| Basic Information | |
|---|---|
| Family ID | F080559 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 44 residues |
| Representative Sequence | GSGVAVQFREMNREGRERMFKILEFVQKTTTFYNNRYLDSLTKS |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.87 % |
| % of genes near scaffold ends (potentially truncated) | 97.39 % |
| % of genes from short scaffolds (< 2000 bps) | 89.57 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.087 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.391 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.565 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.043 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.94% β-sheet: 0.00% Coil/Unstructured: 43.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF01545 | Cation_efflux | 32.17 |
| PF01339 | CheB_methylest | 31.30 |
| PF07238 | PilZ | 5.22 |
| PF05649 | Peptidase_M13_N | 1.74 |
| PF01584 | CheW | 1.74 |
| PF01435 | Peptidase_M48 | 1.74 |
| PF00015 | MCPsignal | 1.74 |
| PF02518 | HATPase_c | 1.74 |
| PF00072 | Response_reg | 0.87 |
| PF00248 | Aldo_ket_red | 0.87 |
| PF13426 | PAS_9 | 0.87 |
| PF00920 | ILVD_EDD | 0.87 |
| PF02779 | Transket_pyr | 0.87 |
| PF04679 | DNA_ligase_A_C | 0.87 |
| PF01627 | Hpt | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 62.61 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 32.17 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 32.17 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 32.17 |
| COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 3.48 |
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 1.74 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 1.74 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.09 % |
| Unclassified | root | N/A | 13.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573001|GZR05M101BWL9N | Not Available | 514 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_103998944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300001174|JGI12679J13547_1000960 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300001546|JGI12659J15293_10020754 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100497466 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → unclassified Pedosphaera → Pedosphaera sp. Tous-C6FEB | 1096 | Open in IMG/M |
| 3300004152|Ga0062386_101250187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300005445|Ga0070708_100175323 | All Organisms → cellular organisms → Bacteria | 2003 | Open in IMG/M |
| 3300005568|Ga0066703_10213451 | Not Available | 1173 | Open in IMG/M |
| 3300005586|Ga0066691_10727021 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005764|Ga0066903_100722535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1762 | Open in IMG/M |
| 3300006052|Ga0075029_100805165 | Not Available | 640 | Open in IMG/M |
| 3300006052|Ga0075029_101334755 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300006102|Ga0075015_100358239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300006162|Ga0075030_100388400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1112 | Open in IMG/M |
| 3300006163|Ga0070715_10337312 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300006893|Ga0073928_10122332 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
| 3300006893|Ga0073928_10726446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300006903|Ga0075426_10706426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300009524|Ga0116225_1019813 | All Organisms → cellular organisms → Bacteria | 3466 | Open in IMG/M |
| 3300009525|Ga0116220_10255428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 766 | Open in IMG/M |
| 3300010048|Ga0126373_10237877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1785 | Open in IMG/M |
| 3300010048|Ga0126373_12100180 | Not Available | 627 | Open in IMG/M |
| 3300010361|Ga0126378_10184975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 2152 | Open in IMG/M |
| 3300010366|Ga0126379_10161906 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Schlesneria → Schlesneria paludicola | 2102 | Open in IMG/M |
| 3300010376|Ga0126381_103112101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300010376|Ga0126381_104605188 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300010937|Ga0137776_1734337 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300011271|Ga0137393_11666529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300012203|Ga0137399_10743787 | Not Available | 826 | Open in IMG/M |
| 3300012210|Ga0137378_11327095 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012357|Ga0137384_10421378 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300012357|Ga0137384_11328441 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300012363|Ga0137390_11338642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300012469|Ga0150984_110510892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300012683|Ga0137398_11240471 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012960|Ga0164301_10460434 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300012960|Ga0164301_11723777 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300014168|Ga0181534_10464585 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300015373|Ga0132257_104087555 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300015374|Ga0132255_100181096 | All Organisms → cellular organisms → Bacteria | 2967 | Open in IMG/M |
| 3300017822|Ga0187802_10322500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300017959|Ga0187779_10823084 | Not Available | 635 | Open in IMG/M |
| 3300017961|Ga0187778_10047373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2624 | Open in IMG/M |
| 3300017972|Ga0187781_11086987 | Not Available | 586 | Open in IMG/M |
| 3300017975|Ga0187782_10628609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300018019|Ga0187874_10149771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 987 | Open in IMG/M |
| 3300018043|Ga0187887_10978555 | Not Available | 500 | Open in IMG/M |
| 3300018085|Ga0187772_10894359 | Not Available | 645 | Open in IMG/M |
| 3300018086|Ga0187769_10595794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 835 | Open in IMG/M |
| 3300018090|Ga0187770_10456531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300018090|Ga0187770_11472368 | Not Available | 554 | Open in IMG/M |
| 3300020581|Ga0210399_10272173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1413 | Open in IMG/M |
| 3300020581|Ga0210399_10396891 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300020583|Ga0210401_10850119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300021088|Ga0210404_10609093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300021088|Ga0210404_10785314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300021407|Ga0210383_11170965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300021420|Ga0210394_11739126 | Not Available | 521 | Open in IMG/M |
| 3300021433|Ga0210391_10257854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1369 | Open in IMG/M |
| 3300021433|Ga0210391_10765362 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300021433|Ga0210391_10986079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300021433|Ga0210391_11495474 | Not Available | 518 | Open in IMG/M |
| 3300021476|Ga0187846_10198858 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300021477|Ga0210398_10941929 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300021478|Ga0210402_10584603 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300021478|Ga0210402_11962419 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300021478|Ga0210402_12030701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300021479|Ga0210410_11534034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300021560|Ga0126371_12008871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300022557|Ga0212123_10449072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
| 3300022731|Ga0224563_1008026 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300023255|Ga0224547_1011606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1114 | Open in IMG/M |
| 3300025320|Ga0209171_10632164 | Not Available | 511 | Open in IMG/M |
| 3300025854|Ga0209176_10118373 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300025906|Ga0207699_11219704 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300025912|Ga0207707_10994498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300025928|Ga0207700_10952765 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300025928|Ga0207700_11751073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300025939|Ga0207665_10677700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300025939|Ga0207665_10778591 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300026890|Ga0207781_1015507 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300026941|Ga0207741_1021228 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300027545|Ga0209008_1140691 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300027567|Ga0209115_1056687 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300027633|Ga0208988_1088475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300027842|Ga0209580_10096801 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300027842|Ga0209580_10208343 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300027842|Ga0209580_10572225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300027905|Ga0209415_10173300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2104 | Open in IMG/M |
| 3300027908|Ga0209006_10616176 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300028773|Ga0302234_10382168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300028798|Ga0302222_10042876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1842 | Open in IMG/M |
| 3300031028|Ga0302180_10124835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1450 | Open in IMG/M |
| 3300031028|Ga0302180_10397440 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300031446|Ga0170820_13492636 | Not Available | 766 | Open in IMG/M |
| 3300031573|Ga0310915_11111952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300031668|Ga0318542_10400624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300031679|Ga0318561_10370972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
| 3300031715|Ga0307476_10721729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300031753|Ga0307477_10392479 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300031823|Ga0307478_11397169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300031947|Ga0310909_10512658 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300031962|Ga0307479_10056261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3789 | Open in IMG/M |
| 3300032001|Ga0306922_10519347 | Not Available | 1268 | Open in IMG/M |
| 3300032180|Ga0307471_100822327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300032261|Ga0306920_104053927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300032770|Ga0335085_11517676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300032783|Ga0335079_10034442 | All Organisms → cellular organisms → Bacteria | 5814 | Open in IMG/M |
| 3300032828|Ga0335080_11406912 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300033004|Ga0335084_10082754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3329 | Open in IMG/M |
| 3300033004|Ga0335084_10095710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3083 | Open in IMG/M |
| 3300033405|Ga0326727_11190951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300033433|Ga0326726_11278040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300033545|Ga0316214_1064011 | Not Available | 539 | Open in IMG/M |
| 3300033887|Ga0334790_161501 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.39% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.09% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.09% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.35% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.48% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.48% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.61% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.74% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.74% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.74% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.87% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.87% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.87% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.87% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.87% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.87% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.87% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.87% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
| 3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
| 3300026941 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD2_04303910 | 2189573001 | Grass Soil | VQFRELNREARERMFRILEFVQKTTSFYNNRYLDSLTKN |
| INPhiseqgaiiFebDRAFT_1039989442 | 3300000364 | Soil | PGSGAAVQFRELNREARDRMFRILEFVQKTTTFYNNRYLDSLTKN* |
| JGI12679J13547_10009603 | 3300001174 | Forest Soil | EGVVARLDPGSGLAIQFREVNREGRDRMLKILEFVQKTTTFYNNRYLNSLTKN* |
| JGI12659J15293_100207541 | 3300001546 | Forest Soil | QFREMNREGRERMFRILEFVQKTTSFYNKRYLDSLTKT* |
| JGIcombinedJ26739_1004974661 | 3300002245 | Forest Soil | FREMNREGRDRMLKILEFVQKTTTFYNNRYLNSLTKN* |
| Ga0062386_1012501871 | 3300004152 | Bog Forest Soil | RLDPGSGVAVQFREMNRDGRDRMFRILEFVQKTSAYYNNRYFENLLKR* |
| Ga0070708_1001753231 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AEGVVARIDPGTGMAVQFQEMNREARAQMFKILEFVQKTTAFYNNRYFENLLKR* |
| Ga0066703_102134511 | 3300005568 | Soil | GVVARLDPGTGVAVQFREMNREGRERMFKILEFVQKTTTFFNNRYLDSLTKTKS* |
| Ga0066691_107270211 | 3300005586 | Soil | DGVVARIDPGSGVAVQFKEMNREGREKMFKVIEFVQKATAFYNNRYFENLLKR* |
| Ga0066903_1007225351 | 3300005764 | Tropical Forest Soil | QFREMNREARDRMFRILEFVQKANSFYNNKYLDSLTRN* |
| Ga0075029_1008051652 | 3300006052 | Watersheds | AVQFREMNRDGRDRMFRILEFVQKTSAFYNNRYFENLLKR* |
| Ga0075029_1013347552 | 3300006052 | Watersheds | VVARLDPGSGVAVQFREMNREGRERMFKILEFVQKTTAFYNSRYLDTLTKS* |
| Ga0075015_1003582391 | 3300006102 | Watersheds | VNREGRERMLKILEFVQKSSAFHNNRYLETLLKR* |
| Ga0075030_1003884002 | 3300006162 | Watersheds | GSGVAVQFREMNREARERMFRILEFIQKTTTFYNNRYLDSLTKN* |
| Ga0070715_103373121 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ARLDPGSGVAVQFREMNREGRERMFRILEFVQKTTTFFNNRYIDSLKKS* |
| Ga0073928_101223324 | 3300006893 | Iron-Sulfur Acid Spring | VVARLDPGSGVAVQFRELNREARDRMLKILEFVQKTTTFYNNRYLNSLTKT* |
| Ga0073928_107264462 | 3300006893 | Iron-Sulfur Acid Spring | DPGVGVAVQFKETNREGREKMLKILEYVQRTTTFYNNRYFEGLLKR* |
| Ga0075426_107064261 | 3300006903 | Populus Rhizosphere | PGSGVAVQFRELNREARERMFRILEFVQKTTTYYNNRYLDTLAKN* |
| Ga0116225_10198133 | 3300009524 | Peatlands Soil | VARLDPGSGIAVQFREMNREGRERMFRILEFVQKTTTFYNNRYLDSLTKG* |
| Ga0116220_102554282 | 3300009525 | Peatlands Soil | VNREGRERMFKILEFVQKATAFYNNRYFENLLKR* |
| Ga0126373_102378773 | 3300010048 | Tropical Forest Soil | AGVAVQFREMNREGRERLFKILEFVQKTTADYNNRYLNSLTKS* |
| Ga0126373_121001802 | 3300010048 | Tropical Forest Soil | MVARIDPGTGIAVQFQEMNREARAKMFKILEFVQKTTTYYNNRYFENLLKR* |
| Ga0126378_101849751 | 3300010361 | Tropical Forest Soil | VVMRLDPGSGVAVQFHELNREARERMFRIIEFVQKTTTFYNKRYLDSLARN* |
| Ga0126379_101619061 | 3300010366 | Tropical Forest Soil | LDPGTGVAVQFKEMNREARERMFKILEFVQKTTTFYNNRYLSSLTKS* |
| Ga0126381_1031121011 | 3300010376 | Tropical Forest Soil | AVQFHELNREARERMFRIIEFVQKTTTFYNKRYLDSLARN* |
| Ga0126381_1046051881 | 3300010376 | Tropical Forest Soil | LDPGAGVAVQFREMNREARERMFKILEFVQKTTTYYNNRYLNSLTKS* |
| Ga0137776_17343372 | 3300010937 | Sediment | LDPGAGVAVQFREMNREARERMFKVLEFVQKTTTYYNNRYLNSLTKN* |
| Ga0137393_116665291 | 3300011271 | Vadose Zone Soil | IDPGSGIAVQFKEPNREGRETLLKILEHVQKSTAFYNNRYFENLLKR* |
| Ga0137399_107437871 | 3300012203 | Vadose Zone Soil | YVARMDPGSGIAVQFKELNREAKEKMGRILEHVQKTNTFYNNRYFENLVKR* |
| Ga0137378_113270951 | 3300012210 | Vadose Zone Soil | EMNREGRERMFKIIEFVQKTTTYFNNRYIDSLTKS* |
| Ga0137384_104213782 | 3300012357 | Vadose Zone Soil | DRLDPGSGIAVQFQERNREGRERMFRIIEFVQKTTTFFNNRYIDSLTKS* |
| Ga0137384_113284412 | 3300012357 | Vadose Zone Soil | GIAVQFREMNREGRETMLKILEFVQKTTTFYNNRYLNSLSKS* |
| Ga0137390_113386421 | 3300012363 | Vadose Zone Soil | GSGIAVQFKELNREAKEKMYRILEHVQKTNTFYNNRYFENLIKR* |
| Ga0150984_1105108922 | 3300012469 | Avena Fatua Rhizosphere | MNREARERMFRILEFVQKATSFYNNRYLDSLTKN* |
| Ga0137398_112404712 | 3300012683 | Vadose Zone Soil | FREMNREGRDRMFKILEFVQKTTTFYNNRYLDSLTKT* |
| Ga0164301_104604343 | 3300012960 | Soil | DPGSGLAVQFPELNRDARDRMFRIIEFVQKSTSFYNKRYLDSLAKS* |
| Ga0164301_117237771 | 3300012960 | Soil | GVAIQFREMNREGRERMFRILEFVQKTTTFYNNRYLDSLSKS* |
| Ga0181534_104645852 | 3300014168 | Bog | FREMNREGRERMFRILEFVQKTTSFYNKRYLDSLSKT* |
| Ga0132257_1040875551 | 3300015373 | Arabidopsis Rhizosphere | FREMNREGRERMFRILEFVQKTTTFFNNRYIDSLKKS* |
| Ga0132255_1001810965 | 3300015374 | Arabidopsis Rhizosphere | EMNREARDRMFRILEYVQKTTTFYNNRYLDSLTKN* |
| Ga0187802_103225001 | 3300017822 | Freshwater Sediment | RLDPGSGLAIQFREMNREGRERMLKVLEFVQKTTTFYNNRYLNSLTKS |
| Ga0187779_108230841 | 3300017959 | Tropical Peatland | GSGVAVQFHELNREARERMFRILEFVQKTTSFYNKRYLDSLARN |
| Ga0187778_100473731 | 3300017961 | Tropical Peatland | GSGVAVQFREVNREGRERMFKILEFVQKATAYYNNRYFENLLKR |
| Ga0187781_110869872 | 3300017972 | Tropical Peatland | FAEGVVMRLDPGSGVAVQFHELNREARERMFRIIEFVQKTTSFYNKRYLDSLARN |
| Ga0187782_106286092 | 3300017975 | Tropical Peatland | VVARLEPGSGVAVQFKEVNRDGRERMFKVLEFVQKTTAYYNSRYFENLLKR |
| Ga0187874_101497712 | 3300018019 | Peatland | GSGVAVQFREMNREGRERMFKILEFVQKTTTFYNNRYLDSLTKS |
| Ga0187887_109785552 | 3300018043 | Peatland | GVGVAVQFKETNREGREKMLKILEYVQKTTTFYNNRYFEGLLKR |
| Ga0187772_108943592 | 3300018085 | Tropical Peatland | VQFREVTREGRERMFKILEYVQKTTAYYNSRYFESLLKR |
| Ga0187769_105957942 | 3300018086 | Tropical Peatland | VAVQFREVNREGRERMFKILEFVQKATAYYNNRYFENLLKQ |
| Ga0187770_104565312 | 3300018090 | Tropical Peatland | VLRLDPGSGVAVQFREVNREGREKMLRILEVVQKTNAYYNNRYFENILKR |
| Ga0187770_114723681 | 3300018090 | Tropical Peatland | FREVTREGRERMFKILEYVQKTTAYYNSRYFESLLKR |
| Ga0210399_102721731 | 3300020581 | Soil | FKELNREAKEKMYRILEHVQKTNTFYNNRYFENLLKR |
| Ga0210399_103968912 | 3300020581 | Soil | AIQFREMNREGRERMFKILEFVQKTTTFYNNRYLNSLTKG |
| Ga0210401_108501192 | 3300020583 | Soil | DAEGYVARMDPGSGIAVQFKELNREAKERMYRILEHVQKTNTFYNNRYFENLLKR |
| Ga0210404_106090932 | 3300021088 | Soil | VGVAVQFKETNREGREKMLKILEYVQKTTTFYNNRYFEGLLKK |
| Ga0210404_107853141 | 3300021088 | Soil | VQFRELNREARERMFRVLEFVQKTTTFYNNRYLDSLTKN |
| Ga0210383_111709651 | 3300021407 | Soil | KAEGVVARLDPGSGIAVQFREMNREARDRMFKILEFVQKTTTFYNNRYLDSLTKT |
| Ga0210394_117391261 | 3300021420 | Soil | VQFKETNREGREKMLKILEYVQRTTTFYNNRYFEGLLKR |
| Ga0210391_102578541 | 3300021433 | Soil | ELNREGRERMLKILEFVQKTTTFYNNRYLSSLTKT |
| Ga0210391_107653621 | 3300021433 | Soil | VAVQFREVNREGRERMFKILEFVQKTTTFYNNRYLDSLTKS |
| Ga0210391_109860792 | 3300021433 | Soil | PGVGVAVQFKETNREGREKMLKILEYVQKTTTFYNNRYFEGLLKR |
| Ga0210391_114954741 | 3300021433 | Soil | ARLDPGTGVAVQFKEVNREGRERMFKILEFVQKTTTFYNNRYLDSLTKS |
| Ga0187846_101988581 | 3300021476 | Biofilm | TRLDPGSGVAVQFREMNREARERMFRILEFVQKTTTFFNNRYLDSLTKS |
| Ga0210398_109419292 | 3300021477 | Soil | TAEGVVARLDPGTGVAVQFREVNREGRERMFKILEFVQKTTTFYNNRYLDSLTKS |
| Ga0210402_105846031 | 3300021478 | Soil | QFREMNREGRDRMFKILEFVQKTTTFHNNRYFENLTKR |
| Ga0210402_119624192 | 3300021478 | Soil | LDPGSGIAVQFREMNREGRDRMFKILEFVQKTTTFFNNRYLDSLTKS |
| Ga0210402_120307011 | 3300021478 | Soil | VQFQEMNREARAQMFKILEFVQKTTAFYNNRYFENLLKR |
| Ga0210410_115340341 | 3300021479 | Soil | GIAVQFKELNREAKEKMYRILEHVQKTNTFYNNRYFENLLKR |
| Ga0126371_120088711 | 3300021560 | Tropical Forest Soil | GVVMRLDPGSGVAVQFHELNREARERMFRIIEFVQKTTSFYNKRYLDSLARN |
| Ga0212123_104490721 | 3300022557 | Iron-Sulfur Acid Spring | DPGVGVAVQFKETNREGREKMLKILEYVQRTTTFYNNRYFEGLLKR |
| Ga0224563_10080261 | 3300022731 | Soil | EGVVARIDPGVGVAVQFKETNREGREKMLKILEYVQRTTTFYNNRYFEGLLKR |
| Ga0224547_10116061 | 3300023255 | Soil | AEGVVARLDPGSGLAIQFREMNREGRERMLKVLEFVQKTTTFYNNRYLNSLTKS |
| Ga0209171_106321642 | 3300025320 | Iron-Sulfur Acid Spring | VGVAVQFKETNREGREKMLKILEYVQRTTTFYNNRYFEGLLKR |
| Ga0209176_101183731 | 3300025854 | Arctic Peat Soil | PGTGVAVQFREVNREGRERMFKILEFVQKTTTFYNNRYLDSLTKS |
| Ga0207699_112197042 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | SGVAVQFREMNREARERMFRVLEFVQKSTTYFNNRYLSSLTKS |
| Ga0207707_109944981 | 3300025912 | Corn Rhizosphere | ELNREARDRMFRIIEFVQKSTSFYNKRYLDSLAKS |
| Ga0207700_109527651 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VVARLDPGSGVAVQFREMNREGRERMFKILEFVQKTTTFFNNRYLDSLKKS |
| Ga0207700_117510731 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | FREVNREGRERMFKILEFVQKSTTFYNNRYFENLTKR |
| Ga0207665_106777001 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | GLVMRLDPGSGLAVQFPELNREARDRMFRIIEFVQKSTSFYNKRYLDSLAKS |
| Ga0207665_107785911 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VVAVQFREMNREARERMFKVLEFVQKTTTFYNNRYLDSLTKS |
| Ga0207781_10155071 | 3300026890 | Tropical Forest Soil | VARLDPGSGIAIQFREMNREGRERMFRILEFVQKTTTYYNNRYIDSLSKI |
| Ga0207741_10212282 | 3300026941 | Tropical Forest Soil | ARLDPGSGIAIQFREMNREGRERMFRILEFVQKTTTYYNNRYIDSLSKI |
| Ga0209008_11406912 | 3300027545 | Forest Soil | ARLDPGCGLAIQFREMNREGRERMLKVLEFVQKTTTFYNNRYLSSLTKS |
| Ga0209115_10566871 | 3300027567 | Forest Soil | SGIAVQFREMNREGRERMFRILEFVQKTTSFYNKRYLDSLTKT |
| Ga0208988_10884751 | 3300027633 | Forest Soil | ARIDPGSGIAVQFKEPNREGREKMFKILEHVQKSTAFYNNRYFENLLKR |
| Ga0209580_100968011 | 3300027842 | Surface Soil | EMNREARERMFRVLEFVQKSTTYFNNRYLSSLTKS |
| Ga0209580_102083433 | 3300027842 | Surface Soil | GLAVQFRELNREGRERMLKILEFVQKTTTFYNNRYLSSLTKS |
| Ga0209580_105722252 | 3300027842 | Surface Soil | SGAAVQFRELNREARERMFRVLEFVQKTTTFYNNRYLDSLTNN |
| Ga0209415_101733004 | 3300027905 | Peatlands Soil | FREMNREGRERMFKILEFVQKTTTFYNNRYLDSLTKT |
| Ga0209006_106161761 | 3300027908 | Forest Soil | KELNREGRVRMLKILEYVRKTSAFYDSRYFASLLKR |
| Ga0302234_103821681 | 3300028773 | Palsa | GVAVQFREMNREGRERMFKILEFVQKTTTFYNNRYLNSLTKS |
| Ga0302222_100428761 | 3300028798 | Palsa | PGSGVAVQFREMNREGRERMFKILEFVQKTTTFYNNRYLNSLTKS |
| Ga0302180_101248351 | 3300031028 | Palsa | GSGVAVQFREMNREGRERMFKILEFVQKTTTFYNNRYLNSLTKS |
| Ga0302180_103974402 | 3300031028 | Palsa | IVARLEPGSGVAVEFVEMNREGREKMFKILEFVQKTSTFFNNRYLDSLARK |
| Ga0170820_134926362 | 3300031446 | Forest Soil | EVNREGRERMFKILEVVQKTTAYYNNRYFEGLLKR |
| Ga0310915_111119522 | 3300031573 | Soil | AAVQFREMNREARDRMFRILEFVQKANSFYNNKYLDSLTRN |
| Ga0318542_104006241 | 3300031668 | Soil | GFVTRLDPGSGAAVQFREMNREARDRMFRILEFVQKANSFYNNKYLDSLTRN |
| Ga0318561_103709722 | 3300031679 | Soil | VQFREMNREARDRMFRIIEFVQKTTTFYNNRYLDSLTRN |
| Ga0307476_107217292 | 3300031715 | Hardwood Forest Soil | RLDPGSGVAVQFRELNREGRERMLKILEFVQKTTTFYNNRYLNSLTKN |
| Ga0307477_103924791 | 3300031753 | Hardwood Forest Soil | VAVQFREVNREGREKMFKIMEFVQKSTTFYNNRYFENLLKR |
| Ga0307478_113971691 | 3300031823 | Hardwood Forest Soil | REMNREGRERMFKILEFVQKTTTFYNNRYLDSLTKM |
| Ga0310909_105126581 | 3300031947 | Soil | DPGSGAAIQFREMNREARDRMFKILEFVQKTTSFYNNRYLDSLTKN |
| Ga0307479_100562615 | 3300031962 | Hardwood Forest Soil | PGSGIAVQFKELNREAKEKMYRILEHVQKTNTFYNNRYFENLLKR |
| Ga0306922_105193472 | 3300032001 | Soil | GAAVQFREMNREARDRMFRIIEFVQKTTTFYNNRYLDSLTRN |
| Ga0307471_1008223271 | 3300032180 | Hardwood Forest Soil | AVQFKELNREAKEKMYRILEHVQKTNTFYNNRYFENLLKR |
| Ga0306920_1040539271 | 3300032261 | Soil | VNRLDPGSGVAVQFREMNREARDRMFRVLEFVQKTTTFYNNRYLDSLTKN |
| Ga0335085_115176761 | 3300032770 | Soil | VARLDPGSGVAVQFRELNREGRERMFRILEFVQKTTTFYNNRYLDTLAKN |
| Ga0335079_100344425 | 3300032783 | Soil | DPGSGVAVQFREMNREGRERMFKILEFVQKTTTFYNNRYLDSLTKN |
| Ga0335080_114069122 | 3300032828 | Soil | GFVNRLDPGSGVAVQFREMNREARDRMFRILEFVQKTTTFYNNRYLDSLAKN |
| Ga0335084_100827543 | 3300033004 | Soil | TRLDPGSGIAVQFREMNREARDRMFKILEFVQKTTTFYNNRYLDSLTKS |
| Ga0335084_100957103 | 3300033004 | Soil | IAVQFREMNREARDRMFKILEFVQKSTSFYNNRYLDSLTKN |
| Ga0326727_111909511 | 3300033405 | Peat Soil | GVAVQFREVNREGRERMFKILEFVQKATAFYNNRYFENLLKR |
| Ga0326726_112780401 | 3300033433 | Peat Soil | AVQFREMNREARERMFRILEFVQKANSFYNNRYLDSLTRN |
| Ga0316214_10640111 | 3300033545 | Roots | ARIDPGVGVAVQFKETNREGREKMLKILEYVQRTTTFYNNRYFEGLLKR |
| Ga0334790_161501_2_154 | 3300033887 | Soil | VARLDPGTGVAVQFREVNREGRERMFKILEFVQKTTTFYNNRYLDSLTKS |
| ⦗Top⦘ |