175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii781Open in IMG/M
3300030618|Ga0311354_10161628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2433Open in IMG/M
3300030618|Ga0311354_10707951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii962Open in IMG/M
3300031572|Ga0318515_10594430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii588Open in IMG/M
3300031573|Ga0310915_11021090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii576Open in IMG/M
3300031668|Ga0318542_10260769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii883Open in IMG/M
3300031679|Ga0318561_10115609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1422Open in IMG/M
3300031679|Ga0318561_10526505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii651Open in IMG/M
3300031679|Ga0318561_10643644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii583Open in IMG/M
3300031680|Ga0318574_10253922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1017Open in IMG/M
3300031681|Ga0318572_10429868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii785Open in IMG/M
3300031682|Ga0318560_10372572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii772Open in IMG/M
3300031708|Ga0310686_104942795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1162Open in IMG/M
3300031713|Ga0318496_10535161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii648Open in IMG/M
3300031713|Ga0318496_10547418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii640Open in IMG/M
3300031715|Ga0307476_10659321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii775Open in IMG/M
3300031719|Ga0306917_10854346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii713Open in IMG/M
3300031747|Ga0318502_10717962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii604Open in IMG/M
3300031751|Ga0318494_10088383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1694Open in IMG/M
3300031751|Ga0318494_10459772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii740Open in IMG/M
3300031751|Ga0318494_10735960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii577Open in IMG/M
3300031765|Ga0318554_10879778Not Available500Open in IMG/M
3300031768|Ga0318509_10615455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii605Open in IMG/M
3300031778|Ga0318498_10174554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii977Open in IMG/M
3300031778|Ga0318498_10319512Not Available695Open in IMG/M
3300031781|Ga0318547_10182090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1249Open in IMG/M
3300031782|Ga0318552_10426509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii676Open in IMG/M
3300031795|Ga0318557_10387684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii642Open in IMG/M
3300031798|Ga0318523_10539154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii576Open in IMG/M
3300031805|Ga0318497_10732700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii554Open in IMG/M
3300031819|Ga0318568_10202634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1224Open in IMG/M
3300031821|Ga0318567_10452277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii728Open in IMG/M
3300031821|Ga0318567_10589812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii631Open in IMG/M
3300031823|Ga0307478_11011363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii694Open in IMG/M
3300031831|Ga0318564_10457282Not Available556Open in IMG/M
3300031890|Ga0306925_10760105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1009Open in IMG/M
3300031890|Ga0306925_11350385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii706Open in IMG/M
3300031890|Ga0306925_11720368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii604Open in IMG/M
3300031938|Ga0308175_100195353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1988Open in IMG/M
3300031941|Ga0310912_10305416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1232Open in IMG/M
3300031941|Ga0310912_10495305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii953Open in IMG/M
3300031945|Ga0310913_10952214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii603Open in IMG/M
3300031954|Ga0306926_10583958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1366Open in IMG/M
3300031954|Ga0306926_11219040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii883Open in IMG/M
3300031954|Ga0306926_12398960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii581Open in IMG/M
3300032008|Ga0318562_10127477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1457Open in IMG/M
3300032009|Ga0318563_10534455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii633Open in IMG/M
3300032010|Ga0318569_10601421Not Available512Open in IMG/M
3300032039|Ga0318559_10416721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii626Open in IMG/M
3300032039|Ga0318559_10484684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii577Open in IMG/M
3300032044|Ga0318558_10390329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii692Open in IMG/M
3300032065|Ga0318513_10675551Not Available506Open in IMG/M
3300032066|Ga0318514_10386736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii742Open in IMG/M
3300032066|Ga0318514_10387576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii741Open in IMG/M
3300032895|Ga0335074_11127802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii672Open in IMG/M
3300032896|Ga0335075_10118741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3399Open in IMG/M
3300032896|Ga0335075_10315966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1732Open in IMG/M
3300034199|Ga0370514_050948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1040Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil38.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.53%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa7.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment6.14%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.26%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.51%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.51%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.63%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.63%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.75%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.75%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.75%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.88%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.88%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.88%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.88%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.88%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.88%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.88%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027110Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes)EnvironmentalOpen in IMG/M
3300027609Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070762_1126252213300005602SoilMTRTAAIRGAPVLFGAGCVVWAAVPLVSSGWAGFALFLAILGVAAGALRLVLAGVPTPEESYLLSAPLRAWLKFLEILRLVPWEEGALVAILWLEVLHPARPWHTAFLGAGLIAYLLATHLVESGAAPEALRPQVRVLAVGAGLLALGAGAGM
Ga0070763_1078304613300005610SoilVTAPRLAAAGSRLAAALLGAGCVIWADTGSAVTHKGDADLALFLAIFGVAAGVIRLALAGVPVPEDTFLLPAPLHVWLWFLQTLRRVPWEEGALLAIVWLEVLHRSPPWHTAVLGAALIAYLLAVHLAETDASPAVLRPQVQ
Ga0070763_1080437123300005610SoilMTRPVVIRPAAIRTAAGLLGAGCVIWAAAPLVHKGLANLVLVLAILGVVGAALRLILAGVPVPEDTFLLPPPLKAWLRFLEMLRRVPWEEGAVIAIVWLEVLHASRPWHTFFLGAALIAYLLATHLAESDTSPGVLR
Ga0075424_10020900313300006904Populus RhizosphereVTISAALLGVGCVVWAAVPPARQGWAGFALFLAIAGVAAGALRLALIAVPVPEDSFLLPGVLRAWLRFLEALRQVPWEEGAVAGVLWLEVLHPSRPWHTAVLGAALTAYLLATHLAESGSRPGVLRPHARV
Ga0116218_107011023300009522Peatlands SoilVRGAIGVRIAACLLGAGCVVWATVPQVHRGTADFALFLAIVGVAAGALRLALTAVPVPEDSYLLPAALRGWLSFLATLRAVPWEEGALLAALWLEVLHPSRPWHTAVLGAALIAYLLATHLAESGASPQAL
Ga0116221_139436613300009523Peatlands SoilVNRAVLRVAGSPVWGPVAVRAAAALLGAGCVVWATVPQVHKGAADFALFVAIVGVVAGALRLALTAVPVPEDSYLLPAALRGWLSFLATLRLVPWEEGALLAVLWLEVLHPSRPWHTAVLGAALIAYLLAVHLAESGASPQALRPQVRVLA
Ga0116134_106972423300009764PeatlandMRGTVAIRVAAFLLGAGCVVWATVPQVHEGLADWALFLATIGVAAGALRLALTAVPVPENSYLLPAGLRVWLSFLETLRKVPWEEGALIAILWLEVLHSSRPWHTAVLGAALIAYLLATHLAESDAS
Ga0116223_1017641613300009839Peatlands SoilMTRSIAIRAAAGLLGAGCVVWSAAPLVHKGLANLALVLAICGVAGGTLRLLLAGVPVPEDSFLLSTPLQAWLRLLETLRRVPWEEGAVLAIVWLEVLHSSRPWHTALLGAALVAYLLATHLAESDASPGVLRPQVRVLAVGAALLALGAGAGMLP
Ga0126384_1057115323300010046Tropical Forest SoilMRAAAVLLGAGCLVWAALPAVHRGYATFVLAVAIAGVAGGGLRLALAAVPVPDESYWPSPGVRAWRAFLDVVRLVPWEEGAVIGIAWLEVLHPSRPWHTAVLGAGLIAYLIVVHLAESDARLATLRPQARVLGLGAVLLALGAG
Ga0074045_1090303213300010341Bog Forest SoilVAIRVAASLLGAGCVVWATVPQVHKGLADLALFLAAIGVAAGALRLALTAVPVPESSYLLPTGLRVWLSFLETLRKVPWEEGALIAILWLEVLHPSRPWHTAVLGAALIAYLLATHLAESAASLGALRPQVRVLAVGAGLLAL
Ga0126381_10364219823300010376Tropical Forest SoilMTRSIAIRAAAGLLGAGCLVWAAAPLEHRGSANLALTLAIAGVAGGVLRLLLAGVPVPEDSYLLPTPLQAWLRFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASP
Ga0136449_10391701113300010379Peatlands SoilMRGTVRGVIGVRIAACLLGAGCVVWATVPQVHKGAADFALFLAIVGVAAGALRLALTAVPVPEDSYLLPAALRGWLSILATLRTVPWEEGALLAVLWLEVLHPSRPWHTAILGAALIAYLLAVHLAESGASPRA
Ga0126361_1031296413300010876Boreal Forest SoilMTLRAGAGLMGAGCVTWAAVPLPHQGWTGFALFLAITGVAAGALRLALAGLPVPGDDYYLLPAPLRAWLRFGEILRQVPWEEGAVTAVLWLEVLHPARPWHTAVLGAGLIAYLLTTHLAESDTSWAALRPQVRVLAIGAGLLALGAGAGMLPALSPGAGSALLRLLAA
Ga0137387_1100214923300012349Vadose Zone SoilVHRGYATFVLDVAIAGVAAGGLRLALAAVPVPEDSYWPSPGLRVWRTFLEAVRQVPWEEGAVIGIAWLEVLHPSRPWHTAVLGAGLIAYLLITHLAESDATLATLRPQARVL
Ga0137413_1096995323300012924Vadose Zone SoilMRAAAVLLGAGCLVWAALPAVHRGWSGFALVLAIAGVAAGGLRLALAAVPVPEDSYWPSPGLRVWRAFLEVVRQVPWEEGAVIGIVWLEVLHPSRPWHTAVLGAGLIAYLLVVHLAESDAPLATLRPQARVLGLGAVLLALGAGAGMLPAVGPGAGSALL
Ga0126369_1290979523300012971Tropical Forest SoilMTRTMAIRAAASLLGAGCVVWATAPLVHTGLANLALFLAICGVTGGALRLLLAGVPVPEDSFLLSVPLRAWLGFLETLRRVPWEEGAVLAIVWLEVLHRSRPWHTAVLGAALIAYLLATHLAESDASPTVLRPQVRVLA
Ga0181526_1075357523300014200BogMRGTVAIRVAAFLLGAGCVVWATVPQVHEGLADWALFLATIGVAAGALRLALTAVPVPENSYLLPVGLRVWLSFLETLRKVPWEEGALIAILWLEVLHSSRPWHTAVLGAALIAYLLATHLAESDASLRALRPQVRVLAVGAGLLALGAGAGML
Ga0182041_1182670213300016294SoilMIRRSVAIRAAAVLLGAGSVVWATAPPVHHGPASLALVLAICGVAGGALRLILAGVPVPEDSFVLRPPLRAWLGFLQTLRRVPWEEGAVFAIVWLEALHKSRPWHTAVLGAALIAYLLATHLAESGAS
Ga0182034_1183548913300016371SoilMTRSLGPVRLGPVVIGPVATRGAAMRAAAILLGVGCVVWATAPPVHKGPVNLALILAIGGVAGGALRLILAGVPVPDDAFLLPAPARAWLSFLEVLRRVPWEEGAVIGLVWLEVLHPSRPWHTAVLGAALVAYLLATHLAESDATLGTLRPQVRVLALGA
Ga0182040_1109441213300016387SoilMTRTIAIRAAASLLGAGSVVWATAPLVHTGLANLALFLAICGVTGGALRLLLAGVPVPEDSFLLSVPLRAWLGFLETLRRLPWEECAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDA
Ga0182039_1202011613300016422SoilMRGAAVLLGAGCVIWAALPPADKGYAGFAVTVAIAGVAGGGLRLALTAVPVPEDSYLLSAGLRAWLTFLAAVRLVPWEEGALVAIVWLEVLHPARPWHTAVLGAGLIAYLLVTHLAESDAALATLRPQ
Ga0182038_1029351313300016445SoilMTRAVTIKAAAGLLGAGCVVWSVLGPAPPHRGQAHLALTLAIIGVAGGVLRLILAGVPEPEESFLLPVPLRAWFWFLGVLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPAVLRPQARVLAVGAGLLALGAGAGMLP
Ga0187812_106772423300017821Freshwater SedimentMTRAIAIRAAAGLLGAGCVVWVTAPLVHDGPANLALILAICGVAGGALRLILAGVPVPEDSFLLPSPLRAWLGFLQTLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPGVLRPQVRVLAV
Ga0187802_1022043813300017822Freshwater SedimentMTRSIAIRAAAGLLGAGCVVWSAAPLVHRGLANLALVLAICGVAGGALRLLLAGVPVPEDSFLLSAPLQAWLRFLETLRRVPWEEGAVLAIVWLEVLHSSRPWHTALLGAALVAYLLATHLAESDASPGVLRPQVRVLAVGAALLA
Ga0187820_105938313300017924Freshwater SedimentMTRFLGPVRLGPFVIGPVDTRAAAIRAAAILLGAGCVVWATVPPVHKGLANLALILAICGVAGGALRLILAGVPVPEDAFLLPAPTQVWLRFLGILRQVPWEEGAVIGLVWLEVLHPSRPWHTAILGAALVAYLLATHLAESNAGPGTLRPQVRVLAVGAGLLALGAGAGMLPATGPGAG
Ga0187807_133401413300017926Freshwater SedimentDREHAPMTRSIAIRAAAGLLGAGCVVWATAPLVHDGLANLALILASCGVAGGALRLILAAVPVPEDSFLLPSPLRAWLRFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESGASPAVLRPQVRVLAVGAGLLALGAGAGMLPATGPGAG
Ga0187806_110742813300017928Freshwater SedimentMTRFLGPVRLGPFVIGPVDTRAAAIRAAAILLGAGCVVWATVPPVHKGLANLALILAICGVAGGALRLILAGVPVPEDAFLLPAPTQVWLRFLGILRQVPWEEGAVIGLVWLEVLHPSRPWHTAILGAALVAYLLATHLAESNAGPGTLRPQVRVLAVGAGLLALGAGAGMLPATGPGAGAALL
Ga0187808_1038740213300017942Freshwater SedimentMTRSFAIRAAAILLGAGCVVWATAPPVHQGLANLALVLAVCGVAGGALRLLLAGVPVPEDPFLLSAPLQAWLRFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGVALIAYLLATHLAESDASPAVLRPQARVLAVGAGLLALGAGAGM
Ga0187879_1043217813300017946PeatlandMTGGSVPRARVLRAGVLRSSSLLLGTVLLGAGCIVWAAAPLAPSGYAGFALFLAILGVAAGALRLALAAVPEPEDNYLLPIPLRTWLKFLETLRLVPWEEGALVAILWLEVLHRAWPWHTALLGAALIGYLLATHLAESGASPEALRPQVR
Ga0187779_1024126623300017959Tropical PeatlandMTRSVGPVRLGPASIGPFSIGPVDMGAAAIRAAAGLLGAGCVVWAAVPQVHKGLANLALILAIGGVAGGVLRLILGGVPVPEDAFLLPAPLRAWLGFLQTLRRVPWEEGAVIALVWLEVLHPSRPWHTAVLGAALIAYLLATHLAESGASPGVLRPQLR
Ga0187779_1117803513300017959Tropical PeatlandMTRSVAIRVAAGLLGAGCVVWATVPQVHKGVATLALILAICGVAGGTLRLILAGMPVPEDTFMVPAPVQAWLWFLEALRQVPWEEGAVIALVWLEVLHPSRPWHTAVLGAALIAYLLATHLAESGASPGVLRPQLRVLA
Ga0187781_1092608713300017972Tropical PeatlandMRRAFGPLRLGPLTVGPMDAGAVAVRGAAFLLGAGCVVWASAPLGHSGLAHIALFLAIFGVAAGALRLALAGVPVPNEPYLLPWPLRAWLGLLETLRRVPWEEGALVAILWLEVQHPARPWHTALLGAALIAYLLATQLAESDASVGTLRPQVRLLAAGAGLLALGA
Ga0187777_1030760113300017974Tropical PeatlandMTRSVAIRVAAGLLGAGCVVWATVPQVHKGVATLALILAICGVAGGTLRLILAGMPVPEDSFMVPGPVRAWLWFLEALRQVPWEEGAVIALVWLEVLHPSRPWHTAVLGAALIAYLLATHLAESGASPGVLRPQLRVLAVGAGLLALGAGAGMLPAAGPGPGA
Ga0187782_1033881913300017975Tropical PeatlandMTRSVALRAAAILLGAGCVVWATAPLVHKGLANLALILAICGVAGGALRLILAGVPVPEDSFLLPAPLQAWLRFLETLRRVPWEEGAVLAIVWLEVLHSSRPWHTAVLGTALIAYLLATHLAESGASPGVLRPQVRLLAVGAALLALGAGAGMLPAA
Ga0187815_1043115313300018001Freshwater SedimentMTRSVAIRVAAGLLGTGCVVWATVPQVHKGVADLALVLAIAGVAGGTLRLILAGMPVPEDSFMVPAPVRAWLWFLEALRQVPWEEGAVIALVWLEVLHPSRPWHTAVLGAALIAYLLATHLAESDASPGTLRPQLRVLAVGEGLLALGAGAGMLPAAGPGPGAALLRLVAA
Ga0187883_1037435323300018037PeatlandMRGTVAIRVAAFLLGAGCVVWATVPQVHEGLADWALFLATIGVAAGALRLALTAVPVPENSYLLPVGLRVWLSFLETLRKVPWEEGALIAILWLEVLHSSRPWHTAVLGAALIAYLLATHLAESDASLRALRPQVRVLAVGAGLLALGAGAGMLPEAGPGAGSA
Ga0187784_1122170423300018062Tropical PeatlandMTRSVTLRAAAILLGAGCVVWATAPLVHKGLANLALILALCGVAGGALRLILAGVPVPEDSFLLPAPLQAWLRFLETLRRVPWEEGAVLAIVWLEVLHSSRPWHTAVLGAALIAYLLATHLAESGASP
Ga0210399_1073426413300020581SoilMRGAAVLLGAGCVIWAALPPADKGYAGFSLTVAIAGAAGGGLRLVLTAVPVPEDSYLLSAGLRVWRTFLAAVRQVPWEEGALIAIVWLEVLHPARPWHTAVLGAGLIAYLLVTHLAESDASLATLRPQARVLGLGAVLLALGAGAGMLPAAG
Ga0210404_1064705613300021088SoilMTRYWVAIRAAAALLGAGCVIWAAVPLVHQGWANLALVLAIAGVAAGALRLVLAGVPQPEDTFLLPVPVRAWLRFLETLRRVPWEEGAVIALVWLEVLHRSRPWHTAILGAALIAYLLATHLAESDASPGVLRPQVRVLAVGAGLLALGAGAGML
Ga0210396_1165577913300021180SoilMTRYWIAIRGAAALLGAGCVVWAAVPLVHEGWANLALVLAIAGVAAGALRLALAGVPQPEDVFLLPAPVRAWLRFLEMLRRVPWEEGAVIALVWLEAMHRPWPGHTALLGAALIAYLLATHLAESDASPGVL
Ga0213875_1016325723300021388Plant RootsMSRLTDPGPLAIRVAAMLLGAACVAWAATPPVHNGLVGVALPLAIIGVAAGALRLALSEMPVPEDAFLLGGPQRIWLWFLEALRKVPWEEGGAVAVLWLEVLHSARPRHTAILGAALVAYLLTIHLAESDAALAALRPQ
Ga0210383_1114603913300021407SoilMTRSLRPMSRAAATRAAAILLGAGCVVWATAPPVHKGLANLALILAICGVAGGALRLVLAGVPVPEDTFLLPAPAQALLRFLEILRQVPWEEGAVIGLVWLEVLHPSRPWHTAFLGAALVAYLLATHLAESDAGPGTLRPQVRVLAVGAGLLALGAGAGMLPA
Ga0208219_101016723300025625Arctic Peat SoilMTRPKDAVVLRVAACLLGAGCVVWAAAPLVPRGLAEWALALAILGVAAGTLRLAVARIPVPEDNWLLPTTARAVIRVLEVLRSVPWEEGALLAIVWLELLHSSRPWHTAVLGAALIAYLLVTHLAESDASPKALRPQAWLLAAGAGLLALGAPSEPPDSPPRR
Ga0207700_1006568943300025928Corn, Switchgrass And Miscanthus RhizosphereVNGIAVRAGAALIGAACVVWVAVPAVHKPWAGFALFLAITGVAAGALRLALIAVPVPEDSFLLPGALRAWLRFLETLRQVPWEEGAVTAVLWLEVLHPSRPWHTAVLGAALIAYLLATHLAES
Ga0207644_1141198123300025931Switchgrass RhizosphereMRAGTVTIGAVLLGAGCVAWAAVPAVHKPWAGFALFLAIAGVAAGALRLALIAVPVPEDSFLLPGPLRAWLRFLETLRQVPWEEGAVTAVLWLEVLHPSRPWHTAVLGAALIAYLLATHLAESGSRPRV
Ga0208488_102177113300027110Forest SoilMTRPATIRAAAALLGAGCVVWAAAPLVHTGLANLALVLAILGVVGGVLRLLLAGVPVPEETFLLPTPLRAWLRFLETLRLVPWEEGAVIAIVWLEVMHSSRPWPTAGLGAALIAYLLATHLAESGASPGVLRPQARVLAVGAVLLALGAGAGM
Ga0208488_105664923300027110Forest SoilMTGTAPIGGTAIRGAAIRGAAILLGAGCVVWATAPPVHRGYADFALFLAILGVAAGALRLALATVPVPEDNYLLPGPLRAWLWFLENLRLVPWEEGALIAILWLEVLHPAPPWYTAVLGAALISYLLATHLAESGASPEALRPQVRVLAIGAGLLALGAGAGMIPAVGPGPGSALLR
Ga0209221_105374123300027609Forest SoilMSQVARIRSAGGLIASMGGGPVRAATILLGAGCVVWSAAPLVHTGLAGFVLFLAITCVAAGALRLLLAWVPVPEDSYLLPTPLRVWLRFLEILRVVPWEEGAVVAILWLELLHSAWPWHTAFLGAALTGYLLATHLAESGASPATLRPQARVLAAGAGLLALGAGAGML
Ga0209275_1025062413300027884SoilMTRTAAIRGAPVLFGAGCVVWAAVPLVSSGWAGFALFLAILGVAAGALRLVLAGVPTPEESYLLSAPLRAWLKFLEILRLVPWEEGALVAILWLEVLHPARPWHTAFLGAGLIAYLLATHLVESGAAPEALRPQVRVLAVGAGLLALGAGAG
Ga0209698_1055851413300027911WatershedsMRGTVRGAIGVRIAACLLGAGCVVWATVPQVHKGAADFALFLAIVGVAAGALRLALTAVPVPEDSYLLPAALRGGLSFLATLRLVPWEEGALLAVLWLEVLHPSRPWHTAVLGGALIAYLLAVHLAESGASPRALRPQVRVLAAGA
Ga0302225_1045886713300028780PalsaMTGTGAIRGAAIRGAAILLGAGCVVWATVPPVHRGYADFALFLAILGVTAGALRLTLAAVPVPEDNYLLPAPLRVWIWFLETLRQVPWEEGALIAVLWLEVLHRAWPWHTAVLGAALIAYLLATHLAESGASPDALRPQVRVLAVGAGLLSLGAGAGMLPAVGPGAGSA
Ga0302229_1026814423300028879PalsaMTGTAAIRGAPVLLGAGCVAWAAAPLVNSGWAGFALFLAILGVAAGTLRLVLAGVPTPEESYLLSAPVRFWLKFLDILRLVPWEEGALVAILWLEVLHPAPPWHTAVLGAALIGYLLATHLAESGASPEALRPQAR
Ga0311368_1072990023300029882PalsaMTGSSVPRAGVLRAGVLRGGSILLGAALLGAGCVVWAAAPLVRSGYADFALFLAILGVAAGALRLILAAVPVPEDNYLLPASLRVWLRFLEALRLVPWEEGGLLAILWLEVLHPAPPWHTAVLGAALIAYLLATHLAESGASLEALRPQVRVLAVGAGLLALGAGAG
Ga0311352_1054781923300029944PalsaMTGSSVPRAGVLRAGVLRGGSILLGAALLGAGCVVWAAAPLVRSGYADFALFLAILGVAAGALRLILAAVPVPEDNYLLPASLRVWLRFLEALRLVPWEEGGLLAILWLEVLHPAPPWHTAVLGAALIGYLLATHLAESGASPEALRPQVRVLAVGAGLLA
Ga0311371_1034052313300029951PalsaMTGSSVPRAGVLLAGVLRGGSILLGAALLGAGCVVWAAAPLVRSGYADFALFLAILGVAAGALRLILAAVPVPEDNYLLPASLRVWLRFLEALRLVPWEEGGLLAILWLEVLHPAPPWHTAVLGAALIGYLLATHLAESGASPEALRPQVRVLAVGAGLLALGAGA
Ga0311353_1065641823300030399PalsaMTGSSVPRAGVLRAGVLRGGSILLGAALLGAGCVVWAAAPLVRSGYADFALFLAILGVAAGALRLILAAVPVPEDNYLLPASLRVWLRFLEALRLVPWEEGGLLAILWLEVLHPAPPWHTAVLGAALIGYLLATHLAESGASLEA
Ga0302184_1022317523300030490PalsaMTFTGAIRGGYGRAAIRGAAILLGAGCVVWAAAPLVRSGYAGLALFLAILGVAAGALRLVLAGVPVPEENYLLPGPLRAWLWFLENLRRVPWEEGALIAILWLEVLHPARPWHTAILGAALVGYLLATHLAESGASLEALRPQVRVLA
Ga0311354_1016162813300030618PalsaMTGSSVPRAGVLRAGVLRGGSILLGAALLGAGCVVWAAAPLVRSGYADFALFLAILGVAAGALRLILAAVPVPEDNYLLPASLRVWLRFLEALRLVPWEEGGLLAILWLEVLHPAPPWHTAVLGAALIGYLLATHLAESGASPEALRPQVRVLAVGA
Ga0311354_1070795133300030618PalsaVAAGALRLVLAAVPVPEENYLLPLPLQLCLRFLEVLRLVPWEEGALIAVLWLEVLHRARPWHTAFLGAALIAYLLATHLAESGASPDALRPQVRVLAVGAGLLALGAGAGMVPAVGPGAGSALL
Ga0318515_1059443013300031572SoilMTRSIAIRAAAGLLGAGCLVWAAAPLVHRGSANLALTLAIAGVAGGVLRLLLAGVPVPEDSYLLPTPLQAWLWFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPAALRPQVRVLA
Ga0310915_1102109023300031573SoilMTRAVTIKAAAGLLGAGCVVWSVLGPAPPHRGQAHLALTLAIIGVAGGVLRLILAGVPEPEESFLLPVPLRAWFWFLGVLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESGASPAVLRPQARVLAVGAGLLALGAGAG
Ga0318542_1026076913300031668SoilMTPAAGRGAAVLIGPGLLGAGCVVWATAPLIHTGYPNLALFLASLGVAAGALRLALAATPVPDHTYLLTAAMHYWLRFLEILRLVPWEEGAVIAVLWLEVLHPARPWHTAVLGAALIAYLLATHLAESGASPGALRPQVRVLAAGAGLLALGAGGQHPD
Ga0318561_1011560923300031679SoilMTRAVAIKAAAGLLGAGCVVWSVLGPAPVHRGQANLALTLAICGVAGGALRLILAGVPEPEESFLLPVPLRAWFGFLEFLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPAVLRPQARVLAVGAGLLALGAAAVGGGRRTDRRRRPRAALRGPARVTPGL
Ga0318561_1052650523300031679SoilMTGRAWVAVRAAAVLLGTGSVIWAALPPVHRGYAGFALTVAIAGVAGGGLRLALTAVPVPEESYLLSAGLRAWRAFLAAVRLVPWEEGALIAIVWLEVLHPARPWHTAVLGAGLVAYLLVTHLAESDASPATLRPQARVLG
Ga0318561_1064364423300031679SoilMTPAAGRGAAVLIGPGLLGAGCVVWATAPLIHTGYPNLALFLASLGVAAGALRLALAATPVPEHTYLLTAAMHYWLRFLEILRLVPWEEGAVIAVLWLEVLHPARPWHTAVLGAALIAYLLATHLAESGASPGALRPQVRVLAAGAGLLAL
Ga0318574_1025392223300031680SoilMRGAAVLLGAGCVIWAALPPADKGYAGFALTVAIAGVAGGGLRLALSAVPVPEDSYLLSAGLRAWLMFLAVVRLVPWEEGALVAIVWLEVLHPARPWHTAVLGAGLIAYLLVTHLAESDATLATLRPQARVLGVGA
Ga0318572_1042986823300031681SoilMTRSIAIRAAASLLGAGCVVWATAPLVHTGLANLALFLAICGVTGGALRLLLAGVPVPEDSFLLSVPLRAWLGFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPTVLRPQVRV
Ga0318560_1037257213300031682SoilMTRAVAIKAAAGLLGAGCVVWSVLGPAPVHRGQANLALTLAICGVAGGALRLILAGVPEPEESFLLPVPLRAWFGFLEFLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPAVLRP
Ga0310686_10494279523300031708SoilMTRVLAIRAAAVLLGAGCVIWAATPLVHQGVATLALVLAICGIAGGALRRLWAGVPVPEDSFLMPAPLRLCLWFLQTLRRVPWEEGAVVALVWLEVVHSSRPWHTAILGAALIAYLLATHLAESDASPVVLRPQVRVLAVG
Ga0318496_1053516113300031713SoilMTRSIAIRAAASLLGAGCVVWATAPLVHTGLANLALFLAICGVACGALRLILARVAMPEDSFLLSVPLRAWLGFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPTVL
Ga0318496_1054741813300031713SoilMIRRSVAIRAAAVLLGAGSVVWATAPPVHHGPASLALVLAICGVAGGALRLILAGVPVPEDSFLLRPPLRAWLGFLQTLRRVPWEEGAVFAIVWLEALHKSRPWHTAVLGAALIAYLLATHLAESGASPAV
Ga0307476_1065932123300031715Hardwood Forest SoilMTRYWVAIRAAAALLGAGCVIWAAVPLVHQGWANLALVLAIAGVAAGALRLVLAGVPQPEDTFLLPVPVRAWLRFLETLRRVPWEEGAVIALVWLEVLHRSRPWPTAILGAALIAYLLATHLAESDASPGVLRPQVRVLAVGAGLLALGAGAGMLPATGP
Ga0306917_1085434623300031719SoilMTRSIAIRAAASLLGAGCVVWATAPLVHTGLANLALFLAICGVTGGALRLLLAGVPVPEDSFLLSVPLQAWLGFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDAFPGVLRPQVRVLAVGTGLLALGAGAGMLPAAGLVLPY
Ga0318502_1071796223300031747SoilMTRSIAIRAAASLLGAGCVVWATAPLVHTGLANLALFLAICGVACGALRLILARVAMPEDSFLLSVPLRAWLGFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDSSPTALRPQVRVLAVGAGLLA
Ga0318494_1008838313300031751SoilMTRAVAIKAAAGLLGAGCVVWSVLGPAPVHRGQANLALTLAICGVAGGALRLILAGVPEPEESFLLPVPLRAWFGFLEFLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASP
Ga0318494_1045977213300031751SoilMRGAAVLLGAGCVIWAALPPADKGYAGFAVTVAIAGVAGGGLRLALTAVPVPEDSYLLSAGLRAWLTFLAAVRLVPWEEGALVAIVWLEVLHPARPWHTAVLGAGLIAYLLVTHLAESDAGLATLRPQA
Ga0318494_1073596023300031751SoilMTRSIAIRAAAGLLGAGCLVWAAAPLVHRGSANLALTLAIAGVAGGVLRLLLAGVPVPEDSYLLPTPLQAWLWFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPAALRPQVRVLAVGAGLLAL
Ga0318554_1087977813300031765SoilMTRSIAIRAAAGLLGAGSVVWAAAPPVHRGSANLALTLAIAGVAGGVLRLLLAGVPVPEDSYLLPAPLQAWFRFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPAALRPQVRVLAVGAGL
Ga0318509_1061545523300031768SoilMTRSIAIRAAASLLGAGCVVWATAPLVHTGLANLALFLAICGVTGGALRLLLAGVPVPEDSFLLSVPLQAWLGFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPT
Ga0318498_1017455423300031778SoilMIRRSVAIRAAAVLLGAGSVVWATAPPVHHGPASLALVLAICGVAGGALRLILAGVPVPEDSFLLRPPLRAWLGFLQTLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPGVLRPQVRVLAVGAGLLA
Ga0318498_1031951223300031778SoilPMTRAVAIKAAAGLLGAGCVVWSVLGPAPVHRGQANLALTLAICGVAGGALRLILAGVPEPEESFLLPVPLRAWFGFLEFLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPAVLRPQARVLARRCCGWWRPAH
Ga0318547_1018209023300031781SoilMTGRAWVAVRAAAILLGAGSVIWAALPPVHRGYAGFALTVAIAGVAGGGLRLALTAVPVPEESYLLSAGLRAWRAFLAAVRLVPWEEGALIAIVWLEVLHPARPWHTAVLGAGLVAYLLVTHLAESDASPATLRPQARVL
Ga0318552_1042650923300031782SoilMTRTVTIRAAAVLLGAGCVVWAAAPLVHQGQANLALFLAIAGVAGGGLRLILAGVPVPEDSFLLPTPLQAWFRFLEILRRVPWEEGAVLAIVWLEVLHKSRPWHAAVLGAALIAYLLVTHLAESDASPGVLRPQVRVLAVGAGLLALGAGAG
Ga0318557_1038768423300031795SoilMTGRAWVAVRAAAVLLGTGSVIWAALPPVHRGYAGFALTVAIAGVAGGGLRLALTAVPVPEESYLLSAGLRAWRVFLAAVRLVPWEEGALIAIVWLEVLHPARPWHTAVLGAGLVAYLLVTHLAESDASPATLRPQARVLGAGAVLL
Ga0318523_1053915413300031798SoilMTRSIAIRAAASLLGAGCVVWATAPLVHTGLANLALFLAICGVACGALRLILARVAMPEDSFLLSVPLRAWLGFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDSSPT
Ga0318497_1073270023300031805SoilMTRTITIRAAAVLLGAGCVVWATAPLVHRGAANLALILAIAGVAGGGLRLILAGVPVPEDSFLLPTPLQAWFRFLEILRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLVTHLAESDASPGVLRPQVRVLA
Ga0318568_1020263423300031819SoilMTGSLGPVRLGPASIGRFSIGPVDTRAAAIRAAAILLGAGCVVWATVPPVHKGPVNLALILAIGGVAGGALRLFLAGVPVPEDAFLLPAPAQAWFRFLEILRRVPWEEGAVIGLVWLEVLHPSRPWHTAVLGAALVAYLLATHLAESDATI
Ga0318567_1045227723300031821SoilVSGSATGISWITWITARLRGAAGPVAMRAAAVLLGAGSVIWAALPPVHQGYAGFALTVAIAGVVGGGLRLALTAIPVPEESYLLSAGLRAWRTFLALVRQVPWEEGALIAVVWLEVLHPARPWRTAVLGAGLIAYLLVTHLAETDAPLATLRPQAKV
Ga0318567_1058981213300031821SoilMTRRSVAIRAAAVLLGAGSVVWATAPPVHHGPASLALVLAICGVAGGALRLILAGVPVPEDSFLLRPPLRAWLGFLQTLRRVPWEEGAVFAIVWLEALHESRPWHTAVLGATLIAYLLATHLAESGASPAVLRPQVRVLAVGAG
Ga0307478_1101136313300031823Hardwood Forest SoilMTRYWVAIRAAAALLGAGCVIWAAVPLVHQGWANLALVLAIAGVAAGALRLVLAGVPQPEDTFLLPVPVRAWLRFLETLRRVPWEEGAVIALVWLEVLHRSRPWHTAILGAALIAYLLATHLAESDASPGVLRPQVRVLAVGAGLLALGAGAGMLPATGP
Ga0318564_1045728213300031831SoilLHPPAADRLGIAPMTRSLGPVRLGPVVIGPVATRGAAMRAAAILLGVGCVVWATAPPVHKGPVNLTLFLAIGGVAGGALRLILAGVPVPDDAFLLPAPARAWLSFLEVLRRVPWEEGAVIGLVWLEVLHPSRPWHTAVLGAALVAYLLATHLAESDATLGTLRPQVRVLALGAGLLALGAGAGML
Ga0306925_1076010523300031890SoilMTRTVTIRAAAVLLGAGCVVWAAAPLVHQGQANLALFLAIAGVAGGGLRLILAGVPVPEDSFLLPAPLQAWLRFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHAAVLGAALIAYLLVTHLAESDASPGVLRPQVRVLAVGAGLLALGAGAGMLPAAGPGAGS
Ga0306925_1135038513300031890SoilMTRSIAIRAAAGLLGAGCLVWAAAPLVHRGSANLALTLAIAGVAGGVLRLLLAGVPVPEDSYLLPTPLQAWLWFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPGVLRPQVRVLAVGTGLLALGAGAGMLPAAGPGAG
Ga0306925_1172036823300031890SoilMRGAAVLLGAGCVIWAALPPADKGYAGFAVTVAIAGVAGGGLRLALTAVPVPEDSYLLSAGLRAWLTFLAAVRLVPWEEGALVAIVWLEVLHPARPWHTAVLGAGLIAYLLVTHLAESDAGLATLRPQARVLGV
Ga0308175_10019535313300031938SoilMTIGAALLGAGCVVWAAAPTAHKPWAGFALFLAIAGVAAGALRLALMAVPVPEDSFLLPGPLRAWLRFLETLRQVPWEEGAVAGVLWLEVLHPSRPWHTAVLGAALTAYLLATHLAESGSRPGVLRPHAQVLAAGAV
Ga0310912_1030541613300031941SoilMTGTAVRAAAVLLGAGCVIWAALPRVSQGYAGFALTVAIAGVAGGGLRLALTAVPVPEESYLLSAGLRAWRTFLAVVRQVPWEEGALIAIVWLEVMHPARPWHTAVLGAGLIAYLLITHLAESDAALATLRPQARVLGVGAVLLALG
Ga0310912_1049530513300031941SoilMTRSIAIRAAASLLGAGCVVWATAPLVHTGLANLALFLAICGVTGGALRLLLAGVPVPEDSFLLSVPLRAWLGFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDSSPTALRPQVRVLAVGAGLLALGAGAGMLPATGPGAGSALL
Ga0310913_1095221423300031945SoilMIRRSVAIRAAAVLLGAGSVVWATAPPVHHGPASLALVLAICGVAGGALRLILAGVPVPEDSFLLRPPLRAWLGFLQTLRRVPWEEGAVFAIVWLEALHESRPWHTAVLGATLIAYLLATHLAESGASPA
Ga0306926_1058395813300031954SoilMTRTIAIRAAASLLGAGCVVWATAPLVHTGLANLALFLAICGVACGALRLILARVAMPEDSFLLSVPLRAWLGFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDSSPTALRPQVRVL
Ga0306926_1121904023300031954SoilMTRSLGPVRLGPVVIGPVATRGAAMRAAAILLGVGCVVWATAPPVHKGPVNLTLFLAIGGVAGGALRLILAGVPVPDDAFLLPAPARAWLSFLEVLRRVPWEEGAVIGLVWLEVLHPSRPWHTAVLGAALVAYL
Ga0306926_1239896013300031954SoilMTRAVAIKAAAGLLGAGCVVWSVLGPAPVHRGQANLALTLAICGVAGGALRLILAGVPEPEESFLLPVPLRAWFGFLEFLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPAVLR
Ga0318562_1012747713300032008SoilMTRAVAIKAAAGLLGAGCVVWSVLGPAPVHRGQANLALTLAICGVAGGALRLILAGVPEPEESFLLPVPLRAWFGFLEFLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPAVLRPQARVL
Ga0318563_1053445523300032009SoilMTRSIAIRAAASLLGAGCVVWATAPLVHTGLANLALFLAICGVTGGALRLLLAGVPVPEDSFLLSVPLRAWLGFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPTVLRPQVRVLAAGAG
Ga0318569_1060142113300032010SoilMTRSLGPVRLGPVVIGPVATRGAAMRAAAILLGVGCVVWATAPPVHKGPVNLTLFLAIGGVAGGALRLILAGVPVPDDAFLLPAPARAWLSFLEVLRRVPWEEGAVIGLVWLEVLHPSRPWHTAVLGAALVAYLLATHLAESDATLG
Ga0318559_1041672123300032039SoilMTRSIAIRAAASLLGAGCVVWATAPLVHTGLANLALFLAICGVACGALRLILARVAMPEDSFLLSVPLRAWLGFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDSSPTALRPQV
Ga0318559_1048468423300032039SoilMTGRAWVAVRAAAVLLGAGSVIWAALPPVHQGYAGFALTVAIAGVAGGGLRLALTAIPVPEESYLLSAGLRAWRTFLALVRQVPWEEGALIAVVWLEVLHPARPWRTAVLGAGLIAYLLVTHLAETDAPLATLRPQAKVLG
Ga0318558_1039032923300032044SoilMTRAVAIKAAAGLLGAGCVVWSVLGPAPVHRGQANLALTLAICGVAGGALRLILAGVPEPEESFLLPVPLRAWFGFLEFLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPAVLRPQARVLAVGAGLLALGAAAGMLPPA
Ga0318513_1067555113300032065SoilMTGRAWVAVRAAAVLLGTGSVIWAALPPVHRGYAGFALTVAIAGVAGGGLRLALTAVPVPEESYLLSAGLRAWRVFLAAVRLVPWEEGALIAIVWLEVLHPARPWHTAVLGAGLVAYLLVTHLAESDTSPATLRPQARVLGA
Ga0318514_1038673613300032066SoilMTGSLGPVRLGPASIGRFSIGPVDTRAAAIRAAAILLGAGCVVWATVPPVHKGPVNLALILAIGGVAGGALRLFLAGVPVPEDAFLLPAPAQAWFRFLEILRRVPWEEGAVIGLVWLEVLHPSRPWHTAVLGAALVAYLLATHLAESDATIGTLRPQVRVLALGAGLLALGAGAGMLPAT
Ga0318514_1038757613300032066SoilVVHTGLANLALFLAICGVTGGALRLLLAGVPVPEDSFLLSVPLRAWLGFLETLRRVPWEEGAVLAIVWLEVLHKSRPWHTAVLGAALIAYLLATHLAESDASPTVLRPQVRVLAAGAGLLALGAGAGM
Ga0335074_1112780223300032895SoilMTRPVAIRAAAILLGAGCVIWAAAPLVHKGLAAWALVLACCGVAGGALRLILGRVPVPHDTFLLPAPVRAWLRFLETLRRVPWEEGAVVAIVWLEVLHSSRPWHTAFLGAALIAYLLATHLAESGASPGILRPQ
Ga0335075_1011874113300032896SoilMTRTVSRPVTGWANQAAADLLGAGCVVWATVPLLAHKGLATLALVLAVCGVAGGALRLVLAGVPVPEDSFLLPPPLRAWLSFLQTLRRVPWEEGAVIAVVWLEVLHASRPRHTAILGAALIAYLLATH
Ga0335075_1031596623300032896SoilMTRPVATRAAAALLGAGCVIWAAAPLVHQGLANLALVLAILGVTGGVLRLLLAGVPVPDDTFLLPAPLRAWLRFLETLRLVPWEEGAVIAIVWLEVLHSSRPWPTAVLGAALIAYLLATHLAESGASPGALRPQVR
Ga0370514_050948_2_4903300034199Untreated Peat SoilMTGRAGFGTRARRTGAAHGPTNLIGAALLGAGCLVWAATPPTHQGWTGFALFVAIVAVVAGVLRLVLADVPVPEDNYLLPVPLRAGLRFLEILRQVPWEDCALVAILWLEVLHSARPWHTALLGAGLIAYLLTTHLAESGASFGALSPQVRVLAIGAGLLALG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.