Metagenome Family F080808

Overview

Basic Information

• Family ID: F080808
• Family Type: Metagenome
• Number of Sequences: 114
• Average Sequence Length: 40 residues
• Representative Sequence: FCGTHSSMLEAKSVHDPKIKVVPYVKHYNFALVNSSMQGL
• Number of Associated Samples: 65
• Number of Associated Scaffolds: 114

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 1.79 %
• % of genes near scaffold ends (potentially truncated): 93.86 %
• % of genes from short scaffolds (< 2000 bps): 98.25 %
• Associated GOLD sequencing projects: 62
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (99.123 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (84.210 % of family members)
• Environment Ontology (ENVO): Unclassified (86.842 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (85.965 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 0.00%
  β-sheet: 0.00%
  Coil/Unstructured: 100.00%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
All Organisms	root	All Organisms	0.88 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
cellular organisms	root	All Organisms → cellular organisms	0.88 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.88 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.88 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.88 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.88 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.88 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.88 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.88 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.88 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.88 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.88 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	0.88 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	0.88 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	0.88 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	0.88 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.88 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005459|Ga0068867_100653776	Not Available	923
3300005459|Ga0068867_101624700	Not Available	604
3300005459|Ga0068867_102344378	Not Available	507
3300005718|Ga0068866_10813501	Not Available	650
3300009148|Ga0105243_11162471	Not Available	783
3300013297|Ga0157378_11544889	Not Available	709
3300013297|Ga0157378_12552301	Not Available	563
3300014745|Ga0157377_11466420	Not Available	541
3300014969|Ga0157376_11396334	Not Available	732
3300014969|Ga0157376_12487175	Not Available	557
3300015268|Ga0182154_1033175	Not Available	629
3300015268|Ga0182154_1062257	Not Available	528
3300015269|Ga0182113_1054985	Not Available	600
3300015269|Ga0182113_1087363	Not Available	520
3300015274|Ga0182188_1036501	Not Available	580
3300015275|Ga0182172_1026176	Not Available	682
3300015275|Ga0182172_1039641	Not Available	610
3300015276|Ga0182170_1027927	Not Available	673
3300015276|Ga0182170_1061152	Not Available	540
3300015276|Ga0182170_1061685	Not Available	539
3300015276|Ga0182170_1062886	Not Available	536
3300015277|Ga0182128_1009545	Not Available	903
3300015277|Ga0182128_1060572	Not Available	545
3300015279|Ga0182174_1036158	Not Available	649
3300015281|Ga0182160_1023614	Not Available	719
3300015281|Ga0182160_1049503	Not Available	588
3300015285|Ga0182186_1036579	Not Available	639
3300015285|Ga0182186_1053507	Not Available	574
3300015287|Ga0182171_1069152	Not Available	542
3300015288|Ga0182173_1067990	Not Available	540
3300015289|Ga0182138_1029819	Not Available	689
3300015289|Ga0182138_1047815	Not Available	605
3300015289|Ga0182138_1090403	Not Available	500
3300015291|Ga0182125_1056076	Not Available	589
3300015292|Ga0182141_1079295	Not Available	530
3300015294|Ga0182126_1057855	Not Available	586
3300015295|Ga0182175_1078339	Not Available	540
3300015296|Ga0182157_1100898	Not Available	506
3300015298|Ga0182106_1059329	Not Available	596
3300015298|Ga0182106_1098003	Not Available	510
3300015299|Ga0182107_1074230	Not Available	560
3300015299|Ga0182107_1076045	Not Available	555
3300015299|Ga0182107_1099474	Not Available	510
3300015302|Ga0182143_1014212	Not Available	894
3300015303|Ga0182123_1088737	Not Available	519
3300015304|Ga0182112_1070944	Not Available	569
3300015305|Ga0182158_1053361	Not Available	616
3300015305|Ga0182158_1101296	Not Available	507
3300015307|Ga0182144_1099823	Not Available	516
3300015307|Ga0182144_1102797	Not Available	511
3300015308|Ga0182142_1049825	Not Available	650
3300015321|Ga0182127_1076396	Not Available	589
3300015322|Ga0182110_1071678	Not Available	599
3300015341|Ga0182187_1150512	Not Available	559
3300015341|Ga0182187_1179444	Not Available	523
3300015342|Ga0182109_1109934	Not Available	657
3300015343|Ga0182155_1196226	Not Available	529
3300015344|Ga0182189_1138494	Not Available	609
3300015346|Ga0182139_1107497	Not Available	690
3300015346|Ga0182139_1201757	Not Available	543
3300015346|Ga0182139_1229730	Not Available	516
3300015355|Ga0182159_1278110	Not Available	557
3300015361|Ga0182145_1106392	Not Available	616
3300015361|Ga0182145_1110806	Not Available	607
3300015361|Ga0182145_1140497	Not Available	561
3300015361|Ga0182145_1166777	Not Available	529
3300017404|Ga0182203_1073409	Not Available	653
3300017404|Ga0182203_1076578	Not Available	644
3300017404|Ga0182203_1091698	Not Available	609
3300017404|Ga0182203_1122442	Not Available	554
3300017407|Ga0182220_1048467	Not Available	631
3300017409|Ga0182204_1029326	Not Available	765
3300017409|Ga0182204_1054053	Not Available	640
3300017410|Ga0182207_1127612	Not Available	562
3300017410|Ga0182207_1157116	Not Available	523
3300017411|Ga0182208_1055425	Not Available	654
3300017411|Ga0182208_1068227	Not Available	615
3300017413|Ga0182222_1102772	Not Available	509
3300017415|Ga0182202_1054333	Not Available	679
3300017420|Ga0182228_1048689	Not Available	721
3300017424|Ga0182219_1048372	Not Available	699
3300017424|Ga0182219_1109072	Not Available	545
3300017424|Ga0182219_1127790	Not Available	518
3300017425|Ga0182224_1098862	Not Available	595
3300017425|Ga0182224_1117761	Not Available	562
3300017430|Ga0182192_1174563	Not Available	500
3300017433|Ga0182206_1085741	Not Available	613
3300017433|Ga0182206_1151506	Not Available	510
3300017438|Ga0182191_1107787	Not Available	602
3300017438|Ga0182191_1116222	Not Available	587
3300017443|Ga0182193_1119837	Not Available	598
3300017680|Ga0182233_1017683	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1284
3300017680|Ga0182233_1076973	Not Available	603
3300017680|Ga0182233_1105592	Not Available	524
3300017684|Ga0182225_1102933	Not Available	559
3300017686|Ga0182205_1148572	Not Available	528
3300017686|Ga0182205_1164194	Not Available	510
3300017689|Ga0182231_1060361	Not Available	715
3300017689|Ga0182231_1067875	Not Available	674
3300017689|Ga0182231_1086124	Not Available	601
3300017690|Ga0182223_1056036	Not Available	628
3300017690|Ga0182223_1066449	Not Available	599
3300017690|Ga0182223_1103184	Not Available	530
3300017690|Ga0182223_1103695	Not Available	529
3300021060|Ga0182232_1058051	Not Available	637
3300021060|Ga0182232_1058719	Not Available	633
3300025899|Ga0207642_10898424	Not Available	567
3300025901|Ga0207688_10574279	Not Available	710
3300025935|Ga0207709_10927407	Not Available	709
3300026023|Ga0207677_11610271	Not Available	601
3300026023|Ga0207677_12118220	Not Available	523
3300026089|Ga0207648_10367965	Not Available	1298

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	85.96%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.89%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.14%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	85.96%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.89%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.14%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	85.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.89%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.14%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	84.21%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	7.02%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	4.39%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.75%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	1.75%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.88%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068867_1006537762	3300005459	Miscanthus Rhizosphere	LDFADFCGTYSSILEAKSVNDPKIKVVPYVKHYNFDLVNS
Ga0068867_1016247001	3300005459	Miscanthus Rhizosphere	*KADFCESISSMLEAKSVNDPKIKVVPYTKYYNFALVTTSMQGL*
Ga0068867_1023443782	3300005459	Miscanthus Rhizosphere	FCGTHSSMLEAKSVHDPKIKVVPYVKHYNFALVNSSMQGL*
Ga0068866_108135012	3300005718	Miscanthus Rhizosphere	DSCDPNSSMLGAKSVNDPKIKVVPHLTYYNFALVTTYMQSL*
Ga0105243_111624711	3300009148	Miscanthus Rhizosphere	SMLEAKSVHDIKIKVVPNVKHYNFALVNPSMQGL*
Ga0157378_115448891	3300013297	Miscanthus Rhizosphere	FDDSCDPISNMLGAESFNDPKIKVVPYSTYYNFALVTTSMQGL*
Ga0157378_125523011	3300013297	Miscanthus Rhizosphere	*KLGFAGFCGTHLSMLEAESVHDPKIKVVPYVKHYNFALVNSSMQGL*
Ga0157377_114664201	3300014745	Miscanthus Rhizosphere	IDDSCEPNSSMLGAKLVYAPNIKVVPYTKYYNFALVISMQGL*
Ga0157376_113963342	3300014969	Miscanthus Rhizosphere	DFSDFCGTYSSMLGAKSVYDLKIKVVPYVKHYNFALVNSSMQGL*
Ga0157376_124871751	3300014969	Miscanthus Rhizosphere	SMLEAKSVHDLKIKVVPYVKHYNFALVISSMQGL*
Ga0182154_10331751	3300015268	Miscanthus Phyllosphere	SMLGAESINDPKIKVVPYVKHYNFDLVNSSMQGL*
Ga0182154_10622571	3300015268	Miscanthus Phyllosphere	HSSMLEAKSVHDLKIKVVPYVKHYNFALVISSMQGL*
Ga0182113_10549851	3300015269	Miscanthus Phyllosphere	LDFADFCGTYSSILEAKSVNDPKIKVVPYVKHYNFDLVNSSMQGL
Ga0182113_10873631	3300015269	Miscanthus Phyllosphere	DDSCDPISNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGL*
Ga0182188_10365011	3300015274	Miscanthus Phyllosphere	ISNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGS*
Ga0182172_10261761	3300015275	Miscanthus Phyllosphere	LDFADFCGTYSSILEAKSVNDPKIKVVPYVKHYNFDLVNSSMQG
Ga0182172_10396411	3300015275	Miscanthus Phyllosphere	DFAGFCGTHSSMLEAKSVHVIKIKVVPYVKHYNFALVNSSMQGP*
Ga0182170_10279271	3300015276	Miscanthus Phyllosphere	PISHMLGAKSVKDPKIKVVPYVKHYNFALMNSSMQGL*
Ga0182170_10611521	3300015276	Miscanthus Phyllosphere	SNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGL*
Ga0182170_10616851	3300015276	Miscanthus Phyllosphere	LDFADFCGTYSSILEAKSVNDPKIKVVPYVKHYNFDLVNSS
Ga0182170_10628861	3300015276	Miscanthus Phyllosphere	DPISHMLGAESVKDPKIKVVPYVKHYNIALVNSSMQGL*
Ga0182128_10095451	3300015277	Miscanthus Phyllosphere	MDFADFCGTYSSMLEAKSVNDPNIKVVPYTKYYNFALVISSMQGL*
Ga0182128_10605721	3300015277	Miscanthus Phyllosphere	NSHMLGAESVKGPKIKVVPYVKHYNIALVNSSMQGP*
Ga0182174_10361581	3300015279	Miscanthus Phyllosphere	VGFADSCDPNSSMLGAKSVSNPKIKVVPLAKHYNFALVTTSMQGL*
Ga0182160_10236142	3300015281	Miscanthus Phyllosphere	PNSSMIGAESVKGPNIKVVPYVKHYNIVLVNSSMQGP*
Ga0182160_10495032	3300015281	Miscanthus Phyllosphere	SSMLEAKSVNDPKIKVVPYVKHYNFDLVNSSMQGL*
Ga0182186_10365791	3300015285	Miscanthus Phyllosphere	PDFCGTYSSMLEAKSVNDPKIKVVPYTKYYNFALVISSMQGL*
Ga0182186_10535071	3300015285	Miscanthus Phyllosphere	MLGAESVKDPKIKVVPYVKHYNIALVNSSMQGLEHL
Ga0182171_10691521	3300015287	Miscanthus Phyllosphere	ISNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGL*
Ga0182173_10679901	3300015288	Miscanthus Phyllosphere	SMLEAKSVKDPKIKVVPHAKHYNFALVTSSMQGL*
Ga0182138_10298192	3300015289	Miscanthus Phyllosphere	MLIFSDSCDANSSMLEAKSVNDPKIKVVPYVKYYNFALVISSMQGL*
Ga0182138_10478152	3300015289	Miscanthus Phyllosphere	MESCEPISSMLGAKLVYDPKIKVVPLIKYYNFALVTTSMQGL
Ga0182138_10904032	3300015289	Miscanthus Phyllosphere	EIFVKS*NADFPDFCGTYSSMLEAKSVNDPKIKVVPYVKHYNFDLVNSSMQGL*
Ga0182125_10560761	3300015291	Miscanthus Phyllosphere	PISNMLGAESVKDPKIKVVPYVKHYNIALVNSSMQGL*
Ga0182141_10792951	3300015292	Miscanthus Phyllosphere	NMLGAKSVNDPKIKVVPYVKHYNFALVNSSMQGL*
Ga0182126_10578551	3300015294	Miscanthus Phyllosphere	MLIFADSCETNSSMLEAKSVNDPKIKVVPYVKYYNFALVISSMQGL*
Ga0182175_10783392	3300015295	Miscanthus Phyllosphere	HMLGAESVKDPKIKVVPYVKHYNIALVNSSMQGL*
Ga0182157_11008981	3300015296	Miscanthus Phyllosphere	*NSNSHMLGAESVKDPKIKVVPYVKHYNFALVNSSMQGP*
Ga0182106_10486931	3300015298	Miscanthus Phyllosphere	VGFADSCELISSMLGAKPVNDPKIKVVPHVKHYNFALVISSMQGL*
Ga0182106_10593291	3300015298	Miscanthus Phyllosphere	PISHMLGAESVKDPKIKVVPYVKHYNIALVNSSMQGL*
Ga0182106_10980031	3300015298	Miscanthus Phyllosphere	SNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGS*
Ga0182107_10742301	3300015299	Miscanthus Phyllosphere	SMLEGKSVNDPKIKVVAYTKYYNFALVTTSMQGP*
Ga0182107_10760451	3300015299	Miscanthus Phyllosphere	VLNLGFADFCGTNSSRLEAKSVNDLKIKVVPYVKHYNFALV
Ga0182107_10994741	3300015299	Miscanthus Phyllosphere	DF*NPNSHMLGAESVKGPKIKVVPYVKHYNIDLVNSSMQGP*
Ga0182143_10142121	3300015302	Miscanthus Phyllosphere	MLIFADSCETNSSMLEAKSVNDPKIKVVPYIKYYNFALVTTSMQGL
Ga0182123_10887371	3300015303	Miscanthus Phyllosphere	SMLGAESVNDPKIKVVPYVKHYNFALVNSSMQGL*
Ga0182112_10709441	3300015304	Miscanthus Phyllosphere	HSSMLEAESVHDPKIKVVPYVKHSNFALVNSSMQGS*
Ga0182158_10533611	3300015305	Miscanthus Phyllosphere	CGTHSSMLEAKSASDQKIKVVPYVKHYNFALVISSMEGL*
Ga0182158_11012961	3300015305	Miscanthus Phyllosphere	KCLKQWKADFCEPISSMLGAKLVYDPKIKVVPLVKYYNIALVTTSMQGL*
Ga0182144_10998231	3300015307	Miscanthus Phyllosphere	SMLEAKSVNDPKIKVVPYVKHYNFDLVNSSMQGL*
Ga0182144_11027971	3300015307	Miscanthus Phyllosphere	VLNLGFADFCGTNSNMLEAKSVHDLKIKVVPYVKHYNF
Ga0182142_10498251	3300015308	Miscanthus Phyllosphere	ADFCGTHSSMLEAKSVNDLEIKVVPYVKHYNFALVNSSMQGL*
Ga0182127_10763961	3300015321	Miscanthus Phyllosphere	EFFVKS*NADFPDFCGTYSSMLEAKSVNDPKIKVVPYVKHYNFDLVNSSMQGL*
Ga0182110_10716781	3300015322	Miscanthus Phyllosphere	DFCEPNSSMLGAKPVNDPKIKVVPLAKYYNFALVTTSMQGL*
Ga0182187_11505121	3300015341	Miscanthus Phyllosphere	FADFCGTYSSMLEAKSVNDPKIKVVPYTKYYNFALVISSIQGL*
Ga0182187_11794441	3300015341	Miscanthus Phyllosphere	HMLGAESVKGPKIKVVPYVKHYNIALVNSSMQGP*
Ga0182109_11099342	3300015342	Miscanthus Phyllosphere	HSSMLEAKSVHDLKIKVVPYVKHYNFALVISSMQGH*
Ga0182155_11962262	3300015343	Miscanthus Phyllosphere	VLNLGFADFCGTNSSMLEAKSVNGPKIKVVPYVKHYNFALVISSMQGF*
Ga0182189_11384941	3300015344	Miscanthus Phyllosphere	SSMLEAKLVNDPKIKVVPYVKYYNFALVISSMQGL*
Ga0182139_11074972	3300015346	Miscanthus Phyllosphere	GFAGFCGTHSSMLEAKSVHDPKIKVVPYVKHYNFDLVNSSMQGL*
Ga0182139_12017571	3300015346	Miscanthus Phyllosphere	VLNLGFADFCGTNSNMLEAKSVHDLKIKVVPYVKHYNFALVISSM
Ga0182139_12297302	3300015346	Miscanthus Phyllosphere	DDSCEPNSSMLGAKPVNDPKIKVVPLAKYYNFVLVTTSMQGL*
Ga0182159_12781101	3300015355	Miscanthus Phyllosphere	SMLEAKSVHDLKIKVVPYVKHYNFALVNSSMQGL*
Ga0182145_11063921	3300015361	Miscanthus Phyllosphere	QDFDDSCDPISNMLGAESVKDPKIKVVPYVKHYNIALVNSSTQGL*
Ga0182145_11108062	3300015361	Miscanthus Phyllosphere	*NPNSHMLGAESINDPKIKVVPYVKHYNFDLLNSSMQGL*
Ga0182145_11404971	3300015361	Miscanthus Phyllosphere	VGSCGPISSILGAKLVYDPKIKVVPLAKYYNFALVTTCM
Ga0182145_11667771	3300015361	Miscanthus Phyllosphere	FCGTYSSMLEAKSVNDPKIKVVPYTKYYNFALVISSMQGL*
Ga0182203_10734091	3300017404	Miscanthus Phyllosphere	XKQXKADFCESISSMLEAKSVNDPKIKVVPYTKYYNFALVTTSMQGL
Ga0182203_10765781	3300017404	Miscanthus Phyllosphere	LDFADFCGTYSSMLEAKSVNDPKIKVVPYVKHYNIALVISSMQGL
Ga0182203_10916981	3300017404	Miscanthus Phyllosphere	GFADFCEPKSNMLVAKPANDPKIKVVPHIKYYNFALVTTSMQGL
Ga0182203_11224421	3300017404	Miscanthus Phyllosphere	DDSCDPISNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGL
Ga0182220_10484671	3300017407	Miscanthus Phyllosphere	NSHMLGADSVKDPKIKVVPYVKHYNIALVNSSMQGL
Ga0182204_10293261	3300017409	Miscanthus Phyllosphere	KQGIDDSCEPNSSMLGAKPVYDPKIKVVPLAKYYNFALVTTSMQGL
Ga0182204_10540531	3300017409	Miscanthus Phyllosphere	DFAGFCGTHSSMLEAKSVHDPKIKVVPYVKHYNFDLVNSSMQGL
Ga0182207_11276121	3300017410	Miscanthus Phyllosphere	ISNMLGAESVKDPKIKVVPYVKHYNIALVNSSMQGL
Ga0182207_11571161	3300017410	Miscanthus Phyllosphere	FDDFXNPNSSMLGAESINDPKIKVVPYTKHYNIALVNSSMQGL
Ga0182208_10554252	3300017411	Miscanthus Phyllosphere	XNVDFADSCETNSSMLEAKSVNDPKIKVVPSVKYYNFALVISSMQGL
Ga0182208_10682271	3300017411	Miscanthus Phyllosphere	SSMLEAKSVNDPKIKFVPYSKYYNFSLVTTSMQGL
Ga0182222_11027721	3300017413	Miscanthus Phyllosphere	SSMLEAKSVNDPKIKVIPYVKHYNFALVISSMQGL
Ga0182202_10543332	3300017415	Miscanthus Phyllosphere	LDFADFCGTHSSMLEAKSVHDPKIKVVPYVKHYNFDLLNSSMQGL
Ga0182202_11353571	3300017415	Miscanthus Phyllosphere	NNLEIFVKSXNADFPDFCGTYSSMLEAKSVNDPKIKVVPYVKHYNFDLVNSSMQGL
Ga0182228_10486891	3300017420	Miscanthus Phyllosphere	XKLDFAGFCGTHSSMLEAKSVHDLKIKVVPYVKHYNFALVISSMQGL
Ga0182219_10483722	3300017424	Miscanthus Phyllosphere	KAGFAGFCGTHSSMLEAKSVHVIKIKVVPYVKHYNFALVNSSMQGP
Ga0182219_11090721	3300017424	Miscanthus Phyllosphere	DPISNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGL
Ga0182219_11277901	3300017424	Miscanthus Phyllosphere	LDFADFCGTYSSILEAKSVNDPKIKVVPYVKHYNFDLVNSSM
Ga0182224_10988621	3300017425	Miscanthus Phyllosphere	THSSMLEAKSVHVIKIKVVPYVKHYNFALVNSSMQGP
Ga0182224_11177611	3300017425	Miscanthus Phyllosphere	DFADFCGTYSSMLEAKSVNDPKIKVVPYTKYYNFALVISSMQGL
Ga0182192_11745631	3300017430	Miscanthus Phyllosphere	DFADFCGTHSSMLEAKSVHDPKIKVVPYVKHYNFDLVNSSMQGL
Ga0182206_10857411	3300017433	Miscanthus Phyllosphere	LDFADFCGTYSSMLEAKSVNDPKIKVVPYTKYYNFALVISSMQGL
Ga0182206_11515061	3300017433	Miscanthus Phyllosphere	SNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGL
Ga0182191_11077872	3300017438	Miscanthus Phyllosphere	DSCDPNSSMLGAKSVNDPKIKVVPYSKYYNFALVSSSMQGL
Ga0182191_11162222	3300017438	Miscanthus Phyllosphere	XNPNSHMLGAESVKGPKIKVVPYVKHYNIALVNSSMQGP
Ga0182193_11198371	3300017443	Miscanthus Phyllosphere	CEPNSSMLGAKPVNDPKIKVVPLAKYYNFDLVTTSMQGL
Ga0182233_10176832	3300017680	Miscanthus Phyllosphere	GTHSSMLEAKSVHDLKIKVVPYVKHYNFALVISSMQGL
Ga0182233_10769731	3300017680	Miscanthus Phyllosphere	PISHMLGAESVNDPKIKVVPYVKHYNIALVISSMQGL
Ga0182233_11055921	3300017680	Miscanthus Phyllosphere	MLIFPDFCGTYSSMLEAKSVNNQKIKVVPYVKHYNFDLVNSSMQGL
Ga0182225_11029331	3300017684	Miscanthus Phyllosphere	CKADFCEPISSMLGAKLVYDPKIKVFTLIQYYNFALVTTSVQGL
Ga0182205_11485721	3300017686	Miscanthus Phyllosphere	DSCDPISNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGL
Ga0182205_11641941	3300017686	Miscanthus Phyllosphere	PNSSMLEAKSVHDIKIKVVPNVKHYNFALVNPSMQGL
Ga0182231_10603611	3300017689	Miscanthus Phyllosphere	GTHSSMLEAKSVHDPKIKVVPYVKHYNFDLLNSSMQGL
Ga0182231_10678752	3300017689	Miscanthus Phyllosphere	SSMLGAKPVNDPKIKVVHYIKYYNFALVTTSMQGL
Ga0182231_10861241	3300017689	Miscanthus Phyllosphere	XKQXKADFCESNSNMLEAKSVHDIKIKVVPYVKHYNFALVNSSMQGL
Ga0182223_10560361	3300017690	Miscanthus Phyllosphere	CKAYFCEPISSMLGAELAYDPKIEVVPLMKYYNFALVTTSMQSF
Ga0182223_10664491	3300017690	Miscanthus Phyllosphere	GTYSSMLEAKSVNDPKIKVVPYVKHYNIALVSSSMQGP
Ga0182223_11031841	3300017690	Miscanthus Phyllosphere	PNSSMIGAESVKGPNIKVVPYVKHYNIVLVNSSMQGP
Ga0182223_11036951	3300017690	Miscanthus Phyllosphere	SSMLGAESVSDPKIKVVPYVKHYNFALVSSSMQGL
Ga0182232_10580511	3300021060	Phyllosphere	SCDTNSSMLEAKSVNDPKIKVVPYVKYYNFALVISSMQGL
Ga0182232_10587192	3300021060	Phyllosphere	FCNSNSSMLEAKSVNDSKIKVVPYVKHYNFALVISSMQGL
Ga0207642_108984242	3300025899	Miscanthus Rhizosphere	MLEAKSVNDPKIKVVPYTKYYNIALVNSSMQGLQHLVP
Ga0207688_105742792	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	PNPHMLGAKSVKDPKIKVVPYVKHYNIALVIFSMQGL
Ga0207709_109274071	3300025935	Miscanthus Rhizosphere	TNSSMLEAKSVDDPKIKVVPYVKYYNFALVISSMQGL
Ga0207677_116102711	3300026023	Miscanthus Rhizosphere	PISNMLGAESVKDPKIKVVPYVKHYNIALVNSSMQGL
Ga0207677_121182201	3300026023	Miscanthus Rhizosphere	GFCGTHSSMLEAETVHDPKIKVVPYVKHSNFALVNSSMQGP
Ga0207648_103679651	3300026089	Miscanthus Rhizosphere	SCEPKSSMLGAKPVNDPKIKVVPLAEYYNFVLVTTSMQGI