NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F080789

Metagenome Family F080789

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080789
Family Type Metagenome
Number of Sequences 114
Average Sequence Length 139 residues
Representative Sequence KINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDPIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFHTFGVACQTIAAASRLIDLMPGNDQWIISR
Number of Associated Samples 79
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.88 %
% of genes near scaffold ends (potentially truncated) 94.74 %
% of genes from short scaffolds (< 2000 bps) 94.74 %
Associated GOLD sequencing projects 73
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(28.070 % of family members)
Environment Ontology (ENVO) Unclassified
(76.316 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(62.281 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.40%    β-sheet: 0.00%    Coil/Unstructured: 59.60%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF14460Prok-E2_D 35.09
PF00899ThiF 5.26
PF13701DDE_Tnp_1_4 3.51
PF00480ROK 0.88
PF13358DDE_3 0.88
PF00589Phage_integrase 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009518|Ga0116128_1190467All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300009519|Ga0116108_1176561All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300009519|Ga0116108_1209147All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus572Open in IMG/M
3300009616|Ga0116111_1156987All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus537Open in IMG/M
3300009617|Ga0116123_1107722All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium738Open in IMG/M
3300009618|Ga0116127_1066490All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus999Open in IMG/M
3300009629|Ga0116119_1023989All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1665Open in IMG/M
3300009631|Ga0116115_1132489All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300009636|Ga0116112_1075563All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus964Open in IMG/M
3300009636|Ga0116112_1132915All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus695Open in IMG/M
3300009640|Ga0116126_1174178All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium706Open in IMG/M
3300009640|Ga0116126_1217794All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus608Open in IMG/M
3300009641|Ga0116120_1175783All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300009645|Ga0116106_1164123All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium709Open in IMG/M
3300009646|Ga0116132_1147938All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300009646|Ga0116132_1239483All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus551Open in IMG/M
3300009665|Ga0116135_1156388All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus854Open in IMG/M
3300009839|Ga0116223_10697633All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300010341|Ga0074045_10267731All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1126Open in IMG/M
3300010341|Ga0074045_11072544All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus503Open in IMG/M
3300010379|Ga0136449_101964665All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus866Open in IMG/M
3300010379|Ga0136449_102875714All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium677Open in IMG/M
3300010379|Ga0136449_103169042All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300010379|Ga0136449_104014990All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus549Open in IMG/M
3300010379|Ga0136449_104664059All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300012210|Ga0137378_11178539All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium682Open in IMG/M
3300014152|Ga0181533_1130833All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1057Open in IMG/M
3300014153|Ga0181527_1281210All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300014155|Ga0181524_10120222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1419Open in IMG/M
3300014155|Ga0181524_10225795All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus896Open in IMG/M
3300014155|Ga0181524_10280074All Organisms → cellular organisms → Bacteria → Acidobacteria769Open in IMG/M
3300014155|Ga0181524_10460350All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus545Open in IMG/M
3300014158|Ga0181521_10422645All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium652Open in IMG/M
3300014159|Ga0181530_10215763All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1047Open in IMG/M
3300014159|Ga0181530_10665158All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus505Open in IMG/M
3300014164|Ga0181532_10410107All Organisms → cellular organisms → Bacteria → Acidobacteria751Open in IMG/M
3300014165|Ga0181523_10739291All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300014200|Ga0181526_11026286All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300014201|Ga0181537_10942814All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus584Open in IMG/M
3300014491|Ga0182014_10366932All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300014492|Ga0182013_10430678All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium701Open in IMG/M
3300014496|Ga0182011_10104487All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1974Open in IMG/M
3300014496|Ga0182011_10564979All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300014501|Ga0182024_10145798All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus3337Open in IMG/M
3300014502|Ga0182021_12715092All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300014638|Ga0181536_10245123All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300014655|Ga0181516_10663838All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus539Open in IMG/M
3300014838|Ga0182030_10678429All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus972Open in IMG/M
3300014839|Ga0182027_10585815All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1202Open in IMG/M
3300017822|Ga0187802_10434053All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300017929|Ga0187849_1158144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus909Open in IMG/M
3300017929|Ga0187849_1366652All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300017940|Ga0187853_10331089All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium683Open in IMG/M
3300017940|Ga0187853_10366509All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300017942|Ga0187808_10218205All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus850Open in IMG/M
3300017955|Ga0187817_10323421All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus983Open in IMG/M
3300017955|Ga0187817_10433989All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus838Open in IMG/M
3300017988|Ga0181520_10530127All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus828Open in IMG/M
3300018002|Ga0187868_1070416All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1427Open in IMG/M
3300018002|Ga0187868_1105931All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1079Open in IMG/M
3300018003|Ga0187876_1090779All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1152Open in IMG/M
3300018013|Ga0187873_1014256All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus4425Open in IMG/M
3300018014|Ga0187860_1286928All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300018018|Ga0187886_1265657All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300018019|Ga0187874_10181539All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus880Open in IMG/M
3300018020|Ga0187861_10173463All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus980Open in IMG/M
3300018021|Ga0187882_1175249All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus857Open in IMG/M
3300018022|Ga0187864_10378317All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300018023|Ga0187889_10483491All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300018024|Ga0187881_10476937All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus508Open in IMG/M
3300018025|Ga0187885_10381417All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus633Open in IMG/M
3300018030|Ga0187869_10358421All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium698Open in IMG/M
3300018033|Ga0187867_10057650All Organisms → cellular organisms → Bacteria → Acidobacteria2318Open in IMG/M
3300018033|Ga0187867_10195562All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300018033|Ga0187867_10414246All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus746Open in IMG/M
3300018033|Ga0187867_10720976All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300018034|Ga0187863_10694269All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300018035|Ga0187875_10264603All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300018035|Ga0187875_10697787All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300018038|Ga0187855_10390604All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300018042|Ga0187871_10319668All Organisms → cellular organisms → Bacteria → Acidobacteria858Open in IMG/M
3300018042|Ga0187871_10553542All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300018044|Ga0187890_10894087All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300018057|Ga0187858_10381719All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus878Open in IMG/M
3300019082|Ga0187852_1197740All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus831Open in IMG/M
3300019082|Ga0187852_1220748All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus776Open in IMG/M
3300023090|Ga0224558_1158830All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia718Open in IMG/M
3300023090|Ga0224558_1185995All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus637Open in IMG/M
3300023101|Ga0224557_1145130All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300025419|Ga0208036_1024562All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1185Open in IMG/M
3300025441|Ga0208456_1027774All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1176Open in IMG/M
3300025446|Ga0208038_1044028All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus889Open in IMG/M
3300025459|Ga0208689_1091498All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300025480|Ga0208688_1094201All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia582Open in IMG/M
3300025576|Ga0208820_1147740All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300027854|Ga0209517_10391745All Organisms → cellular organisms → Bacteria → Acidobacteria783Open in IMG/M
3300029817|Ga0247275_1100973All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus763Open in IMG/M
3300031524|Ga0302320_11080494All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus839Open in IMG/M
3300031524|Ga0302320_11947018All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300031672|Ga0307373_10067033All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus3449Open in IMG/M
3300032160|Ga0311301_11050069All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1069Open in IMG/M
3300032160|Ga0311301_12193082All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300032160|Ga0311301_13027650All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300032897|Ga0335071_11175063All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium713Open in IMG/M
3300033402|Ga0326728_10169216All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus2300Open in IMG/M
3300033402|Ga0326728_10226635All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1826Open in IMG/M
3300033402|Ga0326728_10357072All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1282Open in IMG/M
3300033402|Ga0326728_10406587All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1159Open in IMG/M
3300033405|Ga0326727_10196810All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus2216Open in IMG/M
3300033405|Ga0326727_10437755All Organisms → cellular organisms → Bacteria1174Open in IMG/M
3300033405|Ga0326727_10445810All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1157Open in IMG/M
3300033405|Ga0326727_10560398All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus968Open in IMG/M
3300033405|Ga0326727_10893280All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus666Open in IMG/M
3300034091|Ga0326724_0338094All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus821Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland28.07%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland20.18%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog14.04%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.77%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil8.77%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.51%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen3.51%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.63%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.63%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.75%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.88%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.88%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300025419Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025441Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025446Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025459Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025480Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031672Soil microbial communities from Risofladan, Vaasa, Finland - OX-2EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0116128_119046713300009518PeatlandPDADQYEIPDVEGSIPACMRRTALDESELARLKDKINDPLAKKLVDALLALDHLSAQAKRPELDDDIGQQLSDCNPALPCLLAVFAEGDAVAGCSDEDAQGMMEVEPEPNIIIPFDPTDMASVQRTFHMFGVACQTIAAASRLIDLMPGNEQWIISR*
Ga0116108_117656123300009519PeatlandLVDAVTGLDRVSRQAERPEHDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFQTFGVACETIAAASRVIDLMPGNDQWIISR*
Ga0116108_120914713300009519PeatlandDNVLALDHLSAQVERPDLDDDTAQQLSDCNPPLPCLLAVFAEGDSIGGCFDEDAAGMMEVEPEPNIIIPFNPMDTASVQRTFCMFGVACQTIAAASRVIDLMPGNDQWIISR*
Ga0116111_115698713300009616PeatlandTLREWAAQEPDADQYEIPDVEGSIPPCMRLEALDEAELARLKDNINNPIAKNLVDAALALDHLSAQAKRPELDDDIGQQLSDCNPALPCLLAVFAEGDAVAGCSDEDAQGMMEVEPEPNIIIPFDPTDMASVQRTFHMFGVACQTIAAASRLIDLMPGNEQWIISR*
Ga0116123_110772213300009617PeatlandQLLESVHPQLPATFFHLLVGALNHWVRVYDHRDAEERAETLREWAAQEPDADQYELPDVEGSIPPCMRQAALDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRSFHTFGVACQTIAAASRVIDLMPGNDQWIISR*
Ga0116127_106649023300009618PeatlandERAETLREWAAGEPDADQYEIPDVEGSIPLCMRQTTLDEGEVAHLKDNINDPRAKKLVNAVLALDHLSTQAERPDLDDNIREELSACNPPLPCLLAVFAEGDTISAAFDEDAQGMMEVEPEPNIIIPFNPTDTQSVQRTFHMFGVACQTIAAASRLIDLMPGNDQWIISR*
Ga0116119_102398933300009629PeatlandDAEERAETLREWAAQEPDADQYEIPDVEGSIPPCMRLEALDEAELARLKDNINNPIAKNLVDAALALDHLSAQAKRPELDDDIGQQLSDCNPALPCLLAVFAEGDAVAGCSDEDAQGMMEVEPEPNIIIPFDPTDMASVQRTFHMFGVACQTIAAASRLIDLMPGNEQWIISR*
Ga0116115_113248913300009631PeatlandMRQAALDEGELAHLMVKINDPLAMKLVNAVLALDHLSAQVERPDLDDDTAQQLSDCNPPLPCLLAVFAEGDSIGGCFDEDAAGMMEVEPEPNIIIPFNPMDTASVQRTFCMFGVACQTIAAASRVIDLMPGNDQWIISR*
Ga0116112_107556313300009636PeatlandCMRRTALDECELARLKDKINDPLATKLVEAVLALDHLSAQAKRPELDDDIGQQLSDCNPALPCLLAVFAEGDAVAGCSDEDAQGMMEVEPEPNIIIPFDPTDMASVQRTFHMFGVACQTIAAASRLIDLMPGNEQWIISR*
Ga0116112_113291523300009636PeatlandDLDDNIREELSACNPPLPCLLAVFAEGDTISAAFDEDAQGMMEVEPEPNIIIPFNPTDTQSVQRTFHMFGVACQTIAAASRLIDLMPGNDQWIISR*
Ga0116126_117417823300009640PeatlandLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAIFAESDAISAAFDEDAQGMMEVEPEPNIIIPFDPTNAESVQRTFQTFGVACHTIAAASRLIDLMPGNDQWIISR*
Ga0116126_121779413300009640PeatlandNAVLALDHLSTQAERPDLDDNIREELSACNPPLPCLLAVFAEGDTISAAFDEDAQGMMEVEPEPNIIIPFNPTDTQSVQRTFHMFGVACQTIAAASRLIDLMPGNDQWIISR*
Ga0116120_117578323300009641PeatlandESIHPQLPATFFHLFVGALNHWIRIYNYRDAEERAETLREWAAQEPDADQYELPDVAGSVPPCMREAALNEGELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFHTFGVACQTIAAASRLIDLMPGNDQWIISR*
Ga0116106_116412313300009645PeatlandKLADAVTGLDRVSRQAERPELDDDVGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFNPMDTASVQRTFCMFGVACQTIAAASRVIDLMPGNDQWIISR*
Ga0116132_114793823300009646PeatlandEERAETLREWAAQEPDADQYEIPDVEGSIPPCMRLEALDEAELARLKDNINNPIAKNLVDAALALDHLSAQAKRPELDDDIGQQLSDCNPALPCLLAVFAEGDAVAGCSDEDAQGMMEVEPEPNIIIPFDPTDTESVQRTFHVFGVACQTIAATSRVIDLLPGNDQWIISR*
Ga0116132_123948313300009646PeatlandDYRDAEERAETLREWAAQEPDADQYELPDVEGSIPPCMRQGALDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDAASVQRTFHTFGVACQTIAAASRMIDLMPGNDQWIISR*
Ga0116135_115638823300009665PeatlandYELPDVEGSIPPSMRQAALEKSELAQLKDKINDPLATKLVGAVTGLDRVSRQAERPELDDDVGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDKASVQRTFRTFGVACQTIAAASQLIDLMPGNDQWIISR*
Ga0116223_1069763323300009839Peatlands SoilDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFHTFGVACQTIAAASRLIDLMPGNDQWIISR
Ga0074045_1026773113300010341Bog Forest SoilPLATKLVDAVTGLDRVSRQAERPELDDNIGQQLSDCNPALPCLLAIFAESDAISDAFDEDAQGMMEVEPEPNVIIPFDPSDTASVQHTFQMFGVACQTIAAASRVIDLMPGNDQWIISR*
Ga0074045_1107254413300010341Bog Forest SoilDVAGSIPPCMRQAALDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEIEPEPNIIIPFDPTDKASVQRTFQMFGVACQTIAAASRVIDLMPSNDQWIISR*
Ga0136449_10196466513300010379Peatlands SoilPCMRQGALDESELAQLKDKINDPLATKLVDAVTGLDRVSRRAERPELDDDIGQQLSDCNPALPCLLAIFAESDAISAAFDEDAQGMMEVEPEPNIIIPFDPTDAESVQRTFHMFGVACQTIAAASRVIDLMPGNEQWIISR*
Ga0136449_10287571423300010379Peatlands SoilPDLDDDTAQQLSDCNPPLPCLLAVFAEGDSIGGCFDEDAAGMMEAEPEPNIIIPFDPTDMESVQRTFHMFGVACKTIAAASRVIDLMPGNDQWIISR*
Ga0136449_10316904213300010379Peatlands SoilKYDLRDAEERVETLREWAAQEPDAGQYEIPDVEGSIPPCMWQKVLNEGELAHLMDKINNPLAIKLVKSVLALNHLSAQVERPDLDDNISQQLSDCNPPLPCLLAIFAEGDAISASFDEDAQGMMEVEPEPNIIIPFDPTDTEGVQRTFHTFGVACQTIAAASRIIDLMPGNDQWIISR*
Ga0136449_10401499013300010379Peatlands SoilAETLRERAVQEPNADQYEIPDVAGSIPLCMRRTALDEAEVAHIKGKINNPLALRLVDAVIGLDRESAQAERPELDDDTGQQLSDCNPPLPCLLAVFAEGDSIAGCFDEDAQGMMEIEPEPNIILPFDPTNKASVQRTLQMFGVACQTIAAASRLIDLMPGNDQWIISR*
Ga0136449_10466405913300010379Peatlands SoilKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDPIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFHTFGVACQTIAAASRLIDLMPGNDQWIISR*
Ga0137378_1117853923300012210Vadose Zone SoilMRQEALDEGELADLRDKINDPLAMKLVDAVIGLDHISTQAERPELDDDIGERLSDCNPPLPCLLAVFADGDAIAACFDEDAQEMIEVEPEPNIIIPFDPTDAESVQRTFHTFGVACQTIAAASRVIDLMPGNDQWIISK*
Ga0181533_113083323300014152BogINDPLATKLVDAVTGLDRVSRQAERPALDDDIGQHLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFHTFGVACQTIAAASRVIDLMPGNDQWIISR*
Ga0181527_128121023300014153BogAETLREWAAQEPDADQYELPDVEGSIPPCMRQAALDESELAQLQDKINDPLATKLVDAVTGLDRVSRQAERPELDDDVGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFHTFGVACQTIAAASRVIDLMPGNDQWIISR*
Ga0181524_1012022213300014155BogKEKAAFQPLRHITGIATKYDFRDAEERAETLREWAAQEPDAGQYELPDVEGSIPPCMRQEALNEGELAHLKDKINDPLAKDIVETVLSLGHLFAQAERPDLDDNIREELSDCNPPLPCLLAIFAEGDAISAAFDEDAQGMMEVEPEPNIIIPFDPTNAESVQRTFHMFGVACQTIAAASRLIDLMPGNDQWIISR*
Ga0181524_1022579523300014155BogQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDKASVQHTFQMFGVACQTIAAASRVIDLMPGNDQGIISR*
Ga0181524_1028007423300014155BogTMDEGALAHLKDKINDPLATKLVNAALALDHLSTQAGRPELDDDIREELSDCNPPLPCLLAVFAEADAISAAFEDAQGMMEVEPEPNIIIPFDPTDTKSVQRTFHVFGVACQTIASASRLIDLMPGNDPWIISR*
Ga0181524_1046035013300014155BogERVETLREWAAQEPDADQYELPDVEGSIPLCMRQTVLDEGELAYLKNKINDPPAKDLLEAVLALDHLSAQADRPDLDDNIRQQLSDCNPPLPCMLAVFAEGDSIAGCFDEDAAGMMEVEPEPNIIIPFDPTDMAGVQHTFHMFGVACQTIAAASRLIDLMPGNDKWVI*
Ga0181521_1042264513300014158BogRDAEERAETLREWAAQEPDADQYELPDVAGSVPPCMREAALNESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDVIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTNAESVQRTFHMFGVACQTIAAASRLIDLMPGNDQWIVPR*
Ga0181530_1021576323300014159BogMREAALNEGELAHLKDKINDPLATKLVDALVILDRISAQAERPELDDDTGQQLSDCNPPLPCLLAIFAEGDAISAAFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFHTFGVACQTIAAASRVIDLMPGNDQWIISR*
Ga0181530_1066515813300014159BogIPPCMRQTTLDEAELSHLKEKINDPLAMKLVDNVLALDHLSAQVERPDLDDDTAQQLSDCNPPLPCLLAVFAEGDSIGGCFDEDAAGMMEVEPEPNIIIPFNPMDTASVQRTFCMFGVACQTIAAASRVIDLMPGNDQWIISR*
Ga0181532_1041010723300014164BogALDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEIEPEPNIIIPFDPTDKASVQRTLQMFGVACQTIAAASRLIDLMPGNDQWIISR*
Ga0181523_1073929123300014165BogVDAVTGLDRVSRQAERPELDDGIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFQTFGVACQTIAAASRVIDLMPGNDQWIISR*
Ga0181526_1102628623300014200BogRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTLQMFGVACQTIAAASRVIDLMPGNDQWIISR*
Ga0181537_1094281423300014201BogLVDAVTGLDRVSRQAERHELDDGIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEIEPEPNIIIPFDPTDTASVQRTFHTFGVACQTIAAASRVIDLMPGNDQWIISR*
Ga0182014_1036693213300014491BogDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTNAESVQRTFQTFGVACHTIAAASRLIDLMPGNDQWINSR*
Ga0182013_1043067823300014492BogQLLESVHPQLPATFFHLFVGALNHWLRVYDHRDAEERAETLREWAAQEPDADQYELPDVEGSIPPCMRRAALDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAIFAESDAISAAFDEDAQGMMEVEPEPNIIIPFDPTDKTSVQRTFQMFGVACQTIAAASRVIDLMPGNDQWIISR*
Ga0182011_1010448713300014496FenPCMRQAALEKSELAQLKDKINDPLARKLVDTVTGLDRVSRQAERPELDDDVGQQLSDCNPALPCLLAVFAEGDSIAGCFVEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFHMFGVACQTIAAASRLIDLMPGNDQWIISR*
Ga0182011_1056497923300014496FenMSAQAERPEIDDSIRERLSDCNPPLPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDKSSVQRTFQVFGVACQTIAAASRVIDLMPGNDQWIISR*
Ga0182024_1014579813300014501PermafrostLREWAAQEPDADQYELPDVEGSIPPCMRQGALDESELAQLKDKINDPLARKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAIFAESDAISAAFDEDAQGMMEVEPEPNIIIPFDPTDKASVQRTFQMFGVACQTIAAASRVIDLMPGNDQWIISR*
Ga0182021_1271509213300014502FenMREAALNEGELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQQTFHTFGVACQTIAAASRVIDLMPGNDQWIISR*
Ga0181536_1024512313300014638BogVSERHITGIATKYDHRDAEERAETLREWAAQEPDADQYELPDVAGSIPPCMREAALNEGELAHLKDKINDPLATKLVDALVILDRISAQAERPELDDDTGQQLSDCNPPLPCLLAIFAEGDAISAAFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFHTFGVACQTIAAASRLIDLMPGNVSLET*
Ga0181516_1066383813300014655BogPATFFHLFVGALNHWLRVYDHRDAEERAETLREWAAQEPDADQYELPDVEGSIPPCMRQAALDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERSELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEIEPEPNIIVPFDPTNKASVQRTLQLFGVACQTIAAAS
Ga0182030_1067842923300014838BogELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNVIIPFDPTDKASVQRTFQMFGVACQTIATASRVIDLMPGNDQWIISR*
Ga0182027_1058581523300014839FenMQHAALDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAIFAESDAISAAFDEDAQGMMEVEPEPNIIIPFDPTDKASVQRTFQMFGVACQTIAAASRVIDLMPGNDQWIISR*
Ga0187802_1043405323300017822Freshwater SedimentQGELHHLKARINYPLAAKLVEAAFNLDHVSAEARRPELDDDIGQQLSDCNPALPCLLAVFVEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFHTFGVACQTIAAASRVIDLMPGNDRWIISR
Ga0187849_115814413300017929PeatlandLDESELAQLKDKINDPFATKLVDAVTGLDRVSRQAERPELDDDVGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFHTFGVACQTIAAASRLIDLMPGNDQWIVSR
Ga0187849_136665223300017929PeatlandVEGSIPPCMRQGALDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDGIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDKASVQRTFQMFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0187853_1033108913300017940PeatlandTLREWAAQEPDADQYEIPDVEGSIPPCMRQTTLDEAELSHLKEKINDPLAMKLVDNVLALDHLSAQVERPDLDDDTAQQLSDCNPPLPCLLAVFAEGDSIGGCFDEDAAGMMEVEPEPNIIIPFNPMDTASVQRTFCMFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0187853_1036650923300017940PeatlandMREAALNEGELAQLKDKINDPLATKLVDAVTGLDRVSRQAVRPELDDDVGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFHTFGVACQTIAAASRLIDLMPGNDQWIISR
Ga0187808_1021820513300017942Freshwater SedimentELPDVEGSIPLCMRQAALEESELAELKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQRLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFHTFGVACQTIAAASRLIDLMPGNDQWIISR
Ga0187817_1032342113300017955Freshwater SedimentLKDKINDPLATKLVDALIILDRISAQAERPELDDGISQQLSDCNPPLPCLLAVFAEADAIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTESVRRSFHVFGVACQTIAAASRLINLMPGNDQWIISR
Ga0187817_1043398923300017955Freshwater SedimentCMRQAALDESELAQLKDKINDPLATTLVDAVTGLDRVSRQAERPELDDGIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPESNIIIPFDPTDTASVQRTFQTFGVACQTIAAASRLIDLMPGNDQWIISR
Ga0181520_1053012723300017988BogLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDKASVQRTFQMFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0187868_107041633300018002PeatlandATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFADGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRSFHTFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0187868_110593123300018002PeatlandATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFQTFGVACQTISAASRVIDLMPGNDQWIISR
Ga0187876_109077933300018003PeatlandSRQAERPELDDDIGQQLSDCNPALPCLLAVFADGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRSFHTFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0187873_101425673300018013PeatlandLDHLSAQAKRPELDDDIGQQLSDCNPALPCLLAVFAEGDAVAGCSDEDAQGMMEVEPEPNIIIPFDPTDMASVQRTFHMFGVACQTIAAASRLIDLMPGNEQWIISR
Ga0187860_128692823300018014PeatlandKLVNAVLALDHLSTQAERPDLNDNIREQLSDCNPSLPCLLAVFADGDAISAAFDEDAQGMMEVEPEPNIIIPFDPTNAESVQRTFHMFGVACQTIAAASRLIDLMPGNDQWIISR
Ga0187886_126565723300018018PeatlandVLSLDHLSAQAERPDLDDNIREELSDCNPPLPCLLAIFAEGDAISAAFDEDAQGMTEVEPEPNIIIPFNPTDTVSVQRTFHAFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0187874_1018153923300018019PeatlandVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRSFHTFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0187861_1017346323300018020PeatlandWLRIYDFRDAEERAETLREWAAQEPDADQYEIPDVEGSIPPCMRLEALDEAELARLKDNINNPIAKNLVDAALALDHLSAQAKRPELDDDIGQQLSDCNPALPCLLAVFAEGDAVAGCSDEDAQGMMEVEPEPNIIIPFDPTDMASVQRTFHMFGVACQTIAAASRLIDLMPGNEQWIIS
Ga0187882_117524923300018021PeatlandNLVDAALALDHLSAQAKRPELDDDIGQQLSDCNPALPCLLAVFAEGDAVAGCSDEDAQGMMEVEPEPNIIIPFDPTDMASVQRTFHMFGVACQTIAAASRLIDLMPGNEQWIISR
Ga0187864_1037831713300018022PeatlandDEAELSHLKEKINDPLAMKLVDNVLALDHLSAQVERPDLDDDTAQQLSDCNPPLPCLLAVFAEGDSIGGCFDEDAAGMMEVEPEPNIIIPFNPMDTASVQRTFCMFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0187889_1048349113300018023PeatlandIPLCMRQTVLDEGELAYLKNKINDPPAKDLLEAVLALDHLSAQADRPDLDDNIRQQLSDCNPPLPCMLAVFAEGDSIAGCFDEDAAGMMEVEPEPNIIIPFDPTDMAGVQHTFHMFGVACQTIAAASRLIDLMPGNDQWIISR
Ga0187881_1047693713300018024PeatlandEWAAQEPDADQYEIPDVEGSIPPCMRQTTLDEAELSHLKEKINDPLAMKLVDNVLALDHLSAQVERPDLDDDTAQQLSDCNPPLPCLLAVFAEGDSIGGCFDEDAAGMMEVEPEPNIIIPFNPMDTASVQRTFQTFGVACETIAAASRVIDLMPGNDQWIISR
Ga0187885_1038141713300018025PeatlandTKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFHTFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0187869_1035842113300018030PeatlandHLFVGALNHWLRVYDHRDAEERAETLREWAAQEPDADQYELPDVAGSIPPCMRKAALNEGELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFADGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFQTFGVACQTISAASRVIDLMPGNDQWIISR
Ga0187867_1005765013300018033PeatlandTKLVNAVLALDHLSTQAERPDLNDNIREQLSDSNPSLPCLLAVFADGDAISAAFDEDAQGMMEVEPEPNIIIPFDPTDKARVQRTFRTFGVACQTIAAASQLIDLMPGNDQWIISK
Ga0187867_1019556223300018033PeatlandVAGSIPPCMREAALNEGELAHLKDKINDPLATNLVDALVILDRISAQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTNAESVQRTFQTFGVACHTIAAASRLIDLMPGNDQWINSR
Ga0187867_1041424623300018033PeatlandPELDDGIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDKASVQRTFQMFGVACQTIAAASRLIDLMPGNDQWIISR
Ga0187867_1072097623300018033PeatlandPDVEGSIPPCMRQGALDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAIFAESDAISAAFDEDAQGMMEVEPEPNVIIPFDPSDTASVQHTFQMFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0187863_1069426913300018034PeatlandALDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNVIIPFDPSDTASVQHTFQMFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0187875_1026460333300018035PeatlandDQYELPDVEGSIPPCMRQAALDESELAQLKDKINDPLAKKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTNAESVQRTFQTFGVACHTIAAASRLIDLMPGNDQWINSR
Ga0187875_1069778713300018035PeatlandATKLVDAVTGLDRVSRQAERPELDDDIGQQLTDCNPSLPCLLAVFTEGDAISAAFDEDAQGMMEVEPEPNVILPFNPTNTESVQRTFHTFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0187855_1039060423300018038PeatlandETLREWAAQEPDADQYEIAGVEGSIPPCMWQSALNESELAHLKNKINDPLTTKLVNAVLALDHLSTQAERPDLNDNIREQLSDSNPSLPCLLAVFADGDAISAAFDEDAQGMMEVEPEPNIIIPFDPTDKARVQRTFRTFGVACQTIAAASQLIDLMPGNDQWIISK
Ga0187871_1031966813300018042PeatlandDHRDAEERAETLREWAAQEPDADQYEIPDVEGTIPPCMRQAVLNEGELAHHKGKINDLLAMKLVNAVVALDHLSALAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDAESVQRTFQTFGVACETIAAASRVIDLMPGNDQWTISR
Ga0187871_1055354213300018042PeatlandDHRDAEERAETLREWAAQEPDADQYELPDVEGSIPPCMRQAALDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAIFAESDAISAAFDEDAQGMMEVEPEPNIIIPFDPTDKASVQRTFQMFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0187890_1089408713300018044PeatlandATKLVDALIMLDRISAQAERPELDDDTGQQLSDCNPPLPCLLAIFAEGDAISAAFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFHTFGVACQTIAAASRLIDLMPGNDQWIISR
Ga0187858_1038171913300018057PeatlandDAALALDHLSAQAKRPELDDDIGQQLSDCNPALPCLLAVFAEGDAVAGCSDEDAQGMMEVEPEPNIIIPFDPTDMASVQRTFHMFGVACQTIAAASRLIDLMPGNEQWIISR
Ga0187852_119774013300019082PeatlandPPCMRQEALNEGELAHLKDKINNPLAKDIVETVLSLDHLSAQAERPDLDDNIREELSDCNPPLPCLLAIYAEGDAISAAFDEDAQGMMEVEPEPNIIIPFDPTNAESVQRTFHMFGVACQTIAAASRLIDLMPGNDQWIISR
Ga0187852_122074823300019082PeatlandQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFQTFGVACQTISAASRVIDLMPGNDQWIISR
Ga0224558_115883013300023090SoilELAQLKDKINDSLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAKGMMEVEPEPNVIIPFDPSDTASVQHTFQMFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0224558_118599513300023090SoilTLREWAAQEPDSDQYELPDVEGSIPPCMRQAALDESELAQLKDKINDPLAKKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTNAESVQRTFQTFGVACHTIAAASRLIDLMPGNDQWINSR
Ga0224557_114513023300023101SoilELPDVEGSIPPCMRQAALDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAIFAESDAISAAFDEDAQGMMEVEPEPNIIVPFDPTDTASVQRTFHTFGVACQTIAAASRVIDLMPGNDQWINSR
Ga0208036_102456223300025419PeatlandDAEERAETLREWAAQEPDADQYEIPDVEGSIPPCMRLEALDEAELARLKDNINNPIAKNLVDAALALDHLSAQAKRPELDDDIGQQLSDCNPALPCLLAVFAEGDAVAGCSDEDAQGMMEVEPEPNIIIPFDPTDMASVQRTFHMFGVACQTIAAASRLIDLMPGNEQWIISR
Ga0208456_102777433300025441PeatlandIAKNLVDAALALDHLSAQAKRPELDDDIGQQLSDCNPALPCLLAVFAEGDAVAGCSDEDAQGMMEVEPEPNIIIPFDPTDMASVQRTFHMFGVACQTIAAASRLIDLMPGNEQWIISR
Ga0208038_104402823300025446PeatlandLRDKINNQLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFQTFGVACQTISAASRVIDLMPGNDQWIISR
Ga0208689_109149823300025459PeatlandEGSIPPCMRLEALDEAELARLKDNINNPIAKNLVDAALALDHLSAQAKRPELDDDIGQQLSDCNPALPCLLAVFAEGDAVAGCSDEDAQGMMEVEPEPNIIIPFDPTDMASVQRTFHMFGVACQTIAAASRLIDLMPGNEQWIISR
Ga0208688_109420113300025480PeatlandDNVLALDHLSAQVERPDLDDDTAQQLSDCNPPLPCLLAVFAEGDSIGGCFDEDAAGMMEVEPEPNIIIPFNPMDTASVQRTFCMFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0208820_114774013300025576PeatlandVLALDHLSTQAERPDLDDNIREELSACNPPLPCLLAVFAEGDTISAAFDEDAQGMMEVEPEPNIIIPFNPTDTQSVQRTFHMFGVACQTIAAASRLIDLMPGNDQWIISR
Ga0209517_1039174513300027854Peatlands SoilIPPCMRQAALDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNVIIPFDPSDTASVQHTFQMFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0247275_110097313300029817SoilYDHRDAEERAETLREWAAQEPDADQYELPDVEGSIPPCMRQGALDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIGGCFDEDAAGMMEVEPEPNIIIPFNPMDTASVQRTFCMFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0302320_1108049423300031524BogKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQQTFHTFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0302320_1194701823300031524BogDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAIFAESDAISAAFDEDAQGMMEVEPEPNVIIPFDPSDTASVQHTFQMFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0307373_1006703313300031672SoilSIPLCMRQAALEESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIVPFDPTDTASVQRTFHTFGVACQTIAAASRLIDLMPGNDQWIISR
Ga0311301_1105006923300032160Peatlands SoilYELPDVEGSIPLCMRQTALDEGELAQLKDKIRDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDKASVQRTFQMFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0311301_1219308213300032160Peatlands SoilLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNVIIPFDPSDTASVQHTFQMFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0311301_1302765023300032160Peatlands SoilKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFHTFGVACQTIAAASRLIDLMPGNDQWIISR
Ga0335071_1117506323300032897SoilQEPDAGEYELPDVAGSIPLCMRQAALEESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFQTFGVACQTIAAASRLIDLMPGNDQWIISR
Ga0326728_1016921653300033402Peat SoilLAMNLVNAVLALNHLSAQVERPDLDDDTGQLLSDCNPPLPCLLAVFTDGDAISAAFDEDAQGMMEVEPEPNIIIPFDPSNAESVQRTFHTFGVACQTIAAASRMIDLMPGNDQWIISRGE
Ga0326728_1022663513300033402Peat SoilYRDAEERAETLREWAAQEPDADQYELPDVAGSIPPCMRQAALDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERHELDDGIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEIEPEPNIIIPFDPTDTASVQRTFHMFGVACQTIAAASRLINLMPGNDQWIISR
Ga0326728_1035707233300033402Peat SoilPCMRQAALDESELAQLKDKINDPLATELVDAITGLDHVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIMPFDPTDTASVQRTFQTFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0326728_1040658723300033402Peat SoilAEERAETLREWAAQEPDADQYELPDVEGSIPPCMRQGALDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAIFAESDAISAAFDEDAQGMMEVEPEPNIIIPFDPTDKASVQRTFQMFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0326727_1019681033300033405Peat SoilQAERPELDDGIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEIEPEPNIIIPFDPTDTASVQRTFHMFGVACQTIAAASRLINLMPGNDQWIISR
Ga0326727_1043775533300033405Peat SoilDDDIGQQLSDCNPALPCLLAIFAESDAISAAFDEDAQGMMEVEPEPNIIIPFDPTDKASVQRTFQMFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0326727_1044581013300033405Peat SoilIRVYDHRDAEERAETLREWAAQEPDADQYELPDVEGSIPLCMRQAALEESELTQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFVEDAQGMMEVEPEPNIIIPFDPTDTASVQRTFHTFGVACQTIAAASRLIDLMPGNDQWIISR
Ga0326727_1056039813300033405Peat SoilDAVTGLDRVSRQAERPELDDGIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNVIIPFDPSDTASVQHTFQMFGVACQTIAAASRVIDLMPGNDQWIISR
Ga0326727_1089328013300033405Peat SoilALDESELAQLKDKINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFEDAQGMMEVEPEPNIIIPFDPTNAESVQRTFHMFGVACQTIAAASRLIDLMPGNDQWIISR
Ga0326724_0338094_2_3703300034091Peat SoilINDPLATKLVDAVTGLDRVSRQAERPELDDDIGQQLSDCNPALPCLLAVFAEGDSIAGCFDEDAQGMMEVEPEPNIIIPFDPTNAESVQRTFHMFGVACQTIAAASRLIDLMPGNDQWIISR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.